From 3b66e9c129b2346feb354099bef20a238928e207 Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 19 Mar 2025 13:08:08 +0100 Subject: [PATCH 01/83] modified --- README.md | 6 +++++- install.sh | 3 ++- pip_requirements.txt | 5 +++-- run_utils.py | 26 +++++++++++++++++++++++--- utils/processing_functions.py | 2 +- 5 files changed, 34 insertions(+), 8 deletions(-) diff --git a/README.md b/README.md index ddd0a9ff0..3bb9a4864 100644 --- a/README.md +++ b/README.md @@ -32,6 +32,8 @@ Follow these steps to set up PMGen on your system: ```bash git clone https://github.com/AmirAsgary/PMGen.git cd PMGen + conda init bash + source ~/.bashrc bash -l install.sh conda activate PMGen ``` @@ -43,7 +45,9 @@ Follow these steps to set up PMGen on your system: Edit `user_setting.py` to adjust netMHCpan and netMHCIIpan installation paths. - +2. **Tip for installing NetMHCpan**: + - NetMHCpan requires tcsh to be installed. You can install it using `sudo apt-get install tcsh`. + - read the readme file in `netMHCpan` folder and follow instructions. ## Usage diff --git a/install.sh b/install.sh index d47dfdc11..998610e8e 100755 --- a/install.sh +++ b/install.sh @@ -81,7 +81,8 @@ else fi # Activate the environment -$ACTIVATE_CMD "$ENV_NAME" +source "$(conda info --base)/etc/profile.d/conda.sh" +conda activate "$ENV_NAME" # Step 5: Clone and Install PANDORA echo "✔ Cloning and installing PANDORA..." diff --git a/pip_requirements.txt b/pip_requirements.txt index 11a63105e..150ed15e3 100644 --- a/pip_requirements.txt +++ b/pip_requirements.txt @@ -16,5 +16,6 @@ toolz==1.0.0 torch==1.10.1 typing-extensions==3.7.4.3 urllib3==1.26.14 - - +Levenshtein==0.27.1 +tqdm==4.67.1 +pyarrow==19.0.1 \ No newline at end of file diff --git a/run_utils.py b/run_utils.py index a7abd1e96..401ddf674 100644 --- a/run_utils.py +++ b/run_utils.py @@ -15,6 +15,7 @@ import pandas as pd import subprocess import warnings + warnings.filterwarnings("ignore", category=FutureWarning) @@ -790,8 +791,27 @@ def protein_mpnn_wrapper(output_pdbs_dict, args, max_jobs, mode='parallel'): raise ValueError("Invalid mode! Choose 'parallel' or 'single'.") -def run_and_parse_netmhcpan(peptide_fasta_file, mhc_type, output_dir, mhc_seq_list=[], mhc_allele=None, +def run_and_parse_netmhcpan(peptide_fasta_file, mhc_type, output_dir, mhc_seq_list=None, mhc_allele=None, dirty_mode=False): + """ + Runs the NetMHCpan tool and parses its output. + + Args: + peptide_fasta_file (str): Path to the FASTA file containing peptide sequences. + mhc_type (int): Type of MHC (1 for MHC-I, 2 for MHC-II). + output_dir (str): Directory to save the output files. + mhc_seq_list (list, optional): List of MHC sequences. Default is an empty list. + mhc_allele (str, optional): Specific MHC allele name. Default is None. + dirty_mode (bool, optional): If True, removes the raw output file after parsing. Default is False. + + Returns: + pd.DataFrame: DataFrame containing the parsed NetMHCpan output. + + Raises: + ValueError: If neither `mhc_seq_list` nor `mhc_allele` is provided. + """ + if mhc_seq_list is None: + mhc_seq_list = [] assert mhc_type in [1,2] if not mhc_allele and len(mhc_seq_list) == 0: raise ValueError(f'at least one of mhc_seq_list or mhc_allele should be provided') @@ -810,7 +830,7 @@ def run_and_parse_netmhcpan(peptide_fasta_file, mhc_type, output_dir, mhc_seq_li f'with the Alpha/Beta order ' f'found {len(mhc_seq_list)}: {mhc_seq_list}') else: - assert len(mhc_allele.split('/'))==2, (f'mhc_allele for mhc class 2, should contant both alpha and beta alleles seperated by "/"' + assert len(mhc_allele.split('/'))==2, (f'mhc_allele for mhc class 2, should contain both alpha and beta alleles seperated by "/"' f'\n example: DRA/DRB*01. found {mhc_allele}') mhc_seq_list = ['', ''] @@ -820,7 +840,7 @@ def run_and_parse_netmhcpan(peptide_fasta_file, mhc_type, output_dir, mhc_seq_li a = processing_functions.match_inputseq_to_netmhcpan_allele(mhc_seq_list[i], mhc_type, allele) matched_allele.append(a) if mhc_type == 1: break - print("Matched Alleles", matched_allele) + # print("Matched Alleles", matched_allele) processing_functions.run_netmhcpan(peptide_fasta_file, matched_allele, outfile, mhc_type) df = processing_functions.parse_netmhcpan_file(outfile) df.to_csv(outfile_csv, index=False) diff --git a/utils/processing_functions.py b/utils/processing_functions.py index 6e471ab7e..c0ea4f83b 100644 --- a/utils/processing_functions.py +++ b/utils/processing_functions.py @@ -1027,7 +1027,7 @@ def run_netmhcpan(peptide_fasta, allele_list, output, mhc_type, final_allele += allele if 'DQB' in allele or 'DPB' in allele: final_allele += f'-{allele.replace("HLA-", "")}' - print(allele) + # print(allele) cmd = [str(netmhciipan_path), '-f', str(peptide_fasta), '-BA', '-u', '-s', '-length', '9,10,11,12,13,14,15,16,17,18', '-inptype', '0', '-a', str(final_allele)] From 9f734f6efbc58938c3af30d077de241f15090156 Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 19 Mar 2025 13:08:37 +0100 Subject: [PATCH 02/83] added --- run_netmhcpan_script.py | 412 ++++++++++++++++++++++++++++++++++++++++ 1 file changed, 412 insertions(+) create mode 100644 run_netmhcpan_script.py diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py new file mode 100644 index 000000000..e688e766a --- /dev/null +++ b/run_netmhcpan_script.py @@ -0,0 +1,412 @@ +import json +import sys + +from run_utils import run_and_parse_netmhcpan +import os +import pandas as pd +import numpy as np +from tqdm import tqdm +import pyarrow as pa +import pyarrow.parquet as pq +from datetime import datetime +import multiprocessing +from functools import partial +from concurrent.futures import ProcessPoolExecutor + + +""" +Guide to run the script: +1. Run the script with the argument process_data to process the data + - arg1: process_data arg2: None +2. Run the script with the argument run_netmhcpan to run the NetMHCpan for the processed data + - arg1: run_netmhcpan arg2: chunk_number (0-9) +3. Run the script with the argument combine_results to combine the results from the NetMHCpan runs + - arg1: combine_results arg2: None + +""" + + +def load_data(path): + data = pd.read_csv(path, delim_whitespace=True, header=None) + return data + + +def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", + tmp_path = "data/NetMHCpan_dataset/tmp/"): + """ + Load and process MHCII data for NetMHCpan + This function works for only HLA inputs + Args: + mhcII_path: + tmp_path: + + Returns: + + """ + + if not os.path.isdir(tmp_path): + os.mkdir(tmp_path) + + el_data = pd.DataFrame(columns=["peptide", "label", "allele", "core"]) + ba_data = pd.DataFrame(columns=["peptide", "label", "allele", "core"]) + + # Check directory exists + if not os.path.exists(mhcII_path): + print(f"Directory not found: {mhcII_path}") + return + + train_files = [f for f in os.listdir(mhcII_path) if "train" in f] + print(f"Found {len(train_files)} train files") + + for file in tqdm(train_files): + if "BA" in file or "ba" in file: + data = load_data(mhcII_path + file) + print(f"Loaded BA data from {file}: {ba_data.shape}") + + # Rename columns if necessary + if data.shape[1] >= 4: + data.columns = ["peptide", "label", "allele", "core"] + list(range(data.shape[1] - 4)) + # add ba data to the dataframe + ba_data = pd.concat([ba_data, data], ignore_index=True) + else: + print(f"Warning: File {file} has insufficient columns: {data.shape[1]}") + + elif "EL" in file or "el" in file: + data = load_data(mhcII_path + file) + print(f"Loaded EL data from {file}: {data.shape}") + + # Rename columns if necessary + if data.shape[1] >= 4: # Ensure data has enough columns + data.columns = ["peptide", "label", "allele", "core"] + list(range(data.shape[1] - 4)) + # add el data to the dataframe + el_data = pd.concat([el_data, data], ignore_index=True) + else: + print(f"Warning: File {file} has insufficient columns: {data.shape[1]}") + else: + # skip the file and print a warning + print(f"Skipping file: {file}") + + print(f"After loading data: {el_data.shape}") + if el_data.empty: + print("No data was loaded. Check file paths and content.") + return + + # get the cell lines rows, drop the rows that has HLA- in their allele column + el_data = el_data[el_data["allele"].str.contains("HLA-") == False] + print(f"After removing HLA- rows: {el_data.shape}") + + ## drop rows with the same allele and peptide (1) + el_data = el_data.drop_duplicates(subset=["allele", "peptide"], keep="first") + print(f"After removing duplicates: {el_data.shape}") + + ## get allele names of cell lines + allelelist = mhcII_path + "allelelist.txt" # change to allelelist for MHCI + + # Check if allele list file exists + if not os.path.exists(allelelist): + print(f"Allele list file not found: {allelelist}") + return + + allele_map = pd.read_csv(allelelist, delim_whitespace=True, header=None) + allele_map.columns = ["key", "allele_list"] + print(f"Loaded allele map with {len(allele_map)} entries") + + # convert the second column to list if , is present, else return a one element list + allele_map["allele_list"] = allele_map["allele_list"].apply(lambda x: x.split(",") if "," in x else [x]) + + # Create a dictionary for more efficient lookup + allele_dict = dict(zip(allele_map["key"], allele_map["allele_list"])) + + # update the el_data['allele'] dataframe with the allele names + el_data["allele"] = el_data["allele"].apply(lambda x: allele_dict.get(x, [])) + print(f"After mapping alleles: {el_data.shape}") + + # Check if any allele mappings are empty + empty_alleles = el_data[el_data["allele"].apply(lambda x: len(x) == 0)].shape[0] + print(f"Rows with empty allele mappings: {empty_alleles}") + + # decouple rows with multiple alleles, if the row['allele'] has multiple alleles, then create a new row for each allele + el_data = el_data.explode("allele") + print(f"After exploding alleles: {el_data.shape}") + + # First add DRA/ before the allele names for alleles with DRB + el_data["allele"] = el_data["allele"].apply(lambda x: "HLA-DRA/HLA-" + x if "DRB" in x else x) + + # all DRB alleles should have HLA-DRA/ in front of them, assert this + assert el_data[el_data["allele"].apply(lambda x: "DRB" in x and "HLA-DRA/HLA-" not in x)].empty + + # if H-2 is present in the allele name, add a mice-DRA/mice- in front of it + el_data["allele"] = el_data["allele"].apply(lambda x: "mice-DRA/mice-" + x if "H-2" in x else x) + + # split double alleles with / + # if / not in allele name, replace the second - with / + el_data["allele"] = el_data["allele"].apply( + lambda x: x[:x.find("-", x.find("-") + 1)] + "/HLA-" + x[x.find("-", x.find("-") + 1) + 1:] if x.count("-") >= 2 and "/" not in x else x) + + # split to two variables, one with labels = 0 and one with labels = 1 + el_data_0 = el_data[el_data["label"] == 0] + el_data_1 = el_data[el_data["label"] == 1] + + # drop the labels column from el_data_1 + el_data_1 = el_data_1.drop(columns=["label"]) + print(f"Data with label 0: {el_data_0.shape}") + + # Print some sample data for debugging + print(el_data_1.head()) + + # drop the rows with the same allele and peptide (2) + el_data_1 = el_data_1.drop_duplicates(subset=["allele", "peptide"], keep="first") + print(f"After removing duplicates: {el_data_1.shape}") + + # Verify that "/" is present in all allele names + invalid_alleles = el_data_0[el_data_0["allele"].apply(lambda x: "/" not in x)] + if not invalid_alleles.empty: + print("Alleles without '/' separator:") + print(invalid_alleles) + + # Get unique alleles and run NetMHCpan for each + unique_alleles = el_data_0["allele"].unique() + print(f"Processing {len(unique_alleles)} unique alleles") + + return el_data_0, el_data_1, unique_alleles, ba_data + + +def run_netmhcpan(el_data_1, unique_alleles, tmp_path, results_dir): + for allele in unique_alleles: + # Filter data for the current allele + allele_data = el_data_1[el_data_1["allele"] == allele] + + # Create allele-specific filename base + allele_filename = allele.replace("/", "_").replace("*", "").replace(":", "") + + # Get peptides + peptides = allele_data['peptide'].values + print(f"Total peptides for {allele}: {len(peptides)}") + + # Remove duplicate peptides + unique_peptides = np.unique(peptides) + print(f"Unique peptides for {allele}: {len(unique_peptides)}") + + # Process each peptide individually + for peptide_idx, peptide in enumerate(unique_peptides): + # Check if this peptide was already processed + with open(os.path.join(results_dir, "processed_peptides.txt"), "r") if os.path.exists( + os.path.join(results_dir, "processed_peptides.txt")) else open(os.devnull, "r") as f: + processed = any(f"{allele}\t{peptide}\n" == line for line in f) + if processed: + continue + + # Use a timestamp to ensure unique filenames across processes + timestamp = datetime.now().strftime("%Y%m%d%H%M%S%f") + unique_id = f"{peptide_idx}_{timestamp}" + + # Create fasta file with single peptide + peptide_fasta_path = os.path.join(tmp_path, f"results/el0_peptide_{allele_filename}_{unique_id}.fasta") + + # Write single peptide to fasta file + with open(peptide_fasta_path, "w") as f: + f.write(f">peptide\n{peptide}\n") + + # Output directory for this specific peptide + output_dir = os.path.join(tmp_path, f"results/el0_output_{allele_filename}_{unique_id}") + + try: + # Run NetMHCpan for this specific peptide + allele_result = run_and_parse_netmhcpan( + peptide_fasta_file=peptide_fasta_path, + mhc_type=2, + output_dir=output_dir, + mhc_allele=allele + ) + + # Save results to disk immediately + if allele_result is not None: + # take the top 1 results + allele_result = allele_result.head(1) # TODO check later + result_path = os.path.join(results_dir, f"{allele_filename}.parquet") + new_table = pa.Table.from_pandas(allele_result) + if os.path.exists(result_path): + existing_table = pq.read_table(result_path) + combined_table = pa.concat_tables([existing_table, new_table]) + pq.write_table(combined_table, result_path) + else: + pq.write_table(new_table, result_path) + + with open(os.path.join(results_dir, "processed_peptides.txt"), "a") as processed_file: + processed_file.write(f"{allele}\t{peptide}\n") + + except Exception as e: + print(f"Error processing peptide {peptide} with allele {allele}: {str(e)}") + finally: + # Clean up temporary files immediately + try: + if os.path.exists(peptide_fasta_path): + os.remove(peptide_fasta_path) + if os.path.exists(output_dir) and os.path.isdir(output_dir): + import shutil + shutil.rmtree(output_dir) + except Exception as e: + print(f"Failed to remove temporary files: {str(e)}") + + +def combine_results(results_dir, final_output_path): + # Combine all parquet files at the end + try: + all_parquet_files = [os.path.join(results_dir, f) for f in os.listdir(results_dir) if f.endswith('.parquet')] + if all_parquet_files: + print(f"Combining {len(all_parquet_files)} parquet files into final output") + # Read and combine all parquet files + tables = [] + for parquet_file in all_parquet_files: + table = pq.read_table(parquet_file) + tables.append(table) + + if tables: + combined_table = pa.concat_tables(tables) + pq.write_table(combined_table, final_output_path) + df = combined_table.to_pandas() + + # Standardize column names + if 'Peptide' in df.columns and 'peptide' not in df.columns: + df['peptide'] = df['Peptide'] + elif 'Peptide' in df.columns and 'peptide' in df.columns: + df['peptide'] = df['peptide'].fillna(df['Peptide']) + + if 'MHC' in df.columns and 'allele' not in df.columns: + df['allele'] = df['MHC'] + elif 'MHC' in df.columns and 'allele' in df.columns: + df['allele'] = df['allele'].fillna(df['MHC']) + + # Calculate label from Score_EL if label is empty or doesn't exist + if 'label' not in df.columns: + if 'Score_EL' in df.columns: + df['label'] = df['Score_EL'].apply(lambda x: 1 if x > 0.428 else 0) # TODO Threshold can be adjusted + else: + df['label'] = None + + # Keep only required columns + keep_cols = ["allele", "peptide", "label"] + existing_cols = [col for col in keep_cols if col in df.columns] + df = df[existing_cols] + + print(f"Combined results shape: {df.shape}") + print(f"Final output saved to: {final_output_path}") + else: + df = pd.DataFrame(columns=["allele", "peptide", "label"]) + print("No results were found in parquet files") + else: + df = pd.DataFrame(columns=["allele", "peptide", "label"]) + print("No parquet files were generated") + except Exception as e: + print(f"Error combining parquet files: {str(e)}") + df = pd.DataFrame(columns=["allele", "peptide", "label"]) + + # Remove the results directory is commented out + # try: + # import shutil + # if os.path.exists(results_dir) and os.path.isdir(results_dir): + # shutil.rmtree(results_dir) + # print(f"Removed results directory: {results_dir}") + # except Exception as e: + # print(f"Error removing results directory: {str(e)}") + + return df + + +def parallelize_netmhcpan(el_data_1, unique_alleles, tmp_path, results_dir): + with ProcessPoolExecutor() as executor: + tasks = [] + for allele in unique_alleles: + subset_data = el_data_1[el_data_1["allele"] == allele] + tasks.append(executor.submit(run_netmhcpan, subset_data, [allele], tmp_path, results_dir)) + for task in tasks: + task.result() + +def run_(arg1, arg2): + mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/" + tmp_path = "data/NetMHCpan_dataset/tmp/" + results_dir = "data/NetMHCpan_dataset/tmp/results/" + final_output_path = "data/NetMHCpan_dataset/tmp/combined_results.parquet" + + # make results directory + if not os.path.isdir(results_dir): + os.mkdir(results_dir) + + if arg1 == "process_data": + ######################## + # Load data + el_data_0, el_data_1, unique_alleles, ba_data = process_data( + mhcII_path=mhcII_path, + tmp_path=tmp_path) + + # save the variables + el_data_0.to_csv("data/NetMHCpan_dataset/tmp/el_data_0.csv", index=False) + el_data_1.to_csv("data/NetMHCpan_dataset/tmp/el_data_1.csv", index=False) + ba_data.to_csv("data/NetMHCpan_dataset/tmp/ba_data.csv", index=False) + params = { + "unique_alleles": unique_alleles.tolist() if hasattr(unique_alleles, "tolist") else unique_alleles, + "tmp_path": tmp_path, + "results_dir": results_dir + } + with open("data/NetMHCpan_dataset/tmp/params.json", "w") as f: + json.dump(params, f) + + # split el_data to 10 chunks and save seperately + chunk_size = len(el_data_1) // 10 + for i in range(10): + el_data_1_chunk = el_data_1.iloc[i * chunk_size: (i + 1) * chunk_size] + el_data_1_chunk.to_csv(f"data/NetMHCpan_dataset/tmp/el_data_1_chunk_{i}.csv", index=False) + ######################## + + if arg1 == "run_netmhcpan": + # load the variables and parameters from JSON files + with open("data/NetMHCpan_dataset/tmp/params.json", "r") as f: + params = json.load(f) + unique_alleles = np.array(params["unique_alleles"]) + tmp_path = params["tmp_path"] + results_dir = params["results_dir"] + + # load the variables + + el_data_1 = pd.read_csv( + f"data/NetMHCpan_dataset/tmp/el_data_1_chunk_{arg2}.csv") + + # print the len of el_data_1 + print(f"Length of el_data_1: {len(el_data_1)}") + + # subset 1000 random samples from the data for testing + # el_data_1 = el_data_1.sample(n=100, random_state=42) + + # Run NetMHCpan in parallel + parallelize_netmhcpan(el_data_1, unique_alleles, tmp_path, results_dir) + + if arg1 == "combine_results": + # Combine results + df = combine_results(results_dir, final_output_path) + + el_data_0 = pd.read_csv("data/NetMHCpan_dataset/tmp/el_data_0.csv") + ba_data = pd.read_csv("data/NetMHCpan_dataset/tmp/ba_data.csv") + + # concatenate the dataframes df and el_data_0 and ba_data + df = pd.concat([df, el_data_0], ignore_index=True) + df = pd.concat([df, ba_data], ignore_index=True) + + # save the final output + df.to_csv("data/NetMHCpan_dataset/tmp/NetMHCIIpan_all.csv", index=False) + +def main(): + if len(sys.argv) < 1: + print("Usage: python script1.py (only required when running run_netmhcpan)") + sys.exit(1) + + if sys.argv[1] not in ["process_data", "run_netmhcpan", "combine_results"]: + print("Invalid argument. Please specify one of the following: process_data, run_netmhcpan, combine_results") + + if sys.argv[1] == "run_netmhcpan": + run_(sys.argv[1], sys.argv[2]) + + else: + run_(sys.argv[1], None) + +if __name__ == "__main__": + main() \ No newline at end of file From f79a33a296363bdd0e05810a6e1341ae4fd2fa95 Mon Sep 17 00:00:00 2001 From: Amirreza-0 Date: Sun, 23 Mar 2025 17:13:13 +0100 Subject: [PATCH 03/83] checking for False Negatives --- run_netmhcpan_script.py | 48 ++++++++++++++++++++++++++++++----------- 1 file changed, 35 insertions(+), 13 deletions(-) diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py index e688e766a..5485a9ebf 100644 --- a/run_netmhcpan_script.py +++ b/run_netmhcpan_script.py @@ -125,10 +125,16 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", empty_alleles = el_data[el_data["allele"].apply(lambda x: len(x) == 0)].shape[0] print(f"Rows with empty allele mappings: {empty_alleles}") + # add the identifiers + el_data['cell_line_id'] = el_data.index + # decouple rows with multiple alleles, if the row['allele'] has multiple alleles, then create a new row for each allele el_data = el_data.explode("allele") print(f"After exploding alleles: {el_data.shape}") + # reset index for unique identifier + el_data = el_data.reset_index(drop=True) + # First add DRA/ before the allele names for alleles with DRB el_data["allele"] = el_data["allele"].apply(lambda x: "HLA-DRA/HLA-" + x if "DRB" in x else x) @@ -148,7 +154,7 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", el_data_1 = el_data[el_data["label"] == 1] # drop the labels column from el_data_1 - el_data_1 = el_data_1.drop(columns=["label"]) + # el_data_1 = el_data_1.drop(columns=["label"]) print(f"Data with label 0: {el_data_0.shape}") # Print some sample data for debugging @@ -196,6 +202,9 @@ def run_netmhcpan(el_data_1, unique_alleles, tmp_path, results_dir): if processed: continue + # get the cell_line_id + cell_line_id = allele_data[allele_data["peptide"] == peptide]["cell_line_id"].iloc[0] + # Use a timestamp to ensure unique filenames across processes timestamp = datetime.now().strftime("%Y%m%d%H%M%S%f") unique_id = f"{peptide_idx}_{timestamp}" @@ -221,10 +230,13 @@ def run_netmhcpan(el_data_1, unique_alleles, tmp_path, results_dir): # Save results to disk immediately if allele_result is not None: - # take the top 1 results - allele_result = allele_result.head(1) # TODO check later + # take the top 1 result + allele_result = allele_result.head(1) # taking the first row, because the output is sorted by BF score and we take the best score result_path = os.path.join(results_dir, f"{allele_filename}.parquet") new_table = pa.Table.from_pandas(allele_result) + # add long_mer + new_table['long_mer'] = peptide + new_table['cell_line_id'] = cell_line_id if os.path.exists(result_path): existing_table = pq.read_table(result_path) combined_table = pa.concat_tables([existing_table, new_table]) @@ -280,10 +292,29 @@ def combine_results(results_dir, final_output_path): # Calculate label from Score_EL if label is empty or doesn't exist if 'label' not in df.columns: if 'Score_EL' in df.columns: - df['label'] = df['Score_EL'].apply(lambda x: 1 if x > 0.428 else 0) # TODO Threshold can be adjusted + df['label'] = df['Score_EL'].apply(lambda x: 1 if x > 0.426 else 0) # Threshold can be adjusted else: df['label'] = None + # for each unique df["cell_line_id"], if at least one row has label == 1 continue, else drop them and save them in a seperate file + if 'cell_line_id' in df.columns and 'label' in df.columns: + # Create a mask for cell lines with at least one positive label + positive_cell_lines = df.groupby('cell_line_id')['label'].max() == 1 + positive_cell_lines = positive_cell_lines[positive_cell_lines].index.tolist() + + # Filter rows + mask = df['cell_line_id'].isin(positive_cell_lines) + dropped_df = df[~mask].copy() + df = df[mask].copy() + + # Save dropped rows to separate file if there are any + if not dropped_df.empty: + dropped_output_path = final_output_path.replace('.parquet', '_dropped.parquet') + pq.write_table(pa.Table.from_pandas(dropped_df), dropped_output_path) + print( + f"Dropped {dropped_df.shape[0]} rows from {len(set(dropped_df['cell_line_id']))} cell lines with no positive labels") + print(f"Dropped rows saved to: {dropped_output_path}") + # Keep only required columns keep_cols = ["allele", "peptide", "label"] existing_cols = [col for col in keep_cols if col in df.columns] @@ -301,15 +332,6 @@ def combine_results(results_dir, final_output_path): print(f"Error combining parquet files: {str(e)}") df = pd.DataFrame(columns=["allele", "peptide", "label"]) - # Remove the results directory is commented out - # try: - # import shutil - # if os.path.exists(results_dir) and os.path.isdir(results_dir): - # shutil.rmtree(results_dir) - # print(f"Removed results directory: {results_dir}") - # except Exception as e: - # print(f"Error removing results directory: {str(e)}") - return df From 74bb74ec568f432609bc7f3b48da5773c3a0f868 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 25 Mar 2025 09:36:31 +0100 Subject: [PATCH 04/83] processing per cell_line_id with a simpler implementation, saving directly onto the disk in a csv file --- .gitignore | 3 +- run_netmhcpan_script.py | 537 ++++++++++++++++++++++++++-------------- run_utils.py | 6 +- user_setting.py | 4 +- 4 files changed, 361 insertions(+), 189 deletions(-) diff --git a/.gitignore b/.gitignore index c996a7c07..573745f98 100644 --- a/.gitignore +++ b/.gitignore @@ -23,4 +23,5 @@ ProteinMPNN/ ProteinMPNN/* ProteinMPNN/examples ProteinMPNN/outputs -ProteinMPNN/.gitignore \ No newline at end of file +ProteinMPNN/.gitignore +user_setting.py \ No newline at end of file diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py index 5485a9ebf..bfe123920 100644 --- a/run_netmhcpan_script.py +++ b/run_netmhcpan_script.py @@ -8,9 +8,7 @@ from tqdm import tqdm import pyarrow as pa import pyarrow.parquet as pq -from datetime import datetime -import multiprocessing -from functools import partial +import shutil from concurrent.futures import ProcessPoolExecutor @@ -126,14 +124,31 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", print(f"Rows with empty allele mappings: {empty_alleles}") # add the identifiers - el_data['cell_line_id'] = el_data.index + # el_data['cell_line_id'] = el_data.index + # print the length of the el_data + # print(f"Length of el_data: {len(el_data)}") # decouple rows with multiple alleles, if the row['allele'] has multiple alleles, then create a new row for each allele - el_data = el_data.explode("allele") - print(f"After exploding alleles: {el_data.shape}") + # el_data = el_data.explode("allele") + # print(f"After exploding alleles: {el_data.shape}") # reset index for unique identifier - el_data = el_data.reset_index(drop=True) + # el_data = el_data.reset_index(drop=True) + + # First add DRA/ before the allele names for alleles with DRB + el_data["allele"] = el_data["allele"].apply(lambda x: ["HLA-DRA/HLA-" + a if "DRB" in a else a for a in x]) + + # all DRB alleles should have HLA-DRA/ in front of them, assert this + assert el_data[el_data["allele"].apply(lambda x: any("DRB" in a and "HLA-DRA/HLA-" not in a for a in x))].empty + + # if H-2 is present in the allele name, add a mice-DRA/mice- in front of it + el_data["allele"] = el_data["allele"].apply(lambda x: ["mice-DRA/mice-" + a if "H-2" in a else a for a in x]) + + # split double alleles with / + # if / not in allele name, replace the second - with / + el_data["allele"] = el_data["allele"].apply( + lambda x: [a[:a.find("-", a.find("-") + 1)] + "/HLA-" + a[a.find("-", a.find("-") + 1) + 1:] if a.count( + "-") >= 2 and "/" not in a else a for a in x]) # First add DRA/ before the allele names for alleles with DRB el_data["allele"] = el_data["allele"].apply(lambda x: "HLA-DRA/HLA-" + x if "DRB" in x else x) @@ -158,11 +173,11 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", print(f"Data with label 0: {el_data_0.shape}") # Print some sample data for debugging - print(el_data_1.head()) + # print(el_data_1.head()) # drop the rows with the same allele and peptide (2) - el_data_1 = el_data_1.drop_duplicates(subset=["allele", "peptide"], keep="first") - print(f"After removing duplicates: {el_data_1.shape}") + # el_data_1 = el_data_1.drop_duplicates(subset=["allele", "peptide"], keep="first") + # print(f"After removing duplicates: {el_data_1.shape}") # Verify that "/" is present in all allele names invalid_alleles = el_data_0[el_data_0["allele"].apply(lambda x: "/" not in x)] @@ -170,185 +185,332 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", print("Alleles without '/' separator:") print(invalid_alleles) - # Get unique alleles and run NetMHCpan for each - unique_alleles = el_data_0["allele"].unique() - print(f"Processing {len(unique_alleles)} unique alleles") - - return el_data_0, el_data_1, unique_alleles, ba_data - + # # Get unique alleles and run NetMHCpan for each + # unique_alleles = el_data_1["allele"].unique() + # print(f"Processing {len(unique_alleles)} unique alleles") -def run_netmhcpan(el_data_1, unique_alleles, tmp_path, results_dir): - for allele in unique_alleles: - # Filter data for the current allele - allele_data = el_data_1[el_data_1["allele"] == allele] + # # get unique cell line ids + # unique_cell_lines = el_data_1["cell_line_id"].unique() + # + # # assert that the cell_line_id is unique + # print(f"Processing {len(unique_cell_lines)} unique cell line ids") - # Create allele-specific filename base - allele_filename = allele.replace("/", "_").replace("*", "").replace(":", "") + return el_data_0, el_data_1, ba_data - # Get peptides - peptides = allele_data['peptide'].values - print(f"Total peptides for {allele}: {len(peptides)}") - # Remove duplicate peptides - unique_peptides = np.unique(peptides) - print(f"Unique peptides for {allele}: {len(unique_peptides)}") +def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number): + # chunk_dataframe = pd.DataFrame(columns=["MHC", "Peptide", "Of", "Core", "Core_Rel", "Inverted", "Identity", "Score_EL", "%Rank_EL", "Exp_Bind", "Score_BA", "%Rank_BA", "Affinity(nM)", "long_mer", "cell_line_id"]) + chunk_df_path = os.path.join(results_dir, f"el{true_label}_chunk_{chunk_number}.csv") + dropped_rows = pd.DataFrame() + dropped_rows_path = os.path.join(results_dir, f"el{true_label}_dropped_rows_{chunk_number}.csv") + for idx, cell_row in tqdm(el_data.iterrows(), total=el_data.shape[0]): + number_of_alleles = len(eval(cell_row["allele"])) + result_data = pd.DataFrame(columns=["MHC", "Peptide", "Of", "Core", "Core_Rel", "Inverted", "Identity", "Score_EL", "%Rank_EL", "Exp_Bind", "Score_BA", "%Rank_BA", "Affinity(nM)", "long_mer", "cell_line_id"]) + peptide = cell_row["peptide"] + for allele in eval(cell_row["allele"]): + # get the unique id for peptide + unique_id = f"{peptide}_{allele}" - # Process each peptide individually - for peptide_idx, peptide in enumerate(unique_peptides): - # Check if this peptide was already processed - with open(os.path.join(results_dir, "processed_peptides.txt"), "r") if os.path.exists( - os.path.join(results_dir, "processed_peptides.txt")) else open(os.devnull, "r") as f: - processed = any(f"{allele}\t{peptide}\n" == line for line in f) - if processed: - continue + # define path + peptide_fasta_path = os.path.join(tmp_path, f"results/el{true_label}_peptide_{unique_id}.fasta") + peptide_fasta_dir = os.path.dirname(peptide_fasta_path) - # get the cell_line_id - cell_line_id = allele_data[allele_data["peptide"] == peptide]["cell_line_id"].iloc[0] - - # Use a timestamp to ensure unique filenames across processes - timestamp = datetime.now().strftime("%Y%m%d%H%M%S%f") - unique_id = f"{peptide_idx}_{timestamp}" - - # Create fasta file with single peptide - peptide_fasta_path = os.path.join(tmp_path, f"results/el0_peptide_{allele_filename}_{unique_id}.fasta") + # Ensure the directory exists + if not os.path.exists(peptide_fasta_dir): + os.makedirs(peptide_fasta_dir) # Write single peptide to fasta file with open(peptide_fasta_path, "w") as f: f.write(f">peptide\n{peptide}\n") - # Output directory for this specific peptide - output_dir = os.path.join(tmp_path, f"results/el0_output_{allele_filename}_{unique_id}") + # Output directory for this specific cell_line_id + output_dir = os.path.join(tmp_path, f"results/el{true_label}_output_{unique_id}") try: # Run NetMHCpan for this specific peptide - allele_result = run_and_parse_netmhcpan( + result_ = run_and_parse_netmhcpan( peptide_fasta_file=peptide_fasta_path, mhc_type=2, output_dir=output_dir, - mhc_allele=allele + mhc_allele=allele, + save_csv=False ) - # Save results to disk immediately - if allele_result is not None: - # take the top 1 result - allele_result = allele_result.head(1) # taking the first row, because the output is sorted by BF score and we take the best score - result_path = os.path.join(results_dir, f"{allele_filename}.parquet") - new_table = pa.Table.from_pandas(allele_result) - # add long_mer - new_table['long_mer'] = peptide - new_table['cell_line_id'] = cell_line_id - if os.path.exists(result_path): - existing_table = pq.read_table(result_path) - combined_table = pa.concat_tables([existing_table, new_table]) - pq.write_table(combined_table, result_path) - else: - pq.write_table(new_table, result_path) - - with open(os.path.join(results_dir, "processed_peptides.txt"), "a") as processed_file: - processed_file.write(f"{allele}\t{peptide}\n") + # select the top 1 result + if result_ is not None and not result_.empty: + result_ = result_.iloc[[0]] + result_['long_mer'] = peptide + result_['cell_line_id'] = str(chunk_number) + "_" + str(idx) + result_data = pd.concat([result_data, result_]) except Exception as e: print(f"Error processing peptide {peptide} with allele {allele}: {str(e)}") - finally: - # Clean up temporary files immediately - try: - if os.path.exists(peptide_fasta_path): - os.remove(peptide_fasta_path) - if os.path.exists(output_dir) and os.path.isdir(output_dir): - import shutil - shutil.rmtree(output_dir) - except Exception as e: - print(f"Failed to remove temporary files: {str(e)}") - - -def combine_results(results_dir, final_output_path): - # Combine all parquet files at the end - try: - all_parquet_files = [os.path.join(results_dir, f) for f in os.listdir(results_dir) if f.endswith('.parquet')] - if all_parquet_files: - print(f"Combining {len(all_parquet_files)} parquet files into final output") - # Read and combine all parquet files - tables = [] - for parquet_file in all_parquet_files: - table = pq.read_table(parquet_file) - tables.append(table) - - if tables: - combined_table = pa.concat_tables(tables) - pq.write_table(combined_table, final_output_path) - df = combined_table.to_pandas() - - # Standardize column names - if 'Peptide' in df.columns and 'peptide' not in df.columns: - df['peptide'] = df['Peptide'] - elif 'Peptide' in df.columns and 'peptide' in df.columns: - df['peptide'] = df['peptide'].fillna(df['Peptide']) - - if 'MHC' in df.columns and 'allele' not in df.columns: - df['allele'] = df['MHC'] - elif 'MHC' in df.columns and 'allele' in df.columns: - df['allele'] = df['allele'].fillna(df['MHC']) - - # Calculate label from Score_EL if label is empty or doesn't exist - if 'label' not in df.columns: - if 'Score_EL' in df.columns: - df['label'] = df['Score_EL'].apply(lambda x: 1 if x > 0.426 else 0) # Threshold can be adjusted - else: - df['label'] = None - - # for each unique df["cell_line_id"], if at least one row has label == 1 continue, else drop them and save them in a seperate file - if 'cell_line_id' in df.columns and 'label' in df.columns: - # Create a mask for cell lines with at least one positive label - positive_cell_lines = df.groupby('cell_line_id')['label'].max() == 1 - positive_cell_lines = positive_cell_lines[positive_cell_lines].index.tolist() - - # Filter rows - mask = df['cell_line_id'].isin(positive_cell_lines) - dropped_df = df[~mask].copy() - df = df[mask].copy() - - # Save dropped rows to separate file if there are any - if not dropped_df.empty: - dropped_output_path = final_output_path.replace('.parquet', '_dropped.parquet') - pq.write_table(pa.Table.from_pandas(dropped_df), dropped_output_path) - print( - f"Dropped {dropped_df.shape[0]} rows from {len(set(dropped_df['cell_line_id']))} cell lines with no positive labels") - print(f"Dropped rows saved to: {dropped_output_path}") - - # Keep only required columns - keep_cols = ["allele", "peptide", "label"] - existing_cols = [col for col in keep_cols if col in df.columns] - df = df[existing_cols] - - print(f"Combined results shape: {df.shape}") - print(f"Final output saved to: {final_output_path}") - else: - df = pd.DataFrame(columns=["allele", "peptide", "label"]) - print("No results were found in parquet files") - else: - df = pd.DataFrame(columns=["allele", "peptide", "label"]) - print("No parquet files were generated") - except Exception as e: - print(f"Error combining parquet files: {str(e)}") - df = pd.DataFrame(columns=["allele", "peptide", "label"]) - - return df + # Clean up temporary files + if os.path.exists(peptide_fasta_path): + os.remove(peptide_fasta_path) + # Get the actual directory path + peptide_fasta_dir = os.path.dirname(peptide_fasta_path) + if os.path.exists(peptide_fasta_dir) and os.path.isdir(peptide_fasta_dir): + try: + shutil.rmtree(peptide_fasta_dir) + except PermissionError: + print(f"Warning: Could not remove directory {peptide_fasta_dir} due to permission error") -def parallelize_netmhcpan(el_data_1, unique_alleles, tmp_path, results_dir): - with ProcessPoolExecutor() as executor: - tasks = [] - for allele in unique_alleles: - subset_data = el_data_1[el_data_1["allele"] == allele] - tasks.append(executor.submit(run_netmhcpan, subset_data, [allele], tmp_path, results_dir)) - for task in tasks: - task.result() + if os.path.exists(output_dir) and os.path.isdir(output_dir): + try: + shutil.rmtree(output_dir) + except PermissionError: + print(f"Warning: Could not remove directory {output_dir} due to permission error") + + # save the results to disk + if not result_data.empty: + assert len(result_data) == number_of_alleles + result_data['label'] = result_data['Score_BA'].apply(lambda x: 1 if eval(x) > 0.426 else 0) + if true_label == 1: + # if at least one label is not 1, select the highest score_BA and set the labels to 1, then save the allele in a list + # Create a mask for cell lines with at least one positive label + positive_cell_lines = result_data.groupby('cell_line_id')['label'].max() == 1 + positive_cell_lines = positive_cell_lines[positive_cell_lines].index.tolist() + # Filter rows + mask = result_data['cell_line_id'].isin(positive_cell_lines) + dropped_df = result_data[~mask].copy() + result_data = result_data[mask].copy() + # Save dropped rows to separate file if there are any + if not dropped_df.empty: + dropped_rows = pd.concat([dropped_rows, dropped_df]) + + # save the results to the chunk_dataframe directly to the disk using append method + result_data.to_csv(chunk_df_path, mode="a", header=not os.path.exists(chunk_df_path), index=False) + dropped_rows.to_csv(dropped_rows_path, index=False) + + + +# def run_netmhcpan(el_data_1, unique_alleles, tmp_path, results_dir): +# for allele in unique_alleles: +# # Filter data for the current allele +# allele_data = el_data_1[el_data_1["allele"] == allele] +# +# # Create allele-specific filename base +# allele_filename = allele.replace("/", "_").replace("*", "").replace(":", "") +# +# # Get peptides +# peptides = allele_data['peptide'].values +# print(f"Total peptides for {allele}: {len(peptides)}") +# +# # Remove duplicate peptides +# unique_peptides = np.unique(peptides) +# print(f"Unique peptides for {allele}: {len(unique_peptides)}") +# +# # Process each peptide individually +# for peptide_idx, peptide in enumerate(unique_peptides): +# # Check if this peptide was already processed +# with open(os.path.join(results_dir, "processed_peptides.txt"), "r") if os.path.exists( +# os.path.join(results_dir, "processed_peptides.txt")) else open(os.devnull, "r") as f: +# processed = any(f"{allele}\t{peptide}\n" == line for line in f) +# if processed: +# continue +# +# # get the cell_line_id +# cell_line_id = allele_data[allele_data["peptide"] == peptide]["cell_line_id"].iloc[0] +# +# # Use a timestamp to ensure unique filenames across processes +# timestamp = datetime.now().strftime("%Y%m%d%H%M%S%f") +# unique_id = f"{peptide_idx}_{timestamp}" +# +# # Create fasta file with single peptide +# peptide_fasta_path = os.path.join(tmp_path, f"results/el0_peptide_{allele_filename}_{unique_id}.fasta") +# +# # Write single peptide to fasta file +# with open(peptide_fasta_path, "w") as f: +# f.write(f">peptide\n{peptide}\n") +# +# # Output directory for this specific peptide +# output_dir = os.path.join(tmp_path, f"results/el0_output_{allele_filename}_{unique_id}") +# +# try: +# # Run NetMHCpan for this specific peptide +# allele_result = run_and_parse_netmhcpan( +# peptide_fasta_file=peptide_fasta_path, +# mhc_type=2, +# output_dir=output_dir, +# mhc_allele=allele +# ) +# +# # Save results to disk immediately +# if allele_result is not None: +# # take the top 1 result +# allele_result = allele_result.head(1) # taking the first row, because the output is sorted by BF score and we take the best score +# result_path = os.path.join(results_dir, f"{allele_filename}.parquet") +# # add long_mer +# allele_result['long_mer'] = peptide +# allele_result['cell_line_id'] = cell_line_id +# new_table = pa.Table.from_pandas(allele_result) +# if os.path.exists(result_path): +# existing_table = pq.read_table(result_path) +# combined_table = pa.concat_tables([existing_table, new_table]) +# pq.write_table(combined_table, result_path) +# else: +# pq.write_table(new_table, result_path) +# +# with open(os.path.join(results_dir, "processed_peptides.txt"), "a") as processed_file: +# processed_file.write(f"{allele}\t{peptide}\n") +# +# except Exception as e: +# print(f"Error processing peptide {peptide} with allele {allele}: {str(e)}") +# finally: +# # Clean up temporary files immediately +# try: +# if os.path.exists(peptide_fasta_path): +# os.remove(peptide_fasta_path) +# if os.path.exists(output_dir) and os.path.isdir(output_dir): +# import shutil +# shutil.rmtree(output_dir) +# except Exception as e: +# print(f"Failed to remove temporary files: {str(e)}") + + +# def combine_results_(results_dir, final_output_path): +# +# for cell_line_id: +# +# pass +# # combine all csv files +# all_csv_files = [os.path.join(results_dir, f) for f in os.listdir(results_dir) if f.endswith('.csv')] +# dropped_rows = pd.DataFrame() +# if all_csv_files: +# print(f"Combining {len(all_csv_files)} csv files into final output") +# df = None +# for csv_file in all_csv_files: +# try: +# df = pd.read_csv(csv_file) +# except Exception as e: +# print(f"Error reading {csv_file}: {str(e)}") +# continue +# if df: +# # Standardize column names +# if 'Peptide' in df.columns and 'peptide' not in df.columns: +# df['peptide'] = df['Peptide'] +# elif 'Peptide' in df.columns and 'peptide' in df.columns: +# df['peptide'] = df['peptide'].fillna(df['Peptide']) +# if 'MHC' in df.columns and 'allele' not in df.columns: +# df['allele'] = df['MHC'] +# elif 'MHC' in df.columns and 'allele' in df.columns: +# df['allele'] = df['allele'].fillna(df['MHC']) +# # Calculate label from Score_EL if label is empty or doesn't exist +# if 'label' not in df.columns: +# if 'Score_BA' in df.columns: +# df['label'] = df['Score_BA'].apply(lambda x: 1 if eval(x) > 0.426 else 0) +# +# # if at least one label is not 1, select the highest score_BA and set the labels to 1, then save the allele in a list +# if 'cell_line_id' in df.columns and 'label' in df.columns: +# # Create a mask for cell lines with at least one positive label +# positive_cell_lines = df.groupby('cell_line_id')['label'].max() == 1 +# positive_cell_lines = positive_cell_lines[positive_cell_lines].index.tolist() +# # Filter rows +# mask = df['cell_line_id'].isin(positive_cell_lines) +# dropped_df = df[~mask].copy() +# df = df[mask].copy() +# # Save dropped rows to separate file if there are any +# if not dropped_df.empty: +# dropped_rows = pd.concat([dropped_rows, dropped_df]) +# +# # print the length of the dropped rows +# print(f"Length of dropped rows: {len(dropped_rows)}") + +# def combine_results(results_dir, final_output_path): +# # Combine all parquet files at the end +# try: +# all_parquet_files = [os.path.join(results_dir, f) for f in os.listdir(results_dir) if f.endswith('.parquet')] +# if all_parquet_files: +# print(f"Combining {len(all_parquet_files)} parquet files into final output") +# # Read all parquet files as pandas DataFrames +# dfs = [] +# for parquet_file in all_parquet_files: +# try: +# df = pq.read_table(parquet_file).to_pandas() +# dfs.append(df) +# except Exception as e: +# print(f"Error reading {parquet_file}: {str(e)}") +# continue +# if dfs: +# # Concatenate DataFrames (pandas handles schema differences automatically) +# df = pd.concat(dfs, ignore_index=True) +# # Standardize column names +# if 'Peptide' in df.columns and 'peptide' not in df.columns: +# df['peptide'] = df['Peptide'] +# elif 'Peptide' in df.columns and 'peptide' in df.columns: +# df['peptide'] = df['peptide'].fillna(df['Peptide']) +# if 'MHC' in df.columns and 'allele' not in df.columns: +# df['allele'] = df['MHC'] +# elif 'MHC' in df.columns and 'allele' in df.columns: +# df['allele'] = df['allele'].fillna(df['MHC']) +# # Calculate label from Score_EL if label is empty or doesn't exist +# if 'label' not in df.columns: +# if 'Score_BA' in df.columns: +# df['label'] = df['Score_BA'].apply(lambda x: 1 if eval(x) > 0.4 else 0) # Threshold can be adjusted +# else: +# df['label'] = None +# # Handle cell_line_id filtering +# if 'cell_line_id' in df.columns and 'label' in df.columns: +# # Create a mask for cell lines with at least one positive label +# positive_cell_lines = df.groupby('cell_line_id')['label'].max() == 1 +# positive_cell_lines = positive_cell_lines[positive_cell_lines].index.tolist() +# # Filter rows +# mask = df['cell_line_id'].isin(positive_cell_lines) +# dropped_df = df[~mask].copy() +# df = df[mask].copy() +# # Save dropped rows to separate file if there are any +# if not dropped_df.empty: +# dropped_output_path = final_output_path.replace('.parquet', '_dropped.parquet') +# pq.write_table(pa.Table.from_pandas(dropped_df), dropped_output_path) +# print( +# f"Dropped {dropped_df.shape[0]} rows from {len(set(dropped_df['cell_line_id']))} cell lines with no positive labels") +# print(f"Dropped rows saved to: {dropped_output_path}") +# print(f"Kept {df.shape[0]} rows from {len(set(df['cell_line_id']))} cell lines with at least one positive label") +# # Keep only required columns if they exist +# keep_cols = ["allele", "peptide", "label"] +# existing_cols = [col for col in keep_cols if col in df.columns] +# if existing_cols: +# df = df[existing_cols] +# # Save the combined DataFrame to parquet +# pq.write_table(pa.Table.from_pandas(df), final_output_path) +# print(f"Combined results shape: {df.shape}") +# print(f"Final output saved to: {final_output_path}") +# else: +# df = pd.DataFrame(columns=["allele", "peptide", "label"]) +# print("No valid DataFrames were created from parquet files") +# else: +# df = pd.DataFrame(columns=["allele", "peptide", "label"]) +# print("No parquet files were generated") +# except Exception as e: +# print(f"Error combining parquet files: {str(e)}") +# import traceback +# traceback.print_exc() +# df = pd.DataFrame(columns=["allele", "peptide", "label"]) +# return df + + +# def parallelize_netmhcpan(el_data, tmp_path, results_dir): +# run_netmhcpan_(el_data, 1, tmp_path, results_dir, 0) +# +# # with ProcessPoolExecutor() as executor: +# # tasks = [] +# # for allele in unique_cell_line: +# # subset_data = el_data_1[el_data_1["allele"] == allele] +# # tasks.append(executor.submit(run_netmhcpan_, subset_data, [allele], tmp_path, results_dir)) +# # for task in tasks: +# # task.result() def run_(arg1, arg2): mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/" tmp_path = "data/NetMHCpan_dataset/tmp/" - results_dir = "data/NetMHCpan_dataset/tmp/results/" - final_output_path = "data/NetMHCpan_dataset/tmp/combined_results.parquet" + results_dir = "data/NetMHCpan_dataset/results/" + final_output_path = "data/NetMHCpan_dataset/combined_results.parquet" + + # make tmp directory + if not os.path.isdir(tmp_path): + os.mkdir(tmp_path) # make results directory if not os.path.isdir(results_dir): @@ -357,7 +519,7 @@ def run_(arg1, arg2): if arg1 == "process_data": ######################## # Load data - el_data_0, el_data_1, unique_alleles, ba_data = process_data( + el_data_0, el_data_1, ba_data = process_data( mhcII_path=mhcII_path, tmp_path=tmp_path) @@ -366,16 +528,16 @@ def run_(arg1, arg2): el_data_1.to_csv("data/NetMHCpan_dataset/tmp/el_data_1.csv", index=False) ba_data.to_csv("data/NetMHCpan_dataset/tmp/ba_data.csv", index=False) params = { - "unique_alleles": unique_alleles.tolist() if hasattr(unique_alleles, "tolist") else unique_alleles, + # "unique_cell_lines": unique_cell_lines.tolist() if hasattr(unique_cell_lines, "tolist") else unique_cell_lines, "tmp_path": tmp_path, "results_dir": results_dir } with open("data/NetMHCpan_dataset/tmp/params.json", "w") as f: json.dump(params, f) - # split el_data to 10 chunks and save seperately - chunk_size = len(el_data_1) // 10 - for i in range(10): + # split el_data to 10 chunks and save separately + chunk_size = len(el_data_1) // 256 + for i in range(256): el_data_1_chunk = el_data_1.iloc[i * chunk_size: (i + 1) * chunk_size] el_data_1_chunk.to_csv(f"data/NetMHCpan_dataset/tmp/el_data_1_chunk_{i}.csv", index=False) ######################## @@ -384,37 +546,44 @@ def run_(arg1, arg2): # load the variables and parameters from JSON files with open("data/NetMHCpan_dataset/tmp/params.json", "r") as f: params = json.load(f) - unique_alleles = np.array(params["unique_alleles"]) + # unique_alleles = np.array(params["unique_alleles"]) tmp_path = params["tmp_path"] results_dir = params["results_dir"] # load the variables - el_data_1 = pd.read_csv( f"data/NetMHCpan_dataset/tmp/el_data_1_chunk_{arg2}.csv") + el_data_0 = pd.read_csv("data/NetMHCpan_dataset/tmp/el_data_0.csv") # print the len of el_data_1 print(f"Length of el_data_1: {len(el_data_1)}") # subset 1000 random samples from the data for testing - # el_data_1 = el_data_1.sample(n=100, random_state=42) + el_data_1 = el_data_1.sample(n=1000, random_state=42) + # unique_cell_lines = el_data_1["cell_line_id"].unique() # Run NetMHCpan in parallel - parallelize_netmhcpan(el_data_1, unique_alleles, tmp_path, results_dir) - - if arg1 == "combine_results": - # Combine results - df = combine_results(results_dir, final_output_path) - - el_data_0 = pd.read_csv("data/NetMHCpan_dataset/tmp/el_data_0.csv") - ba_data = pd.read_csv("data/NetMHCpan_dataset/tmp/ba_data.csv") - - # concatenate the dataframes df and el_data_0 and ba_data - df = pd.concat([df, el_data_0], ignore_index=True) - df = pd.concat([df, ba_data], ignore_index=True) - - # save the final output - df.to_csv("data/NetMHCpan_dataset/tmp/NetMHCIIpan_all.csv", index=False) + # parallelize_netmhcpan(el_data_1, tmp_path, results_dir) + + # run the netmhcpan for the el_data_1 + run_netmhcpan_(el_data_1, 1, tmp_path, results_dir, arg2) + + # run the netmhcpan for the el_data_0 + # run_netmhcpan_(el_data_0, 0, tmp_path, results_dir, arg2) + + # if arg1 == "combine_results": + # # Combine results + # df = combine_results_(results_dir, final_output_path) + # + # el_data_0 = pd.read_csv("data/NetMHCpan_dataset/tmp/el_data_0.csv") + # ba_data = pd.read_csv("data/NetMHCpan_dataset/tmp/ba_data.csv") + # + # # concatenate the dataframes df and el_data_0 and ba_data + # df = pd.concat([df, el_data_0], ignore_index=True) + # df = pd.concat([df, ba_data], ignore_index=True) + # + # # save the final output + # df.to_csv("data/NetMHCpan_dataset/NetMHCIIpan_all.csv", index=False) def main(): if len(sys.argv) < 1: diff --git a/run_utils.py b/run_utils.py index 401ddf674..57097902e 100644 --- a/run_utils.py +++ b/run_utils.py @@ -792,7 +792,7 @@ def protein_mpnn_wrapper(output_pdbs_dict, args, max_jobs, mode='parallel'): def run_and_parse_netmhcpan(peptide_fasta_file, mhc_type, output_dir, mhc_seq_list=None, mhc_allele=None, - dirty_mode=False): + dirty_mode=False, save_csv=True): """ Runs the NetMHCpan tool and parses its output. @@ -803,6 +803,7 @@ def run_and_parse_netmhcpan(peptide_fasta_file, mhc_type, output_dir, mhc_seq_li mhc_seq_list (list, optional): List of MHC sequences. Default is an empty list. mhc_allele (str, optional): Specific MHC allele name. Default is None. dirty_mode (bool, optional): If True, removes the raw output file after parsing. Default is False. + save_csv (bool, optional): If True, saves the parsed output as a CSV file. Default is True. Returns: pd.DataFrame: DataFrame containing the parsed NetMHCpan output. @@ -843,7 +844,8 @@ def run_and_parse_netmhcpan(peptide_fasta_file, mhc_type, output_dir, mhc_seq_li # print("Matched Alleles", matched_allele) processing_functions.run_netmhcpan(peptide_fasta_file, matched_allele, outfile, mhc_type) df = processing_functions.parse_netmhcpan_file(outfile) - df.to_csv(outfile_csv, index=False) + if save_csv: + df.to_csv(outfile_csv, index=False) if dirty_mode: os.remove(outfile) return df diff --git a/user_setting.py b/user_setting.py index 15574e555..49828ac14 100644 --- a/user_setting.py +++ b/user_setting.py @@ -1,7 +1,7 @@ ##### PLEASE UPDATE ##### #Absolute path to NetMHCIPan executable file e.g. 'home/user/netMHCpan-4.1/netMHCpan' -netmhcipan_path = '/home/amir/amir/ParseFold/PMGen/netMHCIpan-4.1/netMHCpan' -netmhciipan_path = '/home/amir/amir/ParseFold/PMGen/netMHCIIpan-4.3/netMHCIIpan' +netmhcipan_path = '/home/amirreza/Desktop/NetMHCPan/netMHCpan-4.1/netMHCpan' +netmhciipan_path = '/home/amirreza/Desktop/NetMHCPan/netMHCIIpan-4.3/netMHCIIpan' ##### Do not Change ####### import os From a724a40163455ab01650c1af0c86a7539484d88f Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 25 Mar 2025 10:06:58 +0100 Subject: [PATCH 05/83] processing per cell_line_id with a simpler implementation, saving directly onto the disk in a csv file --- run_netmhcpan_script.py | 28 ++++++++++++++-------------- 1 file changed, 14 insertions(+), 14 deletions(-) diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py index bfe123920..6d5d73bbd 100644 --- a/run_netmhcpan_script.py +++ b/run_netmhcpan_script.py @@ -212,7 +212,7 @@ def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number): unique_id = f"{peptide}_{allele}" # define path - peptide_fasta_path = os.path.join(tmp_path, f"results/el{true_label}_peptide_{unique_id}.fasta") + peptide_fasta_path = os.path.join(tmp_path, f"fasta/el{true_label}_peptide_{unique_id}.fasta") peptide_fasta_dir = os.path.dirname(peptide_fasta_path) # Ensure the directory exists @@ -224,7 +224,9 @@ def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number): f.write(f">peptide\n{peptide}\n") # Output directory for this specific cell_line_id - output_dir = os.path.join(tmp_path, f"results/el{true_label}_output_{unique_id}") + output_dir = os.path.join(tmp_path, f"output/") + if not os.path.exists(output_dir): + os.makedirs(output_dir) try: # Run NetMHCpan for this specific peptide @@ -251,17 +253,15 @@ def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number): # Get the actual directory path peptide_fasta_dir = os.path.dirname(peptide_fasta_path) - if os.path.exists(peptide_fasta_dir) and os.path.isdir(peptide_fasta_dir): - try: - shutil.rmtree(peptide_fasta_dir) - except PermissionError: - print(f"Warning: Could not remove directory {peptide_fasta_dir} due to permission error") - - if os.path.exists(output_dir) and os.path.isdir(output_dir): - try: - shutil.rmtree(output_dir) - except PermissionError: - print(f"Warning: Could not remove directory {output_dir} due to permission error") + try: + shutil.rmtree(peptide_fasta_dir) + except PermissionError: + print(f"Warning: Could not remove directory {peptide_fasta_dir} due to permission error") + + try: + shutil.rmtree(output_dir) + except PermissionError: + print(f"Warning: Could not remove directory {output_dir} due to permission error") # save the results to disk if not result_data.empty: @@ -559,7 +559,7 @@ def run_(arg1, arg2): print(f"Length of el_data_1: {len(el_data_1)}") # subset 1000 random samples from the data for testing - el_data_1 = el_data_1.sample(n=1000, random_state=42) + # el_data_1 = el_data_1.sample(n=1000, random_state=42) # unique_cell_lines = el_data_1["cell_line_id"].unique() # Run NetMHCpan in parallel From 3e23bb3f1d7c037f411e9c8edfea28d2f9829ad7 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 25 Mar 2025 15:44:44 +0100 Subject: [PATCH 06/83] processing per cell_line_id with a simpler implementation, saving directly onto the disk in a csv file --- run_netmhcpan_script.py | 23 +++++++++++++---------- 1 file changed, 13 insertions(+), 10 deletions(-) diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py index 6d5d73bbd..55b048c93 100644 --- a/run_netmhcpan_script.py +++ b/run_netmhcpan_script.py @@ -45,8 +45,8 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", if not os.path.isdir(tmp_path): os.mkdir(tmp_path) - el_data = pd.DataFrame(columns=["peptide", "label", "allele", "core"]) - ba_data = pd.DataFrame(columns=["peptide", "label", "allele", "core"]) + el_data = pd.DataFrame(columns=["peptide", "assigned_label", "allele", "core"]) + ba_data = pd.DataFrame(columns=["peptide", "assigned_label", "allele", "core"]) # Check directory exists if not os.path.exists(mhcII_path): @@ -63,7 +63,7 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", # Rename columns if necessary if data.shape[1] >= 4: - data.columns = ["peptide", "label", "allele", "core"] + list(range(data.shape[1] - 4)) + data.columns = ["peptide", "assigned_label", "allele", "core"] + list(range(data.shape[1] - 4)) # add ba data to the dataframe ba_data = pd.concat([ba_data, data], ignore_index=True) else: @@ -75,7 +75,7 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", # Rename columns if necessary if data.shape[1] >= 4: # Ensure data has enough columns - data.columns = ["peptide", "label", "allele", "core"] + list(range(data.shape[1] - 4)) + data.columns = ["peptide", "assigned_label", "allele", "core"] + list(range(data.shape[1] - 4)) # add el data to the dataframe el_data = pd.concat([el_data, data], ignore_index=True) else: @@ -165,8 +165,8 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", lambda x: x[:x.find("-", x.find("-") + 1)] + "/HLA-" + x[x.find("-", x.find("-") + 1) + 1:] if x.count("-") >= 2 and "/" not in x else x) # split to two variables, one with labels = 0 and one with labels = 1 - el_data_0 = el_data[el_data["label"] == 0] - el_data_1 = el_data[el_data["label"] == 1] + el_data_0 = el_data[el_data["assigned_label"] == 0] + el_data_1 = el_data[el_data["assigned_label"] == 1] # drop the labels column from el_data_1 # el_data_1 = el_data_1.drop(columns=["label"]) @@ -238,11 +238,12 @@ def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number): save_csv=False ) - # select the top 1 result + # select the top 1 result from netmhcpan output if result_ is not None and not result_.empty: result_ = result_.iloc[[0]] result_['long_mer'] = peptide result_['cell_line_id'] = str(chunk_number) + "_" + str(idx) + result_['convoluted_label'] = true_label result_data = pd.concat([result_data, result_]) except Exception as e: @@ -265,12 +266,14 @@ def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number): # save the results to disk if not result_data.empty: - assert len(result_data) == number_of_alleles - result_data['label'] = result_data['Score_BA'].apply(lambda x: 1 if eval(x) > 0.426 else 0) + # assert len(result_data) == number_of_alleles + if len(result_data) != number_of_alleles: + print(f"Warning: Expected {number_of_alleles} results but got {len(result_data)}") + result_data['assigned_label'] = result_data['Score_BA'].apply(lambda x: 1 if eval(x) > 0.426 else 0) if true_label == 1: # if at least one label is not 1, select the highest score_BA and set the labels to 1, then save the allele in a list # Create a mask for cell lines with at least one positive label - positive_cell_lines = result_data.groupby('cell_line_id')['label'].max() == 1 + positive_cell_lines = result_data.groupby('cell_line_id')['assigned_label'].max() == 1 positive_cell_lines = positive_cell_lines[positive_cell_lines].index.tolist() # Filter rows mask = result_data['cell_line_id'].isin(positive_cell_lines) From 9cdd66925dbd19112f927873b604f3182203474f Mon Sep 17 00:00:00 2001 From: amirreza Date: Mon, 31 Mar 2025 16:08:20 +0200 Subject: [PATCH 07/83] added support for MHC class I --- run_netmhcpan_script.py | 130 +++++++++++++++++++++++++--------------- 1 file changed, 81 insertions(+), 49 deletions(-) diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py index 55b048c93..32ad4321d 100644 --- a/run_netmhcpan_script.py +++ b/run_netmhcpan_script.py @@ -29,13 +29,13 @@ def load_data(path): return data -def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", - tmp_path = "data/NetMHCpan_dataset/tmp/"): +def process_data(mhc_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", + tmp_path = "data/NetMHCpan_dataset/tmp/", mhc_type=2): """ Load and process MHCII data for NetMHCpan This function works for only HLA inputs Args: - mhcII_path: + mhc_path: tmp_path: Returns: @@ -45,44 +45,69 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", if not os.path.isdir(tmp_path): os.mkdir(tmp_path) - el_data = pd.DataFrame(columns=["peptide", "assigned_label", "allele", "core"]) - ba_data = pd.DataFrame(columns=["peptide", "assigned_label", "allele", "core"]) + if mhc_type == 1: + el_data = pd.DataFrame(columns=["peptide", "label", "allele"]) + ba_data = pd.DataFrame(columns=["peptide", "label", "allele"]) + else: + el_data = pd.DataFrame(columns=["peptide", "label", "allele", "core"]) + ba_data = pd.DataFrame(columns=["peptide", "label", "allele", "core"]) # Check directory exists - if not os.path.exists(mhcII_path): - print(f"Directory not found: {mhcII_path}") + if not os.path.exists(mhc_path): + print(f"Directory not found: {mhc_path}") return - train_files = [f for f in os.listdir(mhcII_path) if "train" in f] + if mhc_type == 1: + train_files = [f for f in os.listdir(mhc_path) if "_ba" in f or "_el" in f] + else: + train_files = [f for f in os.listdir(mhc_path) if "train" in f] print(f"Found {len(train_files)} train files") for file in tqdm(train_files): if "BA" in file or "ba" in file: - data = load_data(mhcII_path + file) + data = load_data(mhc_path + file) print(f"Loaded BA data from {file}: {ba_data.shape}") - # Rename columns if necessary - if data.shape[1] >= 4: - data.columns = ["peptide", "assigned_label", "allele", "core"] + list(range(data.shape[1] - 4)) - # add ba data to the dataframe - ba_data = pd.concat([ba_data, data], ignore_index=True) - else: - print(f"Warning: File {file} has insufficient columns: {data.shape[1]}") + if mhc_type == 2: + # Rename columns if necessary + if data.shape[1] >= 4: + data.columns = ["peptide", "label", "allele", "core"] + list(range(data.shape[1] - 4)) + # add ba data to the dataframe + ba_data = pd.concat([ba_data, data], ignore_index=True) + else: + print(f"Warning: File {file} has insufficient columns: {data.shape[1]}") + if mhc_type == 1: + # Rename columns if necessary + if data.shape[1] >= 3: + data.columns = ["peptide", "label", "allele"] + list(range(data.shape[1] - 3)) + # add ba data to the dataframe + ba_data = pd.concat([ba_data, data], ignore_index=True) + else: + print(f"Warning: File {file} has insufficient columns: {data.shape[1]}") elif "EL" in file or "el" in file: - data = load_data(mhcII_path + file) + data = load_data(mhc_path + file) print(f"Loaded EL data from {file}: {data.shape}") - # Rename columns if necessary - if data.shape[1] >= 4: # Ensure data has enough columns - data.columns = ["peptide", "assigned_label", "allele", "core"] + list(range(data.shape[1] - 4)) - # add el data to the dataframe - el_data = pd.concat([el_data, data], ignore_index=True) + if mhc_type == 2: + # Rename columns if necessary + if data.shape[1] >= 4: # Ensure data has enough columns + data.columns = ["peptide", "label", "allele", "core"] + list(range(data.shape[1] - 4)) + # add el data to the dataframe + el_data = pd.concat([el_data, data], ignore_index=True) + else: + print(f"Warning: File {file} has insufficient columns: {data.shape[1]}") else: - print(f"Warning: File {file} has insufficient columns: {data.shape[1]}") - else: - # skip the file and print a warning - print(f"Skipping file: {file}") + # skip the file and print a warning + print(f"Skipping file: {file}") + if mhc_type == 1: + # Rename columns if necessary + if data.shape[1] >= 3: + data.columns = ["peptide", "label", "allele"] + list(range(data.shape[1] - 3)) + # add el data to the dataframe + el_data = pd.concat([el_data, data], ignore_index=True) + else: + print(f"Warning: File {file} has insufficient columns: {data.shape[1]}") print(f"After loading data: {el_data.shape}") if el_data.empty: @@ -98,7 +123,10 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", print(f"After removing duplicates: {el_data.shape}") ## get allele names of cell lines - allelelist = mhcII_path + "allelelist.txt" # change to allelelist for MHCI + if mhc_type == 1: + allelelist = mhc_path + "allelelist" + else: + allelelist = mhc_path + "allelelist.txt" # change to allelelist for MHCI # Check if allele list file exists if not os.path.exists(allelelist): @@ -165,8 +193,8 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", lambda x: x[:x.find("-", x.find("-") + 1)] + "/HLA-" + x[x.find("-", x.find("-") + 1) + 1:] if x.count("-") >= 2 and "/" not in x else x) # split to two variables, one with labels = 0 and one with labels = 1 - el_data_0 = el_data[el_data["assigned_label"] == 0] - el_data_1 = el_data[el_data["assigned_label"] == 1] + el_data_0 = el_data[el_data["label"] == 0] + el_data_1 = el_data[el_data["label"] == 1] # drop the labels column from el_data_1 # el_data_1 = el_data_1.drop(columns=["label"]) @@ -180,9 +208,9 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", # print(f"After removing duplicates: {el_data_1.shape}") # Verify that "/" is present in all allele names - invalid_alleles = el_data_0[el_data_0["allele"].apply(lambda x: "/" not in x)] + invalid_alleles = el_data_0[el_data_0["allele"].apply(lambda x: "/" in x)] if not invalid_alleles.empty: - print("Alleles without '/' separator:") + print("Alleles with '/' separator:") print(invalid_alleles) # # Get unique alleles and run NetMHCpan for each @@ -198,12 +226,12 @@ def process_data(mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", return el_data_0, el_data_1, ba_data -def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number): +def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number, mhc_class): # chunk_dataframe = pd.DataFrame(columns=["MHC", "Peptide", "Of", "Core", "Core_Rel", "Inverted", "Identity", "Score_EL", "%Rank_EL", "Exp_Bind", "Score_BA", "%Rank_BA", "Affinity(nM)", "long_mer", "cell_line_id"]) chunk_df_path = os.path.join(results_dir, f"el{true_label}_chunk_{chunk_number}.csv") dropped_rows = pd.DataFrame() dropped_rows_path = os.path.join(results_dir, f"el{true_label}_dropped_rows_{chunk_number}.csv") - for idx, cell_row in tqdm(el_data.iterrows(), total=el_data.shape[0]): + for idx, cell_row in tqdm(el_data.iterrows(), total=el_data.shape[0], desc=f"Processing chunk {chunk_number}"): number_of_alleles = len(eval(cell_row["allele"])) result_data = pd.DataFrame(columns=["MHC", "Peptide", "Of", "Core", "Core_Rel", "Inverted", "Identity", "Score_EL", "%Rank_EL", "Exp_Bind", "Score_BA", "%Rank_BA", "Affinity(nM)", "long_mer", "cell_line_id"]) peptide = cell_row["peptide"] @@ -224,7 +252,7 @@ def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number): f.write(f">peptide\n{peptide}\n") # Output directory for this specific cell_line_id - output_dir = os.path.join(tmp_path, f"output/") + output_dir = os.path.join(tmp_path, f"output/{true_label}_output_{unique_id}") if not os.path.exists(output_dir): os.makedirs(output_dir) @@ -232,7 +260,7 @@ def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number): # Run NetMHCpan for this specific peptide result_ = run_and_parse_netmhcpan( peptide_fasta_file=peptide_fasta_path, - mhc_type=2, + mhc_type=mhc_class, output_dir=output_dir, mhc_allele=allele, save_csv=False @@ -506,10 +534,13 @@ def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number): # # task.result() def run_(arg1, arg2): - mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/" - tmp_path = "data/NetMHCpan_dataset/tmp/" + # mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/" + mhcI_path = "data/NetMHCpan_dataset/NetMHCpan_train/" + # tmp_path = "data/NetMHCpan_dataset/tmp/" + tmp_path = "data/NetMHCpan_dataset/tmp_I/" results_dir = "data/NetMHCpan_dataset/results/" - final_output_path = "data/NetMHCpan_dataset/combined_results.parquet" + + mhc_class = 1 # make tmp directory if not os.path.isdir(tmp_path): @@ -523,31 +554,32 @@ def run_(arg1, arg2): ######################## # Load data el_data_0, el_data_1, ba_data = process_data( - mhcII_path=mhcII_path, - tmp_path=tmp_path) + mhc_path=mhcI_path, + tmp_path=tmp_path, + mhc_type=mhc_class) # save the variables - el_data_0.to_csv("data/NetMHCpan_dataset/tmp/el_data_0.csv", index=False) - el_data_1.to_csv("data/NetMHCpan_dataset/tmp/el_data_1.csv", index=False) - ba_data.to_csv("data/NetMHCpan_dataset/tmp/ba_data.csv", index=False) + el_data_0.to_csv(f"{tmp_path}/el_data_0.csv", index=False) + el_data_1.to_csv(f"{tmp_path}/el_data_1.csv", index=False) + ba_data.to_csv(f"{tmp_path}/ba_data.csv", index=False) params = { # "unique_cell_lines": unique_cell_lines.tolist() if hasattr(unique_cell_lines, "tolist") else unique_cell_lines, "tmp_path": tmp_path, "results_dir": results_dir } - with open("data/NetMHCpan_dataset/tmp/params.json", "w") as f: + with open(f"{tmp_path}/params.json", "w") as f: json.dump(params, f) # split el_data to 10 chunks and save separately chunk_size = len(el_data_1) // 256 for i in range(256): el_data_1_chunk = el_data_1.iloc[i * chunk_size: (i + 1) * chunk_size] - el_data_1_chunk.to_csv(f"data/NetMHCpan_dataset/tmp/el_data_1_chunk_{i}.csv", index=False) + el_data_1_chunk.to_csv(f"{tmp_path}/el_data_1_chunk_{i}.csv", index=False) ######################## if arg1 == "run_netmhcpan": # load the variables and parameters from JSON files - with open("data/NetMHCpan_dataset/tmp/params.json", "r") as f: + with open(f"{tmp_path}/params.json", "r") as f: params = json.load(f) # unique_alleles = np.array(params["unique_alleles"]) tmp_path = params["tmp_path"] @@ -555,8 +587,8 @@ def run_(arg1, arg2): # load the variables el_data_1 = pd.read_csv( - f"data/NetMHCpan_dataset/tmp/el_data_1_chunk_{arg2}.csv") - el_data_0 = pd.read_csv("data/NetMHCpan_dataset/tmp/el_data_0.csv") + f"{tmp_path}/el_data_1_chunk_{arg2}.csv") + el_data_0 = pd.read_csv(f"{tmp_path}/el_data_0.csv") # print the len of el_data_1 print(f"Length of el_data_1: {len(el_data_1)}") @@ -569,7 +601,7 @@ def run_(arg1, arg2): # parallelize_netmhcpan(el_data_1, tmp_path, results_dir) # run the netmhcpan for the el_data_1 - run_netmhcpan_(el_data_1, 1, tmp_path, results_dir, arg2) + run_netmhcpan_(el_data_1, 1, tmp_path, results_dir, arg2, mhc_class=mhc_class) # run the netmhcpan for the el_data_0 # run_netmhcpan_(el_data_0, 0, tmp_path, results_dir, arg2) From da2a9966e350661a984dcfce7edb1a6ea6fdd82b Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 15 Apr 2025 18:29:01 +0200 Subject: [PATCH 08/83] The SCQ run script added --- pip_requirements.txt | 3 +- run_pMHC_DL.py | 320 +++++++++++++++++++++++++++++++++++++++++++ utils/model.py | 102 ++++++++++++-- 3 files changed, 411 insertions(+), 14 deletions(-) create mode 100644 run_pMHC_DL.py diff --git a/pip_requirements.txt b/pip_requirements.txt index 150ed15e3..137a8f9bb 100644 --- a/pip_requirements.txt +++ b/pip_requirements.txt @@ -18,4 +18,5 @@ typing-extensions==3.7.4.3 urllib3==1.26.14 Levenshtein==0.27.1 tqdm==4.67.1 -pyarrow==19.0.1 \ No newline at end of file +pyarrow==19.0.1 +scikit-learn==1.6.1 \ No newline at end of file diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py new file mode 100644 index 000000000..bc952789d --- /dev/null +++ b/run_pMHC_DL.py @@ -0,0 +1,320 @@ +import os +import json +import numpy as np +import pandas as pd +import tensorflow as tf +import matplotlib.pyplot as plt +from sklearn.model_selection import KFold +from utils.model import SCQ_model + +# Set TensorFlow logging level for more information +tf.get_logger().setLevel('INFO') + + +def create_dataset(X, batch_size=1, is_training=True): + """Create TensorFlow dataset with consistent approach for both training and validation.""" + # Debug info + print(f"Creating {'training' if is_training else 'validation'} dataset") + print(f"Data shape: {X.shape}") + print(f"Data dtype: {X.dtype}") + print(f"Data range: min={np.min(X):.4f}, max={np.max(X):.4f}, mean={np.mean(X):.4f}") + + # Ensure data is float32 (TensorFlow works best with float32) + X = X.astype(np.float32) + + dataset = tf.data.Dataset.from_tensor_slices(X) + + # Apply shuffling only for training data + if is_training: + dataset = dataset.shuffle(buffer_size=1000) + + # Apply batching with drop_remainder=False to handle all data + dataset = dataset.batch(batch_size) + + # Prefetch for better performance + dataset = dataset.prefetch(tf.data.AUTOTUNE) + + # Debug dataset + for batch in dataset.take(1): + print(f"Sample batch shape: {batch.shape}") + print(f"Sample batch dtype: {batch.dtype}") + print(f"Sample batch range: min={tf.reduce_min(batch):.4f}, max={tf.reduce_max(batch):.4f}") + + return dataset + +def main(): + print("Starting SCQ parameter search...") + + try: + print("Loading peptide embeddings...") + mhc1_pep2vec_embeddings = pd.read_parquet("data/Pep2Vec/wrapper_mhc1.parquet") + mhc2_pep2vec_embeddings = pd.read_parquet("data/Pep2Vec/wrapper_mhc2.parquet") + + # Select the latent columns (the columns that has latent in their name) + mhc1_latent_columns = [col for col in mhc1_pep2vec_embeddings.columns if 'latent' in col] + mhc2_latent_columns = [col for col in mhc2_pep2vec_embeddings.columns if 'latent' in col] + + print(f"Found {len(mhc1_latent_columns)} latent columns for MHC1") + print(f"Found {len(mhc2_latent_columns)} latent columns for MHC2") + + if len(mhc1_latent_columns) == 0 or len(mhc2_latent_columns) == 0: + print("WARNING: No latent columns found. Check column names.") + + # Extract latent features + X_mhc1 = mhc1_pep2vec_embeddings[mhc1_latent_columns].values + X_mhc2 = mhc2_pep2vec_embeddings[mhc2_latent_columns].values + + print(f"MHC1 data shape: {X_mhc1.shape}") + print(f"MHC2 data shape: {X_mhc2.shape}") + + # Data sanity check + print("Data overview:") + print( + f"MHC1 - min: {np.min(X_mhc1):.4f}, max: {np.max(X_mhc1):.4f}, mean: {np.mean(X_mhc1):.4f}, std: {np.std(X_mhc1):.4f}") + print( + f"MHC2 - min: {np.min(X_mhc2):.4f}, max: {np.max(X_mhc2):.4f}, mean: {np.mean(X_mhc2):.4f}, std: {np.std(X_mhc2):.4f}") + + # Check for NaN or infinity values + print(f"MHC1 has NaN: {np.isnan(X_mhc1).any()}, has inf: {np.isinf(X_mhc1).any()}") + print(f"MHC2 has NaN: {np.isnan(X_mhc2).any()}, has inf: {np.isinf(X_mhc2).any()}") + + # Replace any NaN values with zeros + if np.isnan(X_mhc1).any(): + print("Replacing NaN values in MHC1 with zeros") + X_mhc1 = np.nan_to_num(X_mhc1) + + if np.isnan(X_mhc2).any(): + print("Replacing NaN values in MHC2 with zeros") + X_mhc2 = np.nan_to_num(X_mhc2) + + except Exception as e: + print(f"Error loading data: {e}") + return + + # Create output directory for results + output_dir = "output/scq_parameter_search" + os.makedirs(output_dir, exist_ok=True) + + # Define parameter search space - simplified to just one configuration for testing + param_grid = [ + {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 8, 'heads': 4}, + {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, + {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 32, 'heads': 4}, + {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 64, 'heads': 4}, + {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 128, 'heads': 4}, + {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 256, 'heads': 4}, + {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 512, 'heads': 4}, + {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 1024, 'heads': 4}, + ] + + # Common parameters for all configurations + common_params = { + 'descrete_loss': False, + 'weight_recon': 1.0, + 'weight_vq': 1.0, + } + + # Set up cross-validation - reduced to 2 folds for testing + n_folds = 2 + kf = KFold(n_splits=n_folds, shuffle=True, random_state=42) + + # Batch size for all datasets + batch_size = 1 + + # Store results + results = [] + + # Run parameter search for each dataset + # Just use MHC1 for testing + for dataset_name, X, latent_columns in [ + ("MHC1", X_mhc1, mhc1_latent_columns) + ]: + print(f"\n{'=' * 50}") + print(f"Processing {dataset_name} dataset") + print(f"{'=' * 50}\n") + + # Create directory for this dataset + dataset_dir = os.path.join(output_dir, dataset_name) + os.makedirs(dataset_dir, exist_ok=True) + + # Model selection loop + for param_idx, param_config in enumerate(param_grid): + config_name = f"config_{param_idx + 1}" + print(f"\n{'-' * 50}") + print(f"Testing {config_name}: {param_config}") + print(f"{'-' * 50}\n") + + # Merge with common parameters + model_params = {**common_params, **param_config} + + # Create config directory + config_dir = os.path.join(dataset_dir, config_name) + os.makedirs(config_dir, exist_ok=True) + + # Cross-validation metrics + cv_metrics = { + 'loss': [], + 'recon': [], + 'vq': [], + 'perplexity': [] + } + + # Prepare folds + fold_indices = list(kf.split(X)) + + for fold_idx, (train_idx, val_idx) in enumerate(fold_indices): + print(f"Training fold {fold_idx + 1}/{n_folds}") + + # Split data + X_train, X_val = X[train_idx], X[val_idx] + + # Check data shapes + print(f"Train data shape: {X_train.shape}") + print(f"Validation data shape: {X_val.shape}") + + # Convert to TensorFlow dataset using the new function + train_dataset = create_dataset(X_train, batch_size=batch_size, is_training=True) + val_dataset = create_dataset(X_val, batch_size=batch_size, is_training=False) + + # Define the model + model = SCQ_model(**model_params, input_dim=X_train.shape[1]) + + # Print model summary + model.build((None, X_train.shape[1])) + print("Model summary:") + model.summary() + + # Compile the model + model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=0.001)) + + # Prepare callbacks + fold_dir = os.path.join(config_dir, f"fold_{fold_idx}") + os.makedirs(fold_dir, exist_ok=True) + + # Create a custom callback to print metrics after each epoch + class MetricsPrinter(tf.keras.callbacks.Callback): + def on_epoch_end(self, epoch, logs=None): + logs = logs or {} + print(f"\nEpoch {epoch + 1} metrics:") + for metric, value in logs.items(): + print(f" {metric}: {value:.6f}") + + callbacks = [ + tf.keras.callbacks.ModelCheckpoint( + filepath=os.path.join(fold_dir, 'checkpoint'), + save_best_only=True, + monitor='val_total_loss', + mode='min' + ), + tf.keras.callbacks.EarlyStopping( + monitor='val_total_loss', + patience=5, + restore_best_weights=True + ), + MetricsPrinter() # Add the custom callback + ] + + # Train the model with fewer epochs for testing + print("Starting model training...") + try: + history = model.fit( + train_dataset, + epochs=10, # Reduced for testing + validation_data=val_dataset, + callbacks=callbacks, + verbose=1 + ) + + # Check if history contains expected metrics + print("\nHistory keys:", history.history.keys()) + for key, values in history.history.items(): + print(f"{key}: {values}") + except Exception as e: + print(f"Error during training: {e}") + continue + + # Save training history + try: + with open(os.path.join(fold_dir, 'history.json'), 'w') as f: + json.dump(history.history, f) + except Exception as e: + print(f"Error saving history: {e}") + + # Reset metrics before evaluation + print("Resetting metrics before evaluation") + model.reset_metrics() + + # Evaluate on validation set + print("Evaluating model on validation data...") + # After getting validation metrics + try: + val_metrics = model.evaluate(val_dataset, return_dict=True) + print("Validation metrics:", val_metrics) + + # Map the metric names + metric_mapping = { + 'loss': 'total_loss', + 'recon': 'recon_loss', + 'vq': 'vq_loss', + 'perplexity': 'perplexity' + } + + # Record metrics with mapping + for returned_name, expected_name in metric_mapping.items(): + if returned_name in val_metrics: + cv_metrics[expected_name].append(val_metrics[returned_name]) + else: + cv_metrics[expected_name].append(0) + + except Exception as e: + print(f"Error during evaluation: {e}") + # Rest of your error handling + + # Record metrics + for metric in cv_metrics: + cv_metrics[metric].append(val_metrics[metric]) + + # Save fold metrics + with open(os.path.join(fold_dir, 'metrics.json'), 'w') as f: + json.dump(val_metrics, f, indent=2) + + # Calculate average metrics across folds + avg_metrics = {k: np.mean(v) for k, v in cv_metrics.items()} + std_metrics = {k: np.std(v) for k, v in cv_metrics.items()} + + # Report results + print(f"\nAverage metrics for {config_name}:") + for metric, value in avg_metrics.items(): + print(f"{metric}: {value:.6f} (±{std_metrics[metric]:.6f})") + + # Store results + result = { + 'dataset': dataset_name, + 'config': config_name, + **model_params, + **avg_metrics, + **{f"{k}_std": v for k, v in std_metrics.items()}, + 'cv_metrics': cv_metrics + } + results.append(result) + + # Save config results + with open(os.path.join(config_dir, 'results.json'), 'w') as f: + json.dump(result, f, indent=2) + + # Save all results to CSV + results_df = pd.DataFrame([{k: v for k, v in r.items() if k != 'cv_metrics'} for r in results]) + results_df.to_csv(os.path.join(output_dir, 'all_results.csv'), index=False) + + print("\nParameter search complete!") + print(f"Results saved to {output_dir}") + + +if __name__ == "__main__": + try: + main() + except Exception as e: + print(f"Error in main function: {e}") + import traceback + + traceback.print_exc() \ No newline at end of file diff --git a/utils/model.py b/utils/model.py index 3a2d45e76..1552cc648 100644 --- a/utils/model.py +++ b/utils/model.py @@ -322,7 +322,7 @@ def layernorm(self, inputs): class SCQ_model(tf.keras.models.Model): def __init__(self, general_embed_dim=128, codebook_dim=16, codebook_num=64, descrete_loss=False, heads=4, names='SCQ_model', - weight_recon=1, weight_vq=1, **kwargs): + weight_recon=1, weight_vq=1, input_dim=1024, **kwargs): super().__init__() self.general_embed_dim = general_embed_dim self.codebook_dim = codebook_dim @@ -333,13 +333,13 @@ def __init__(self, general_embed_dim=128, codebook_dim=16, codebook_num=64, self.weight_recon = tf.cast(weight_recon, tf.float32) self.weight_vq = tf.cast(weight_vq, tf.float32) # define model - self.encoder = Encoder(dim_input=21, dim_embed=self.general_embed_dim, heads=self.heads) + self.encoder = Encoder(dim_input=input_dim, dim_embed=self.general_embed_dim, heads=self.heads) self.scq = SCQ(dim_input=self.general_embed_dim, dim_embed=self.codebook_dim, num_embed=self.codebook_num, descrete_loss=self.descrete_loss) self.decoder = Decoder(dim_input=self.codebook_dim, dim_embed=self.general_embed_dim, - dim_output=21, heads=self.heads) + dim_output=input_dim, heads=self.heads) # Loss trackers self.total_loss_tracker = tf.keras.metrics.Mean(name='total_loss') @@ -362,22 +362,53 @@ def train_step(self, x): Zq, out_P_proj, vq_loss = self.scq(encoded) # (B,N,E),(B,N,K),(1,) decoded = self.decoder(Zq) - y = tf.clip_by_value(decoded, 1e-10, 1 - (1e-10)) - recon_loss = -tf.reduce_sum(x * tf.math.log(y), axis=-1) - recon_loss = tf.reduce_mean(recon_loss) + # Calculate losses using the new method + losses = self.compute_losses(x, decoded, vq_loss, out_P_proj) - final_loss = self.weight_recon * recon_loss + self.weight_vq * vq_loss - - vars = self.encoder.trainable_weights + self.scq.trainable_weights + self.decoder.trainable_weights - grads = tape.gradient(final_loss, vars) + # Update weights + vars = self.trainable_weights + grads = tape.gradient(losses['total_loss'], vars) self.optimizer.apply_gradients(zip(grads, vars)) - self.perplexity = self.compute_perplexity(out_P_proj) - # Loss Tracking + + # Update metrics + self.total_loss_tracker.update_state(losses['total_loss']) + self.recon_loss_tracker.update_state(losses['recon_loss']) + self.vq_loss_tracker.update_state(losses['vq_loss']) + self.perplexity_tracker.update_state(losses['perplexity']) + + return { + 'loss': self.total_loss_tracker.result(), + 'recon': self.recon_loss_tracker.result(), + 'vq': self.vq_loss_tracker.result(), + 'perplexity': self.perplexity_tracker.result() + } + + def test_step(self, data): + # Get inputs from data + x = data + + # Forward pass + encoded = self.encoder(x) + Zq, out_P_proj, vq_loss = self.scq(encoded) + decoded = self.decoder(Zq) + + # Compute losses + y = tf.clip_by_value(decoded, 1e-10, 1 - (1e-10)) + recon_loss = -tf.reduce_sum(x * tf.math.log(y), axis=-1) + recon_loss = tf.reduce_mean(recon_loss) + + final_loss = self.weight_recon * recon_loss + self.weight_vq * vq_loss + + # Compute perplexity + perplexity = self.compute_perplexity(out_P_proj) + + # Update metrics self.total_loss_tracker.update_state(final_loss) self.recon_loss_tracker.update_state(self.weight_recon * recon_loss) self.vq_loss_tracker.update_state(self.weight_vq * vq_loss) - self.perplexity_tracker.update_state(self.perplexity) + self.perplexity_tracker.update_state(perplexity) + # Return metrics return { 'loss': tf.convert_to_tensor(self.total_loss_tracker.result()), 'recon': tf.convert_to_tensor(self.recon_loss_tracker.result()), @@ -399,6 +430,51 @@ def compute_perplexity(slef, out_P_proj): perplexity = tf.pow(2.0, entropy) # Perplexity: 2^entropy return perplexity + def compute_losses(self, x, decoded, vq_loss, out_P_proj): + """Compute all losses with improved numerical stability.""" + # Clip to avoid numerical issues + decoded_clipped = tf.clip_by_value(decoded, 1e-10, 1.0 - 1e-10) + + # Ensure tensors have compatible shapes + # Get input shapes for debugging + x_shape = tf.shape(x) + decoded_shape = tf.shape(decoded_clipped) + + # Reshape if necessary to ensure compatibility + if len(x.shape) != len(decoded_clipped.shape): + # Make sure both tensors are 3D (batch, seq_len, features) + if len(x.shape) == 2: + x = tf.expand_dims(x, axis=1) + if len(decoded_clipped.shape) == 2: + decoded_clipped = tf.expand_dims(decoded_clipped, axis=1) + + # Calculate reconstruction loss - element-wise cross-entropy + # We'll use the manual formula for more control over dimensions + epsilon = 1e-10 + recon_loss = -tf.reduce_sum(x * tf.math.log(decoded_clipped + epsilon), axis=-1) + recon_loss = tf.reduce_mean(recon_loss) + + # Compute perplexity (codebook usage metric) + perplexity = self.compute_perplexity(out_P_proj) + + # Add KL regularization to encourage more uniform codebook usage + p_j = tf.reduce_mean(out_P_proj, axis=[0, 1]) + p_uniform = tf.ones_like(p_j) / tf.cast(tf.shape(p_j)[0], tf.float32) + kl_loss = tf.reduce_sum(p_j * tf.math.log(p_j / p_uniform + epsilon)) + + # Combine losses with weights + total_loss = (self.weight_recon * recon_loss + + self.weight_vq * vq_loss + + 0.1 * kl_loss) + + return { + 'total_loss': total_loss, + 'recon_loss': recon_loss, + 'vq_loss': vq_loss, + 'kl_loss': kl_loss, + 'perplexity': perplexity + } + '''import tensorflow as tf From dd6f396686dfdd380ddaa79fd4d7b884582123a1 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 15 Apr 2025 18:55:38 +0200 Subject: [PATCH 09/83] refactor loss computation and update parameter search space --- run_pMHC_DL.py | 19 +++++++++++++++++-- utils/model.py | 44 +++++++++++++++++++------------------------- 2 files changed, 36 insertions(+), 27 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index bc952789d..701e18fb8 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -97,6 +97,7 @@ def main(): # Define parameter search space - simplified to just one configuration for testing param_grid = [ + # Explore different codebook_num {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 8, 'heads': 4}, {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 32, 'heads': 4}, @@ -105,6 +106,19 @@ def main(): {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 256, 'heads': 4}, {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 512, 'heads': 4}, {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 1024, 'heads': 4}, + # Explore codebook_dim + {'general_embed_dim': 128, 'codebook_dim': 32, 'codebook_num': 16, 'heads': 4}, + {'general_embed_dim': 128, 'codebook_dim': 64, 'codebook_num': 16, 'heads': 4}, + {'general_embed_dim': 128, 'codebook_dim': 128, 'codebook_num': 16, 'heads': 4}, + # Explore heads + {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 2}, + {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 8}, + {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 16}, + {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 32}, + # Explore general_embed_dim + {'general_embed_dim': 64, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, + {'general_embed_dim': 256, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, + {'general_embed_dim': 512, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, ] # Common parameters for all configurations @@ -127,7 +141,8 @@ def main(): # Run parameter search for each dataset # Just use MHC1 for testing for dataset_name, X, latent_columns in [ - ("MHC1", X_mhc1, mhc1_latent_columns) + ("MHC1", X_mhc1, mhc1_latent_columns), + ("MHC2", X_mhc2, mhc2_latent_columns) ]: print(f"\n{'=' * 50}") print(f"Processing {dataset_name} dataset") @@ -219,7 +234,7 @@ def on_epoch_end(self, epoch, logs=None): try: history = model.fit( train_dataset, - epochs=10, # Reduced for testing + epochs=30, # Reduced for testing validation_data=val_dataset, callbacks=callbacks, verbose=1 diff --git a/utils/model.py b/utils/model.py index 1552cc648..fc4c7675b 100644 --- a/utils/model.py +++ b/utils/model.py @@ -384,37 +384,31 @@ def train_step(self, x): } def test_step(self, data): - # Get inputs from data - x = data + # Get inputs from data + x = data - # Forward pass - encoded = self.encoder(x) - Zq, out_P_proj, vq_loss = self.scq(encoded) - decoded = self.decoder(Zq) + # Forward pass + encoded = self.encoder(x) + Zq, out_P_proj, vq_loss = self.scq(encoded) + decoded = self.decoder(Zq) - # Compute losses - y = tf.clip_by_value(decoded, 1e-10, 1 - (1e-10)) - recon_loss = -tf.reduce_sum(x * tf.math.log(y), axis=-1) - recon_loss = tf.reduce_mean(recon_loss) + # Calculate losses using the new method + losses = self.compute_losses(x, decoded, vq_loss, out_P_proj) - final_loss = self.weight_recon * recon_loss + self.weight_vq * vq_loss + # Update metrics + self.total_loss_tracker.update_state(losses['total_loss']) + self.recon_loss_tracker.update_state(losses['recon_loss']) + self.vq_loss_tracker.update_state(losses['vq_loss']) + self.perplexity_tracker.update_state(losses['perplexity']) - # Compute perplexity - perplexity = self.compute_perplexity(out_P_proj) + return { + 'loss': self.total_loss_tracker.result(), + 'recon': self.recon_loss_tracker.result(), + 'vq': self.vq_loss_tracker.result(), + 'perplexity': self.perplexity_tracker.result() + } - # Update metrics - self.total_loss_tracker.update_state(final_loss) - self.recon_loss_tracker.update_state(self.weight_recon * recon_loss) - self.vq_loss_tracker.update_state(self.weight_vq * vq_loss) - self.perplexity_tracker.update_state(perplexity) - # Return metrics - return { - 'loss': tf.convert_to_tensor(self.total_loss_tracker.result()), - 'recon': tf.convert_to_tensor(self.recon_loss_tracker.result()), - 'vq': tf.convert_to_tensor(self.vq_loss_tracker.result()), - 'perplexity': tf.convert_to_tensor(self.perplexity_tracker.result()) - } def call(self, inputs, training=False): encoded = self.encoder(inputs) From 1d8f25df46a5e3b501645885a9822f24c5fd9eba Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 16 Apr 2025 14:37:25 +0200 Subject: [PATCH 10/83] refactor SCQ model training pipeline and update dataset creation --- run_pMHC_DL.py | 291 +++++++++++++++++++++++---- utils/model.py | 518 +++++++++++++++++++++++++++++++++++++++++++++---- 2 files changed, 732 insertions(+), 77 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index 701e18fb8..5c36c3c31 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -6,42 +6,138 @@ import matplotlib.pyplot as plt from sklearn.model_selection import KFold from utils.model import SCQ_model +import keras # Set TensorFlow logging level for more information tf.get_logger().setLevel('INFO') +# def create_dataset(X, batch_size=1, is_training=True): +# """Create TensorFlow dataset with consistent approach for both training and validation.""" +# # Debug info +# print(f"Creating {'training' if is_training else 'validation'} dataset") +# print(f"Data shape: {X.shape}") +# print(f"Data dtype: {X.dtype}") +# print(f"Data range: min={np.min(X):.4f}, max={np.max(X):.4f}, mean={np.mean(X):.4f}") +# +# # Ensure data is float32 (TensorFlow works best with float32) +# X = X.astype(np.float32) +# +# dataset = tf.data.Dataset.from_tensor_slices(X) +# +# # Apply shuffling only for training data +# if is_training: +# dataset = dataset.shuffle(buffer_size=1000) +# +# # Apply batching with drop_remainder=False to handle all data +# dataset = dataset.batch(batch_size) +# +# # Prefetch for better performance +# dataset = dataset.prefetch(tf.data.AUTOTUNE) +# +# # Debug dataset +# for batch in dataset.take(1): +# print(f"Sample batch shape: {batch.shape}") +# print(f"Sample batch dtype: {batch.dtype}") +# print(f"Sample batch range: min={tf.reduce_min(batch):.4f}, max={tf.reduce_max(batch):.4f}") +# +# return dataset + def create_dataset(X, batch_size=1, is_training=True): - """Create TensorFlow dataset with consistent approach for both training and validation.""" - # Debug info - print(f"Creating {'training' if is_training else 'validation'} dataset") - print(f"Data shape: {X.shape}") - print(f"Data dtype: {X.dtype}") - print(f"Data range: min={np.min(X):.4f}, max={np.max(X):.4f}, mean={np.mean(X):.4f}") + """ + simple function to create a TensorFlow dataset. + Args: + X: + batch_size: + is_training: + + Returns: - # Ensure data is float32 (TensorFlow works best with float32) - X = X.astype(np.float32) + """ + X = tf.convert_to_tensor(X, dtype=tf.float32) + # Create dataset from tensor slices dataset = tf.data.Dataset.from_tensor_slices(X) # Apply shuffling only for training data if is_training: - dataset = dataset.shuffle(buffer_size=1000) + dataset = dataset.shuffle(buffer_size=min(1000, len(X))) - # Apply batching with drop_remainder=False to handle all data + # Apply batching (drop_remainder=False to handle all data) dataset = dataset.batch(batch_size) # Prefetch for better performance dataset = dataset.prefetch(tf.data.AUTOTUNE) - # Debug dataset - for batch in dataset.take(1): - print(f"Sample batch shape: {batch.shape}") - print(f"Sample batch dtype: {batch.dtype}") - print(f"Sample batch range: min={tf.reduce_min(batch):.4f}, max={tf.reduce_max(batch):.4f}") - return dataset +def plot_metrics(history, save_path='training_metrics.png'): + """ + Visualize training metrics over epochs. + + Args: + history: A Keras History object or dictionary containing training history + save_path: Path to save the plot image + """ + # Handle both Keras History objects and dictionaries + history_dict = history.history if hasattr(history, 'history') else history + + # Print available keys to debug + print(f"Available keys in history: {list(history_dict.keys())}") + + metrics = ['loss', 'recon', 'vq', 'perplexity'] + # Check for standard Keras naming (total_loss instead of loss, etc.) + metric_mapping = { + 'loss': ['loss', 'total_loss'], + 'recon': ['recon', 'recon_loss'], + 'vq': ['vq', 'vq_loss'], + 'perplexity': ['perplexity'] + } + + fig, axes = plt.subplots(len(metrics), 1, figsize=(12, 3*len(metrics)), sharex=True) + + # Handle case with only one metric + if len(metrics) == 1: + axes = [axes] + + for i, metric_base in enumerate(metrics): + ax = axes[i] + + # Try different possible metric names + for metric in metric_mapping[metric_base]: + # Plot training metric + if metric in history_dict: + ax.plot(history_dict[metric], 'b-', label=f'Train {metric}') + print(f"Plotting {metric} with {len(history_dict[metric])} points") + break + + # Try different possible validation metric names + for metric in metric_mapping[metric_base]: + val_metric = f'val_{metric}' + if val_metric in history_dict: + ax.plot(history_dict[val_metric], 'r-', label=f'Validation {metric}') + print(f"Plotting {val_metric} with {len(history_dict[val_metric])} points") + break + + ax.set_title(f'{metric_base.capitalize()} over epochs') + ax.set_ylabel('Value') + ax.grid(True) + ax.legend(loc='best') + + plt.xlabel('Epochs') + plt.tight_layout() + + # Save the figure in case display doesn't work + plt.savefig(save_path) + print(f"Plot saved to {save_path}") + + # Try to display + try: + plt.show() + except Exception as e: + print(f"Could not display plot: {e}") + + def main(): print("Starting SCQ parameter search...") @@ -98,32 +194,32 @@ def main(): # Define parameter search space - simplified to just one configuration for testing param_grid = [ # Explore different codebook_num - {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 8, 'heads': 4}, - {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, - {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 32, 'heads': 4}, - {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 64, 'heads': 4}, + # {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 8, 'heads': 4}, + # {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, + # {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 32, 'heads': 4}, + # {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 64, 'heads': 4}, {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 128, 'heads': 4}, - {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 256, 'heads': 4}, - {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 512, 'heads': 4}, - {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 1024, 'heads': 4}, - # Explore codebook_dim - {'general_embed_dim': 128, 'codebook_dim': 32, 'codebook_num': 16, 'heads': 4}, - {'general_embed_dim': 128, 'codebook_dim': 64, 'codebook_num': 16, 'heads': 4}, - {'general_embed_dim': 128, 'codebook_dim': 128, 'codebook_num': 16, 'heads': 4}, - # Explore heads - {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 2}, - {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 8}, - {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 16}, - {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 32}, - # Explore general_embed_dim - {'general_embed_dim': 64, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, - {'general_embed_dim': 256, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, - {'general_embed_dim': 512, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, + # {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 256, 'heads': 4}, + # {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 512, 'heads': 4}, + # {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 1024, 'heads': 4}, + # # Explore codebook_dim + # {'general_embed_dim': 128, 'codebook_dim': 32, 'codebook_num': 16, 'heads': 4}, + # {'general_embed_dim': 128, 'codebook_dim': 64, 'codebook_num': 16, 'heads': 4}, + # {'general_embed_dim': 128, 'codebook_dim': 128, 'codebook_num': 16, 'heads': 4}, + # # Explore heads + # {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 2}, + # {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 8}, + # {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 16}, + # {'general_embed_dim': 128, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 32}, + # # Explore general_embed_dim + # {'general_embed_dim': 64, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, + # {'general_embed_dim': 256, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, + # {'general_embed_dim': 512, 'codebook_dim': 16, 'codebook_num': 16, 'heads': 4}, ] # Common parameters for all configurations common_params = { - 'descrete_loss': False, + 'descrete_loss': True, 'weight_recon': 1.0, 'weight_vq': 1.0, } @@ -244,6 +340,10 @@ def on_epoch_end(self, epoch, logs=None): print("\nHistory keys:", history.history.keys()) for key, values in history.history.items(): print(f"{key}: {values}") + + # plot + plot_metrics(history) + except Exception as e: print(f"Error during training: {e}") continue @@ -324,12 +424,121 @@ def on_epoch_end(self, epoch, logs=None): print("\nParameter search complete!") print(f"Results saved to {output_dir}") +import os +import traceback + +def simple_run(batch_size=1): + """A simplified run using the MHC dataset instead of random data.""" + print("Starting simplified SCQ model run on MHC data...") -if __name__ == "__main__": try: - main() + # Create output directory for results + output_dir = "output/scq_simple_run" + os.makedirs(output_dir, exist_ok=True) + + # Load MHC data + print("Loading peptide embeddings...") + mhc1_pep2vec_embeddings = pd.read_parquet("data/Pep2Vec/wrapper_mhc1.parquet") + + # Select the latent columns + latent_columns = [col for col in mhc1_pep2vec_embeddings.columns if 'latent' in col] + print(f"Found {len(latent_columns)} latent columns for MHC1") + + # Extract latent features + X = mhc1_pep2vec_embeddings[latent_columns].values + print(f"MHC1 data shape: {X.shape}") + + # Data sanity check + print("Data overview:") + print(f"MHC1 - min: {np.min(X):.4f}, max: {np.max(X):.4f}, mean: {np.mean(X):.4f}, std: {np.std(X):.4f}") + + # Replace any NaN values with zeros + if np.isnan(X).any(): + print("Replacing NaN values in MHC1 with zeros") + X = np.nan_to_num(X) + + # Split data into train and test sets (80/20 split) + from sklearn.model_selection import train_test_split + X_train, X_test = train_test_split(X, test_size=0.2, random_state=42) + + # Create datasets + train_dataset = create_dataset(X_train, batch_size=batch_size, is_training=True) + test_dataset = create_dataset(X_test, batch_size=batch_size, is_training=False) + + # Initialize model with dimensions matching the input data + model = SCQ_model( + general_embed_dim=128, + codebook_dim=32, + codebook_num=16, + descrete_loss=True, + heads=4, + input_dim=X_train.shape[1] + ) + + # Print model summary + model.build(input_shape=(None, X_train.shape[1])) + print("Model summary:") + model.summary() + + # Compile model + model.compile(optimizer=keras.optimizers.Adam(learning_rate=0.001)) + + # Train with early stopping + callbacks = [ + tf.keras.callbacks.EarlyStopping(monitor='loss', patience=5), + tf.keras.callbacks.ModelCheckpoint( + filepath=os.path.join(output_dir, 'model_checkpoint.weights.h5'), + save_best_only=True, + save_weights_only=True, # Only save weights, not the full model + monitor='loss' + ) + ] + + # Train model and capture history + history = model.fit( + train_dataset, + epochs=1000, # Reduced from 1000 for quicker testing + callbacks=callbacks, + verbose=1 + ) + + # Plot training metrics + plot_metrics(history, save_path=os.path.join(output_dir, 'training_metrics.png')) + + # Save training history + pd.DataFrame(history.history).to_csv(os.path.join(output_dir, "model_history.csv"), index=False) + + # Test model on test data + print("Evaluating model on test data...") + evaluation = model.evaluate(test_dataset, return_dict=True) + print("Test metrics:", evaluation) + + # Generate and save example outputs + for batch in test_dataset.take(1): + output = model(batch) + # Save sample input and output + np.save(os.path.join(output_dir, "sample_input.npy"), batch.numpy()) + np.savez( + os.path.join(output_dir, "sample_output.npz"), + decoded=output[0].numpy(), + zq=output[1].numpy(), + pj=output[2].numpy() + ) + + print(f"Training complete. Results saved to {output_dir}") + except Exception as e: - print(f"Error in main function: {e}") + print(f"Error in simple_run: {e}") import traceback + traceback.print_exc() - traceback.print_exc() \ No newline at end of file +if __name__ == "__main__": + # try: + # main() + # except Exception as e: + # print(f"Error in main function: {e}") + # import traceback + # + # traceback.print_exc() + # simple run + simple_run() \ No newline at end of file diff --git a/utils/model.py b/utils/model.py index fc4c7675b..eadeaaf52 100644 --- a/utils/model.py +++ b/utils/model.py @@ -306,7 +306,8 @@ def call(self, inputs): b, h, n, o = tf.shape(out)[0], tf.shape(out)[-1], tf.shape(out)[1], tf.shape(out)[2] out = tf.reshape(out, [b, n, h * o]) # (B, N, H * E) out = tf.matmul(out, self.w_out) + self.b_out # (B,N,H*E)@(H*E,O)->(B,N,O) - out = tf.nn.softmax(out) + # out = tf.nn.softmax(out) # Disable softmax for regression tasks + out = tf.nn.sigmoid(out) return out def layernorm(self, inputs): @@ -320,9 +321,9 @@ def layernorm(self, inputs): class SCQ_model(tf.keras.models.Model): - def __init__(self, general_embed_dim=128, codebook_dim=16, codebook_num=64, + def __init__(self, input_dim, general_embed_dim=128, codebook_dim=16, codebook_num=64, descrete_loss=False, heads=4, names='SCQ_model', - weight_recon=1, weight_vq=1, input_dim=1024, **kwargs): + weight_recon=1, weight_vq=1, **kwargs): super().__init__() self.general_embed_dim = general_embed_dim self.codebook_dim = codebook_dim @@ -445,17 +446,22 @@ def compute_losses(self, x, decoded, vq_loss, out_P_proj): # Calculate reconstruction loss - element-wise cross-entropy # We'll use the manual formula for more control over dimensions epsilon = 1e-10 - recon_loss = -tf.reduce_sum(x * tf.math.log(decoded_clipped + epsilon), axis=-1) - recon_loss = tf.reduce_mean(recon_loss) + # recon_loss = -tf.reduce_sum(x * tf.math.log(decoded_clipped + epsilon), axis=-1) + # recon_loss = tf.reduce_mean(tf.square(x - decoded)) + # for sigmoid + recon_loss = tf.reduce_mean(tf.keras.losses.binary_crossentropy(x, tf.nn.sigmoid(decoded))) # Compute perplexity (codebook usage metric) perplexity = self.compute_perplexity(out_P_proj) # Add KL regularization to encourage more uniform codebook usage p_j = tf.reduce_mean(out_P_proj, axis=[0, 1]) + print("p_j:", p_j) p_uniform = tf.ones_like(p_j) / tf.cast(tf.shape(p_j)[0], tf.float32) - kl_loss = tf.reduce_sum(p_j * tf.math.log(p_j / p_uniform + epsilon)) - + # Use tf.clip_by_value to prevent log(0) issues + p_j_safe = tf.clip_by_value(p_j, epsilon, 1.0) + p_uniform_safe = tf.clip_by_value(p_uniform, epsilon, 1.0) + kl_loss = tf.reduce_sum(p_j_safe * tf.math.log(p_j_safe / p_uniform_safe)) # Combine losses with weights total_loss = (self.weight_recon * recon_loss + self.weight_vq * vq_loss + @@ -508,7 +514,36 @@ def random_one_hot_sequence(batch, seq_len, num_classes=21, class_probs=None): # Apply one-hot encoding one_hot_encoded = tf.one_hot(random_indices, depth=num_classes) - return one_hot_encoded + return one_hot_encoded''' + + +def create_dataset(X, batch_size=1, is_training=True): + """ + simple function to create a TensorFlow dataset. + Args: + X: + batch_size: + is_training: + + Returns: + + """ + X = tf.convert_to_tensor(X, dtype=tf.float32) + + # Create dataset from tensor slices + dataset = tf.data.Dataset.from_tensor_slices(X) + + # Apply shuffling only for training data + if is_training: + dataset = dataset.shuffle(buffer_size=min(1000, len(X))) + + # Apply batching (drop_remainder=False to handle all data) + dataset = dataset.batch(batch_size) + + # Prefetch for better performance + dataset = dataset.prefetch(tf.data.AUTOTUNE) + + return dataset import tensorflow as tf @@ -516,34 +551,445 @@ def random_one_hot_sequence(batch, seq_len, num_classes=21, class_probs=None): import pandas as pd import os -# Set parameters -os.makedirs('test_tmp', exist_ok=True) -batch_size = 600 -seq_length = 20 # Example sequence length -feature_dim = 21 # Must match encoder input dim -# Generate random input data (batch_size, seq_length, feature_dim) -x_train = random_one_hot_sequence(batch_size, seq_length, feature_dim) -# Initialize SCQ model -model = SCQ_model(general_embed_dim=128, codebook_dim=32, codebook_num=5, descrete_loss=False, heads=8) -# Compile model -model.compile(optimizer=keras.optimizers.Adam(learning_rate=0.001)) -# Train model and capture history -history = model.fit(x_train, epochs=1000, batch_size=batch_size) -# Convert history to DataFrame and save as CSV -history_df = pd.DataFrame(history.history) -history_df.to_csv("test_tmp/model_history.csv", index=False) -# Test model on new data -x_test = random_one_hot_sequence(batch_size, seq_length, feature_dim) -output = model(x_test) -# Save input and output arrays as .npy files - -os.makedirs -np.save("test_tmp/input_data.npy", x_test) -np.savez("test_tmp/output_data.npz", decoded=output[0].numpy(), zq=output[1].numpy(), pj=output[2].numpy()) -print("Training complete. Model history saved as 'model_history.csv'.") -print("Input and output arrays saved as 'input_data.npy' and 'output_data.npy'.") -print((output[2])) -print(x_train[0])''' +# # Set parameters +# os.makedirs('test_tmp', exist_ok=True) +# batch_size = 600 +# seq_length = 20 # Example sequence length +# feature_dim = 21 # Must match encoder input dim +# # Generate random input data (batch_size, seq_length, feature_dim) +# x_train = random_one_hot_sequence(batch_size, seq_length, feature_dim) +# # Initialize SCQ model +# model = SCQ_model(input_dim=feature_dim, general_embed_dim=128, codebook_dim=32, codebook_num=5, descrete_loss=False, heads=8) +# # Compile model +# model.compile(optimizer=keras.optimizers.Adam(learning_rate=0.001)) +# # Train model and capture history +# history = model.fit(x_train, epochs=1000, batch_size=batch_size) +# # Convert history to DataFrame and save as CSV +# history_df = pd.DataFrame(history.history) +# history_df.to_csv("test_tmp/model_history.csv", index=False) +# # Test model on new data +# x_test = random_one_hot_sequence(batch_size, seq_length, feature_dim) +# output = model(x_test) +# # Save input and output arrays as .npy files +# +# os.makedirs +# np.save("test_tmp/input_data.npy", x_test) +# np.savez("test_tmp/output_data.npz", decoded=output[0].numpy(), zq=output[1].numpy(), pj=output[2].numpy()) +# print("Training complete. Model history saved as 'model_history.csv'.") +# print("Input and output arrays saved as 'input_data.npy' and 'output_data.npy'.") +# print((output[2])) +# print(x_train[0]) + +# # Set parameters +# os.makedirs('test_tmp', exist_ok=True) +# batch_size = 4 +# seq_length = 1024 # this is the length of the latent from pep2vec +# feature_dim = 1 # we have the latent representation +# mhc1_pep2vec_embeddings = pd.read_parquet("../data/Pep2Vec/wrapper_mhc1.parquet") +# # Select the latent columns (the columns that has latent in their name) +# mhc1_latent_columns = [col for col in mhc1_pep2vec_embeddings.columns if 'latent' in col] +# print(f"Found {len(mhc1_latent_columns)} latent columns for MHC1") +# X_mhc1 = mhc1_pep2vec_embeddings[mhc1_latent_columns].values +# X = X_mhc1.reshape(-1, seq_length, feature_dim) +# from sklearn.model_selection import train_test_split +# X_train, X_test = train_test_split(X, test_size=0.2, random_state=42) +# +# # Create datasets +# train_dataset = create_dataset(X_train, batch_size=batch_size, is_training=True) +# test_dataset = create_dataset(X_test, batch_size=batch_size, is_training=False) +# +# # Initialize SCQ model +# model = SCQ_model(input_dim=feature_dim, general_embed_dim=128, codebook_dim=32, codebook_num=5, descrete_loss=False, heads=8) +# # Compile model +# model.compile(optimizer=keras.optimizers.Adam(learning_rate=0.001)) +# # Train model and capture history +# history = model.fit(train_dataset, epochs=20, batch_size=batch_size) +# # Convert history to DataFrame and save as CSV +# history_df = pd.DataFrame(history.history) +# history_df.to_csv("test_tmp/model_history.csv", index=False) +# +# # Test model on new data correctly by iterating through batches +# decoded_outputs = [] +# zq_outputs = [] +# pj_outputs = [] +# +# for batch in test_dataset: +# output = model(batch) +# decoded_outputs.append(output[0].numpy()) +# zq_outputs.append(output[1].numpy()) +# pj_outputs.append(output[2].numpy()) +# +# # Save input and output arrays as .npy files +# os.makedirs('test_tmp', exist_ok=True) +# np.save("test_tmp/input_data.npy", X_test) # Save the actual test data +# np.savez("test_tmp/output_data.npz", +# decoded=np.vstack(decoded_outputs), +# zq=np.vstack(zq_outputs), +# pj=np.vstack(pj_outputs)) +# +# print("Training complete. Model history saved as 'model_history.csv'.") +# print("Input and output arrays saved as 'input_data.npy' and 'output_data.npz'.") +# print("Shape of model outputs:", np.vstack(pj_outputs).shape) + + +import os +import numpy as np +import pandas as pd +import tensorflow as tf +from tensorflow import keras +import matplotlib.pyplot as plt +from sklearn.model_selection import train_test_split +from sklearn.metrics import mean_squared_error +import itertools + + +def create_dataset(X, batch_size=4, is_training=True): + """Create a TensorFlow dataset from input array X.""" + dataset = tf.data.Dataset.from_tensor_slices(X) + if is_training: + dataset = dataset.shuffle(buffer_size=len(X)) + dataset = dataset.batch(batch_size) + return dataset + + +def load_data(data_path, test_size=0.2, random_state=42): + """Load and prepare data for training.""" + # Load data + embeddings = pd.read_parquet(data_path) + + # Select the latent columns + latent_columns = [col for col in embeddings.columns if 'latent' in col] + print(f"Found {len(latent_columns)} latent columns") + + # Extract values and reshape + X = embeddings[latent_columns].values + seq_length = len(latent_columns) + feature_dim = 1 + X = X.reshape(-1, seq_length, feature_dim) + + # Split into train and test sets + X_train, X_test = train_test_split(X, test_size=test_size, random_state=random_state) + + return X_train, X_test, seq_length, feature_dim + + +def train_scq_model(X_train, X_test, feature_dim, general_embed_dim, codebook_dim, + codebook_num, batch_size=4, epochs=20, learning_rate=0.001, + heads=8, descrete_loss=False, output_dir="test_tmp"): + """Train an SCQ model with the given parameters.""" + # Create directories if they don't exist + os.makedirs(output_dir, exist_ok=True) + + # Create datasets + train_dataset = create_dataset(X_train, batch_size=batch_size, is_training=True) + test_dataset = create_dataset(X_test, batch_size=batch_size, is_training=False) + + # Initialize SCQ model + model = SCQ_model(input_dim=int(feature_dim), + general_embed_dim=int(general_embed_dim), + codebook_dim=int(codebook_dim), + codebook_num=int(codebook_num), + descrete_loss=descrete_loss, + heads=int(heads)) + + # Compile model + model.compile(optimizer=keras.optimizers.Adam(learning_rate=learning_rate)) + + # Train model and capture history + history = model.fit(train_dataset, epochs=epochs, batch_size=batch_size) + + # Save training history + history_df = pd.DataFrame(history.history) + history_path = os.path.join(output_dir, f"model_history_cb{codebook_num}_emb{general_embed_dim}.csv") + history_df.to_csv(history_path, index=False) + + # Evaluate model on test data + decoded_outputs, zq_outputs, pj_outputs = evaluate_model(model, test_dataset) + + # Save outputs + output_path = os.path.join(output_dir, f"output_data_cb{codebook_num}_emb{general_embed_dim}.npz") + np.savez(output_path, + decoded=np.vstack(decoded_outputs), + zq=np.vstack(zq_outputs), + pj=np.vstack(pj_outputs)) + + # Calculate metrics + mse = calculate_reconstruction_mse(X_test, np.vstack(decoded_outputs)) + + return model, history, mse + + +def evaluate_model(model, test_dataset): + """Evaluate the model on test data.""" + decoded_outputs = [] + zq_outputs = [] + pj_outputs = [] + + for batch in test_dataset: + output = model(batch) + decoded_outputs.append(output[0].numpy()) + zq_outputs.append(output[1].numpy()) + pj_outputs.append(output[2].numpy()) + return decoded_outputs, zq_outputs, pj_outputs +def calculate_reconstruction_mse(X_test, decoded_output): + """Calculate mean squared error between input and reconstructed output.""" + # Reshape if necessary to match dimensions + if X_test.shape != decoded_output.shape: + # Adjust shapes as needed based on your model's output + pass + + return mean_squared_error(X_test.reshape(-1), decoded_output.reshape(-1)) + + +def plot_training_history(history_df, title="Training History", output_path=None): + """Plot training metrics from history dataframe.""" + plt.figure(figsize=(12, 6)) + + # Plot all metrics in the history + for column in history_df.columns: + plt.plot(history_df[column], label=column) + + plt.title(title) + plt.xlabel('Epoch') + plt.ylabel('Value') + plt.legend() + plt.grid(True) + + if output_path: + plt.savefig(output_path) + plt.close() + else: + plt.show() + + +def plot_reconstruction_comparison(original, reconstructed, n_samples=5, output_path=None): + """Plot comparison between original and reconstructed sequences.""" + # Randomly select n_samples sequences to visualize + indices = np.random.choice(len(original), size=min(n_samples, len(original)), replace=False) + + plt.figure(figsize=(15, 3 * n_samples)) + + for i, idx in enumerate(indices): + # Plot original sequence + plt.subplot(n_samples, 2, 2 * i + 1) + plt.plot(original[idx].flatten()) + plt.title(f"Original Sequence {idx}") + plt.grid(True) + + # Plot reconstructed sequence + plt.subplot(n_samples, 2, 2 * i + 2) + plt.plot(reconstructed[idx].flatten()) + plt.title(f"Reconstructed Sequence {idx}") + plt.grid(True) + + plt.tight_layout() + + if output_path: + plt.savefig(output_path) + plt.close() + else: + plt.show() + + +def parameter_search(X_train, X_test, feature_dim, batch_size=4, epochs=20, learning_rate=0.001, + codebook_nums=[3, 5, 7], embed_dims=[64, 128, 256], + codebook_dim=32, heads=8, output_dir="parameter_search"): + """ + Perform grid search over codebook_num and general_embed_dim parameters. + Returns the best parameters based on reconstruction MSE. + """ + os.makedirs(output_dir, exist_ok=True) + + results = [] + + # Create all combinations of parameters + param_combinations = list(itertools.product(codebook_nums, embed_dims)) + total_combinations = len(param_combinations) + + print(f"Starting parameter search with {total_combinations} combinations...") + + for i, (codebook_num, embed_dim) in enumerate(param_combinations): + print(f"Training combination {i + 1}/{total_combinations}: codebook_num={codebook_num}, embed_dim={embed_dim}") + + try: + # Train the model with this parameter combination + model, history, mse = train_scq_model( + X_train, X_test, feature_dim, + general_embed_dim=embed_dim, + codebook_dim=codebook_dim, + codebook_num=codebook_num, + batch_size=batch_size, + epochs=epochs, + learning_rate=learning_rate, + heads=heads, + output_dir=output_dir + ) + + # Store results + results.append({ + 'codebook_num': codebook_num, + 'general_embed_dim': embed_dim, + 'mse': mse, + 'history': history + }) + + # Plot training history + history_df = pd.DataFrame(history.history) + plot_training_history( + history_df, + title=f"Training History (codebook_num={codebook_num}, embed_dim={embed_dim})", + output_path=os.path.join(output_dir, f"history_plot_cb{codebook_num}_emb{embed_dim}.png") + ) + + except Exception as e: + print(f"Error training with codebook_num={codebook_num}, embed_dim={embed_dim}: {e}") + + # Create results dataframe + results_df = pd.DataFrame([(r['codebook_num'], r['general_embed_dim'], r['mse']) + for r in results], + columns=['codebook_num', 'general_embed_dim', 'mse']) + + # Save results + results_df.to_csv(os.path.join(output_dir, "parameter_search_results.csv"), index=False) + + # Find best parameters + best_idx = results_df['mse'].idxmin() + best_params = results_df.loc[best_idx] + + print(f"Parameter search complete. Best parameters:") + print(f" codebook_num: {best_params['codebook_num']}") + print(f" general_embed_dim: {best_params['general_embed_dim']}") + print(f" MSE: {best_params['mse']}") + + # Plot results heatmap + plot_parameter_search_results(results_df, output_dir) + + return best_params, results_df + + +def plot_parameter_search_results(results_df, output_dir): + """Plot heatmap of parameter search results.""" + # Create pivot table for heatmap + pivot_df = results_df.pivot(index='codebook_num', columns='general_embed_dim', values='mse') + + plt.figure(figsize=(10, 8)) + plt.imshow(pivot_df, cmap='viridis_r') # Reverse colormap so darker is better (lower MSE) + + # Set labels + plt.colorbar(label='MSE (lower is better)') + plt.title('Parameter Search Results') + plt.xlabel('General Embedding Dimension') + plt.ylabel('Codebook Number') + + # Set tick labels + plt.xticks(range(len(pivot_df.columns)), pivot_df.columns) + plt.yticks(range(len(pivot_df.index)), pivot_df.index) + + # Add text annotations + for i in range(len(pivot_df.index)): + for j in range(len(pivot_df.columns)): + value = pivot_df.iloc[i, j] + if not np.isnan(value): + plt.text(j, i, f'{value:.4f}', ha='center', va='center', + color='white' if value > pivot_df.values.mean() else 'black') + + plt.tight_layout() + plt.savefig(os.path.join(output_dir, "parameter_search_heatmap.png")) + plt.close() + + +def run_scq_pipeline(data_path, output_dir="test_tmp", run_param_search=True, + batch_size=4, epochs=20, learning_rate=0.001, + codebook_num=5, general_embed_dim=128, codebook_dim=32, heads=8): + """ + Main function to run the complete SCQ pipeline with optional parameter search. + """ + # Load and prepare data + X_train, X_test, seq_length, feature_dim = load_data(data_path) + + # Create output directory + os.makedirs(output_dir, exist_ok=True) + + # Save input data + np.save(os.path.join(output_dir, "input_data.npy"), X_test) + + if run_param_search: + # Run parameter search to find optimal values + best_params, results_df = parameter_search( + X_train, X_test, feature_dim, + batch_size=batch_size, + epochs=epochs, + learning_rate=learning_rate, + output_dir=os.path.join(output_dir, "param_search") + ) + + # Use best parameters for final model - ensure they are integers + codebook_num = int(best_params['codebook_num']) + general_embed_dim = int(best_params['general_embed_dim']) + + # Train final model with selected/best parameters + print(f"Training final model with codebook_num={codebook_num}, general_embed_dim={general_embed_dim}") + final_model, final_history, final_mse = train_scq_model( + X_train, X_test, feature_dim, + general_embed_dim=general_embed_dim, + codebook_dim=codebook_dim, + codebook_num=codebook_num, + batch_size=batch_size, + epochs=epochs, + learning_rate=learning_rate, + heads=heads, + output_dir=output_dir + ) + + # Evaluate the final model + test_dataset = create_dataset(X_test, batch_size=batch_size, is_training=False) + decoded_outputs, zq_outputs, pj_outputs = evaluate_model(final_model, test_dataset) + + # Create visualizations + history_df = pd.DataFrame(final_history.history) + plot_training_history( + history_df, + title=f"Final Model Training History (codebook_num={codebook_num}, embed_dim={general_embed_dim})", + output_path=os.path.join(output_dir, "final_model_history_plot.png") + ) + + plot_reconstruction_comparison( + X_test, + np.vstack(decoded_outputs), + n_samples=5, + output_path=os.path.join(output_dir, "reconstruction_comparison.png") + ) + + print(f"Pipeline completed successfully.") + print(f"Final model MSE: {final_mse}") + print(f"Final model parameters: codebook_num={codebook_num}, general_embed_dim={general_embed_dim}") + print(f"Results saved to {output_dir}") + + return final_model, final_mse, (codebook_num, general_embed_dim) + + +# Example usage: +if __name__ == "__main__": + # Example usage of the pipeline + data_path = "../data/Pep2Vec/wrapper_mhc1.parquet" + + # # Run full pipeline with parameter search + # model, mse, best_params = run_scq_pipeline( + # data_path=data_path, + # output_dir="scq_results", + # run_param_search=True, + # batch_size=4, + # epochs=20 + # ) + + # Alternatively, run with specific parameters (no search) + model, mse, params = run_scq_pipeline( + data_path=data_path, + output_dir="scq_results_fixed", + run_param_search=False, + codebook_num=7, + general_embed_dim=256 + ) \ No newline at end of file From 322f76748e8ee0a9e399e91b4d5585d4ecae0ac9 Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 17 Apr 2025 15:28:52 +0200 Subject: [PATCH 11/83] refactor model and run script: update SCQ model parameters and enhance dataset handling --- run_pMHC_DL.py | 376 ++++++++++++++++++++++++++++++++++++++++++++++- utils/model.py | 388 +++---------------------------------------------- 2 files changed, 393 insertions(+), 371 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index 5c36c3c31..463e76160 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -1,4 +1,4 @@ -import os +'''import os import json import numpy as np import pandas as pd @@ -468,8 +468,8 @@ def simple_run(batch_size=1): # Initialize model with dimensions matching the input data model = SCQ_model( general_embed_dim=128, - codebook_dim=32, - codebook_num=16, + codebook_dim=16, + codebook_num=8, descrete_loss=True, heads=4, input_dim=X_train.shape[1] @@ -541,4 +541,372 @@ def simple_run(batch_size=1): # # traceback.print_exc() # simple run - simple_run() \ No newline at end of file + simple_run()''' + + +import os +import numpy as np +import pandas as pd +import tensorflow as tf +from tensorflow import keras +import matplotlib.pyplot as plt +from sklearn.model_selection import train_test_split +from sklearn.metrics import mean_squared_error +import itertools +from utils.model import SCQ_model + + +def create_dataset(X, batch_size=4, is_training=True): + """Create a TensorFlow dataset from input array X.""" + dataset = tf.data.Dataset.from_tensor_slices(X) + if is_training: + dataset = dataset.shuffle(buffer_size=len(X)) + dataset = dataset.batch(batch_size) + return dataset + + +def load_data(data_path, test_size=0.2, random_state=42): + """Load and prepare data for training.""" + # Load data + embeddings = pd.read_parquet(data_path) + + # Select the latent columns + latent_columns = [col for col in embeddings.columns if 'latent' in col] + print(f"Found {len(latent_columns)} latent columns") + + # Extract values and reshape + X = embeddings[latent_columns].values + seq_length = len(latent_columns) + feature_dim = 1 + X = X.reshape(-1, seq_length, feature_dim) + + # Split into train and test sets + X_train, X_test = train_test_split(X, test_size=test_size, random_state=random_state) + + return X_train, X_test, seq_length, feature_dim + + +def train_scq_model(X_train, X_test, feature_dim, general_embed_dim, codebook_dim, + codebook_num, batch_size=4, epochs=20, learning_rate=0.001, + heads=8, descrete_loss=False, output_dir="test_tmp"): + """Train an SCQ model with the given parameters.""" + # Create directories if they don't exist + os.makedirs(output_dir, exist_ok=True) + + # Create datasets + train_dataset = create_dataset(X_train, batch_size=batch_size, is_training=True) + test_dataset = create_dataset(X_test, batch_size=batch_size, is_training=False) + + # Initialize SCQ model + model = SCQ_model(input_dim=int(feature_dim), + general_embed_dim=int(general_embed_dim), + codebook_dim=int(codebook_dim), + codebook_num=int(codebook_num), + descrete_loss=descrete_loss, + heads=int(heads)) + + # Compile model + model.compile(optimizer=keras.optimizers.Adam(learning_rate=learning_rate)) + + # Train model and capture history + history = model.fit(train_dataset, epochs=epochs, batch_size=batch_size) + + # Save training history + history_df = pd.DataFrame(history.history) + history_path = os.path.join(output_dir, f"model_history_cb{codebook_num}_emb{general_embed_dim}.csv") + history_df.to_csv(history_path, index=False) + + # Evaluate model on test data + decoded_outputs, zq_outputs, pj_outputs = evaluate_model(model, test_dataset) + + # Save outputs + output_path = os.path.join(output_dir, f"output_data_cb{codebook_num}_emb{general_embed_dim}.npz") + np.savez(output_path, + decoded=np.vstack(decoded_outputs), + zq=np.vstack(zq_outputs), + pj=np.vstack(pj_outputs)) + + # Calculate metrics + mse = calculate_reconstruction_mse(X_test, np.vstack(decoded_outputs)) + + return model, history, mse + + +def evaluate_model(model, test_dataset): + """Evaluate the model on test data.""" + decoded_outputs = [] + zq_outputs = [] + pj_outputs = [] + + for batch in test_dataset: + output = model(batch) + decoded_outputs.append(output[0].numpy()) + zq_outputs.append(output[1].numpy()) + pj_outputs.append(output[2].numpy()) + + return decoded_outputs, zq_outputs, pj_outputs + + +def calculate_reconstruction_mse(X_test, decoded_output): + """Calculate mean squared error between input and reconstructed output.""" + # Reshape if necessary to match dimensions + if X_test.shape != decoded_output.shape: + # Adjust shapes as needed based on your model's output + pass + + return mean_squared_error(X_test.reshape(-1), decoded_output.reshape(-1)) + + +def plot_training_history(history_df, title="Training History", output_path=None): + """Plot training metrics from history dataframe.""" + plt.figure(figsize=(12, 6)) + + # Plot all metrics in the history + for column in history_df.columns: + plt.plot(history_df[column], label=column) + + plt.title(title) + plt.xlabel('Epoch') + plt.ylabel('Value') + plt.legend() + plt.grid(True) + + if output_path: + plt.savefig(output_path) + plt.close() + else: + plt.show() + + +def plot_reconstruction_comparison(original, reconstructed, n_samples=5, output_path=None): + """Plot comparison between original and reconstructed sequences.""" + # Randomly select n_samples sequences to visualize + indices = np.random.choice(len(original), size=min(n_samples, len(original)), replace=False) + + plt.figure(figsize=(15, 3 * n_samples)) + + for i, idx in enumerate(indices): + # Plot original sequence + plt.subplot(n_samples, 2, 2 * i + 1) + plt.plot(original[idx].flatten()) + plt.title(f"Original Sequence {idx}") + plt.grid(True) + + # Plot reconstructed sequence + plt.subplot(n_samples, 2, 2 * i + 2) + plt.plot(reconstructed[idx].flatten()) + plt.title(f"Reconstructed Sequence {idx}") + plt.grid(True) + + plt.tight_layout() + + if output_path: + plt.savefig(output_path) + plt.close() + else: + plt.show() + + +def parameter_search(X_train, X_test, feature_dim, batch_size=4, epochs=20, learning_rate=0.001, + codebook_nums=[4,8,16,32,64,128,256,512,1024], embed_dims=[64, 128, 256], + codebook_dim=21, heads=8, output_dir="parameter_search"): + """ + Perform grid search over codebook_num and general_embed_dim parameters. + Returns the best parameters based on reconstruction MSE. + """ + os.makedirs(output_dir, exist_ok=True) + + results = [] + + # Create all combinations of parameters + param_combinations = list(itertools.product(codebook_nums, embed_dims)) + total_combinations = len(param_combinations) + + print(f"Starting parameter search with {total_combinations} combinations...") + + for i, (codebook_num, embed_dim) in enumerate(param_combinations): + print(f"Training combination {i + 1}/{total_combinations}: codebook_num={codebook_num}, embed_dim={embed_dim}") + + try: + # Train the model with this parameter combination + model, history, mse = train_scq_model( + X_train, X_test, feature_dim, + general_embed_dim=embed_dim, + codebook_dim=codebook_dim, + codebook_num=codebook_num, + batch_size=batch_size, + epochs=epochs, + learning_rate=learning_rate, + heads=heads, + output_dir=output_dir + ) + + # Store results + results.append({ + 'codebook_num': codebook_num, + 'general_embed_dim': embed_dim, + 'mse': mse, + 'history': history + }) + + # Plot training history + history_df = pd.DataFrame(history.history) + plot_training_history( + history_df, + title=f"Training History (codebook_num={codebook_num}, embed_dim={embed_dim})", + output_path=os.path.join(output_dir, f"history_plot_cb{codebook_num}_emb{embed_dim}.png") + ) + + except Exception as e: + print(f"Error training with codebook_num={codebook_num}, embed_dim={embed_dim}: {e}") + + # Create results dataframe + results_df = pd.DataFrame([(r['codebook_num'], r['general_embed_dim'], r['mse']) + for r in results], + columns=['codebook_num', 'general_embed_dim', 'mse']) + + # Save results + results_df.to_csv(os.path.join(output_dir, "parameter_search_results.csv"), index=False) + + # Find best parameters + best_idx = results_df['mse'].idxmin() + best_params = results_df.loc[best_idx] + + print(f"Parameter search complete. Best parameters:") + print(f" codebook_num: {best_params['codebook_num']}") + print(f" general_embed_dim: {best_params['general_embed_dim']}") + print(f" MSE: {best_params['mse']}") + + # Plot results heatmap + plot_parameter_search_results(results_df, output_dir) + + return best_params, results_df + + +def plot_parameter_search_results(results_df, output_dir): + """Plot heatmap of parameter search results.""" + # Create pivot table for heatmap + pivot_df = results_df.pivot(index='codebook_num', columns='general_embed_dim', values='mse') + + plt.figure(figsize=(10, 8)) + plt.imshow(pivot_df, cmap='viridis_r') # Reverse colormap so darker is better (lower MSE) + + # Set labels + plt.colorbar(label='MSE (lower is better)') + plt.title('Parameter Search Results') + plt.xlabel('General Embedding Dimension') + plt.ylabel('Codebook Number') + + # Set tick labels + plt.xticks(range(len(pivot_df.columns)), pivot_df.columns) + plt.yticks(range(len(pivot_df.index)), pivot_df.index) + + # Add text annotations + for i in range(len(pivot_df.index)): + for j in range(len(pivot_df.columns)): + value = pivot_df.iloc[i, j] + if not np.isnan(value): + plt.text(j, i, f'{value:.4f}', ha='center', va='center', + color='white' if value > pivot_df.values.mean() else 'black') + + plt.tight_layout() + plt.savefig(os.path.join(output_dir, "parameter_search_heatmap.png")) + plt.close() + + +def run_scq_pipeline(data_path, output_dir="test_tmp", run_param_search=True, + batch_size=4, epochs=3, learning_rate=0.001, + codebook_num=5, general_embed_dim=128, codebook_dim=32, heads=8): + """ + Main function to run the complete SCQ pipeline with optional parameter search. + """ + # Load and prepare data + X_train, X_test, seq_length, feature_dim = load_data(data_path) + + # Create output directory + os.makedirs(output_dir, exist_ok=True) + + # Save input data + np.save(os.path.join(output_dir, "input_data.npy"), X_test) + + if run_param_search: + # Run parameter search to find optimal values + best_params, results_df = parameter_search( + X_train, X_test, feature_dim, + batch_size=batch_size, + epochs=epochs, + learning_rate=learning_rate, + output_dir=os.path.join(output_dir, "param_search") + ) + + # Use best parameters for final model - ensure they are integers + codebook_num = int(best_params['codebook_num']) + general_embed_dim = int(best_params['general_embed_dim']) + + # Train final model with selected/best parameters + print(f"Training final model with codebook_num={codebook_num}, general_embed_dim={general_embed_dim}") + final_model, final_history, final_mse = train_scq_model( + X_train, X_test, feature_dim, + general_embed_dim=general_embed_dim, + codebook_dim=codebook_dim, + codebook_num=codebook_num, + batch_size=batch_size, + epochs=epochs, + learning_rate=learning_rate, + heads=heads, + output_dir=output_dir + ) + + # Evaluate the final model + test_dataset = create_dataset(X_test, batch_size=batch_size, is_training=False) + decoded_outputs, zq_outputs, pj_outputs = evaluate_model(final_model, test_dataset) + + # Create visualizations + history_df = pd.DataFrame(final_history.history) + plot_training_history( + history_df, + title=f"Final Model Training History (codebook_num={codebook_num}, embed_dim={general_embed_dim})", + output_path=os.path.join(output_dir, "final_model_history_plot.png") + ) + + plot_reconstruction_comparison( + X_test, + np.vstack(decoded_outputs), + n_samples=5, + output_path=os.path.join(output_dir, "reconstruction_comparison.png") + ) + + print(f"Pipeline completed successfully.") + print(f"Final model MSE: {final_mse}") + print(f"Final model parameters: codebook_num={codebook_num}, general_embed_dim={general_embed_dim}") + print(f"Results saved to {output_dir}") + + return final_model, final_mse, (codebook_num, general_embed_dim) + + +# Example usage: +if __name__ == "__main__": + # Example usage of the pipeline + data_path = "data/Pep2Vec/wrapper_mhc1.parquet" + + # # Run full pipeline with parameter search + # model, mse, best_params = run_scq_pipeline( + # data_path=data_path, + # output_dir="scq_results", + # run_param_search=True, + # batch_size=4, + # epochs=20 + # ) + + # Alternatively, run with specific parameters (no search) + model, mse, params = run_scq_pipeline( + data_path=data_path, + output_dir="scq_results_fixed", + run_param_search=False, + codebook_num=16, + codebook_dim=64, + heads=8, + batch_size=1, + general_embed_dim=256, + epochs=20 + ) \ No newline at end of file diff --git a/utils/model.py b/utils/model.py index eadeaaf52..bfca1051e 100644 --- a/utils/model.py +++ b/utils/model.py @@ -223,6 +223,7 @@ def build(self, input_shape): initializer='random_normal', trainable=True, name=f'dout_{self.names}') + def call(self, inputs): x = tf.matmul(inputs, self.d_w) + self.d_b # (B,N,I)->(B,N,E) x = self.layernorm(x) @@ -289,6 +290,9 @@ def build(self, input_shape): self.b_out = self.add_weight(shape=(self.dim_output,), trainable=True, initializer='zeros', name=f'b_out_{self.names}') + # mlp head + self.mlp_head1 = layers.Dense(self.dim_output, activation='tanh', name=f'mlp_head_{self.names}') + def call(self, inputs): Zq = inputs # (B,N,embed_dim), #(B,N,1), (1,) x = tf.matmul(Zq, self.w_in) + self.b_in @@ -307,7 +311,9 @@ def call(self, inputs): out = tf.reshape(out, [b, n, h * o]) # (B, N, H * E) out = tf.matmul(out, self.w_out) + self.b_out # (B,N,H*E)@(H*E,O)->(B,N,O) # out = tf.nn.softmax(out) # Disable softmax for regression tasks - out = tf.nn.sigmoid(out) + # out = tf.nn.sigmoid(out) + # mlp head + out = self.mlp_head1(out) return out def layernorm(self, inputs): @@ -321,10 +327,11 @@ def layernorm(self, inputs): class SCQ_model(tf.keras.models.Model): - def __init__(self, input_dim, general_embed_dim=128, codebook_dim=16, codebook_num=64, + def __init__(self, input_dim=1024, general_embed_dim=128, codebook_dim=16, codebook_num=64, descrete_loss=False, heads=4, names='SCQ_model', - weight_recon=1, weight_vq=1, **kwargs): + weight_recon=1, weight_vq=0.2, **kwargs): super().__init__() + self.input_dim = input_dim self.general_embed_dim = general_embed_dim self.codebook_dim = codebook_dim self.codebook_num = codebook_num @@ -334,13 +341,15 @@ def __init__(self, input_dim, general_embed_dim=128, codebook_dim=16, codebook_ self.weight_recon = tf.cast(weight_recon, tf.float32) self.weight_vq = tf.cast(weight_vq, tf.float32) # define model - self.encoder = Encoder(dim_input=input_dim, dim_embed=self.general_embed_dim, heads=self.heads) + # self.mlp_input = layers.Dense(self.input_dim, activation='swish', name=f'mlp_input_{self.names}') + self.encoder = Encoder(dim_input=self.input_dim, dim_embed=self.general_embed_dim, heads=self.heads) self.scq = SCQ(dim_input=self.general_embed_dim, dim_embed=self.codebook_dim, num_embed=self.codebook_num, descrete_loss=self.descrete_loss) self.decoder = Decoder(dim_input=self.codebook_dim, dim_embed=self.general_embed_dim, - dim_output=input_dim, heads=self.heads) + dim_output=self.input_dim, heads=self.heads) + # self.mlp_output = layers.Dense(self.input_dim, activation='swish', name=f'mlp_output_{self.names}') # Loss trackers self.total_loss_tracker = tf.keras.metrics.Mean(name='total_loss') @@ -359,9 +368,12 @@ def metrics(self): def train_step(self, x): with tf.GradientTape() as tape: + # Forward pass + # x = self.mlp_input(x) encoded = self.encoder(x) Zq, out_P_proj, vq_loss = self.scq(encoded) # (B,N,E),(B,N,K),(1,) decoded = self.decoder(Zq) + # out_P_proj = self.mlp_output(out_P_proj) # (B,N,K) # Calculate losses using the new method losses = self.compute_losses(x, decoded, vq_loss, out_P_proj) @@ -449,7 +461,10 @@ def compute_losses(self, x, decoded, vq_loss, out_P_proj): # recon_loss = -tf.reduce_sum(x * tf.math.log(decoded_clipped + epsilon), axis=-1) # recon_loss = tf.reduce_mean(tf.square(x - decoded)) # for sigmoid - recon_loss = tf.reduce_mean(tf.keras.losses.binary_crossentropy(x, tf.nn.sigmoid(decoded))) + # recon_loss = tf.reduce_mean(tf.keras.losses.binary_crossentropy(x, tf.nn.sigmoid(decoded))) + # normal loss + recon_loss = tf.reduce_mean(tf.keras.losses.binary_crossentropy(x, decoded_clipped)) + # Compute perplexity (codebook usage metric) perplexity = self.compute_perplexity(out_P_proj) @@ -632,364 +647,3 @@ def create_dataset(X, batch_size=1, is_training=True): # print("Shape of model outputs:", np.vstack(pj_outputs).shape) -import os -import numpy as np -import pandas as pd -import tensorflow as tf -from tensorflow import keras -import matplotlib.pyplot as plt -from sklearn.model_selection import train_test_split -from sklearn.metrics import mean_squared_error -import itertools - - -def create_dataset(X, batch_size=4, is_training=True): - """Create a TensorFlow dataset from input array X.""" - dataset = tf.data.Dataset.from_tensor_slices(X) - if is_training: - dataset = dataset.shuffle(buffer_size=len(X)) - dataset = dataset.batch(batch_size) - return dataset - - -def load_data(data_path, test_size=0.2, random_state=42): - """Load and prepare data for training.""" - # Load data - embeddings = pd.read_parquet(data_path) - - # Select the latent columns - latent_columns = [col for col in embeddings.columns if 'latent' in col] - print(f"Found {len(latent_columns)} latent columns") - - # Extract values and reshape - X = embeddings[latent_columns].values - seq_length = len(latent_columns) - feature_dim = 1 - X = X.reshape(-1, seq_length, feature_dim) - - # Split into train and test sets - X_train, X_test = train_test_split(X, test_size=test_size, random_state=random_state) - - return X_train, X_test, seq_length, feature_dim - - -def train_scq_model(X_train, X_test, feature_dim, general_embed_dim, codebook_dim, - codebook_num, batch_size=4, epochs=20, learning_rate=0.001, - heads=8, descrete_loss=False, output_dir="test_tmp"): - """Train an SCQ model with the given parameters.""" - # Create directories if they don't exist - os.makedirs(output_dir, exist_ok=True) - - # Create datasets - train_dataset = create_dataset(X_train, batch_size=batch_size, is_training=True) - test_dataset = create_dataset(X_test, batch_size=batch_size, is_training=False) - - # Initialize SCQ model - model = SCQ_model(input_dim=int(feature_dim), - general_embed_dim=int(general_embed_dim), - codebook_dim=int(codebook_dim), - codebook_num=int(codebook_num), - descrete_loss=descrete_loss, - heads=int(heads)) - - # Compile model - model.compile(optimizer=keras.optimizers.Adam(learning_rate=learning_rate)) - - # Train model and capture history - history = model.fit(train_dataset, epochs=epochs, batch_size=batch_size) - - # Save training history - history_df = pd.DataFrame(history.history) - history_path = os.path.join(output_dir, f"model_history_cb{codebook_num}_emb{general_embed_dim}.csv") - history_df.to_csv(history_path, index=False) - - # Evaluate model on test data - decoded_outputs, zq_outputs, pj_outputs = evaluate_model(model, test_dataset) - - # Save outputs - output_path = os.path.join(output_dir, f"output_data_cb{codebook_num}_emb{general_embed_dim}.npz") - np.savez(output_path, - decoded=np.vstack(decoded_outputs), - zq=np.vstack(zq_outputs), - pj=np.vstack(pj_outputs)) - - # Calculate metrics - mse = calculate_reconstruction_mse(X_test, np.vstack(decoded_outputs)) - - return model, history, mse - - -def evaluate_model(model, test_dataset): - """Evaluate the model on test data.""" - decoded_outputs = [] - zq_outputs = [] - pj_outputs = [] - - for batch in test_dataset: - output = model(batch) - decoded_outputs.append(output[0].numpy()) - zq_outputs.append(output[1].numpy()) - pj_outputs.append(output[2].numpy()) - - return decoded_outputs, zq_outputs, pj_outputs - - -def calculate_reconstruction_mse(X_test, decoded_output): - """Calculate mean squared error between input and reconstructed output.""" - # Reshape if necessary to match dimensions - if X_test.shape != decoded_output.shape: - # Adjust shapes as needed based on your model's output - pass - - return mean_squared_error(X_test.reshape(-1), decoded_output.reshape(-1)) - - -def plot_training_history(history_df, title="Training History", output_path=None): - """Plot training metrics from history dataframe.""" - plt.figure(figsize=(12, 6)) - - # Plot all metrics in the history - for column in history_df.columns: - plt.plot(history_df[column], label=column) - - plt.title(title) - plt.xlabel('Epoch') - plt.ylabel('Value') - plt.legend() - plt.grid(True) - - if output_path: - plt.savefig(output_path) - plt.close() - else: - plt.show() - - -def plot_reconstruction_comparison(original, reconstructed, n_samples=5, output_path=None): - """Plot comparison between original and reconstructed sequences.""" - # Randomly select n_samples sequences to visualize - indices = np.random.choice(len(original), size=min(n_samples, len(original)), replace=False) - - plt.figure(figsize=(15, 3 * n_samples)) - - for i, idx in enumerate(indices): - # Plot original sequence - plt.subplot(n_samples, 2, 2 * i + 1) - plt.plot(original[idx].flatten()) - plt.title(f"Original Sequence {idx}") - plt.grid(True) - - # Plot reconstructed sequence - plt.subplot(n_samples, 2, 2 * i + 2) - plt.plot(reconstructed[idx].flatten()) - plt.title(f"Reconstructed Sequence {idx}") - plt.grid(True) - - plt.tight_layout() - - if output_path: - plt.savefig(output_path) - plt.close() - else: - plt.show() - - -def parameter_search(X_train, X_test, feature_dim, batch_size=4, epochs=20, learning_rate=0.001, - codebook_nums=[3, 5, 7], embed_dims=[64, 128, 256], - codebook_dim=32, heads=8, output_dir="parameter_search"): - """ - Perform grid search over codebook_num and general_embed_dim parameters. - Returns the best parameters based on reconstruction MSE. - """ - os.makedirs(output_dir, exist_ok=True) - - results = [] - - # Create all combinations of parameters - param_combinations = list(itertools.product(codebook_nums, embed_dims)) - total_combinations = len(param_combinations) - - print(f"Starting parameter search with {total_combinations} combinations...") - - for i, (codebook_num, embed_dim) in enumerate(param_combinations): - print(f"Training combination {i + 1}/{total_combinations}: codebook_num={codebook_num}, embed_dim={embed_dim}") - - try: - # Train the model with this parameter combination - model, history, mse = train_scq_model( - X_train, X_test, feature_dim, - general_embed_dim=embed_dim, - codebook_dim=codebook_dim, - codebook_num=codebook_num, - batch_size=batch_size, - epochs=epochs, - learning_rate=learning_rate, - heads=heads, - output_dir=output_dir - ) - - # Store results - results.append({ - 'codebook_num': codebook_num, - 'general_embed_dim': embed_dim, - 'mse': mse, - 'history': history - }) - - # Plot training history - history_df = pd.DataFrame(history.history) - plot_training_history( - history_df, - title=f"Training History (codebook_num={codebook_num}, embed_dim={embed_dim})", - output_path=os.path.join(output_dir, f"history_plot_cb{codebook_num}_emb{embed_dim}.png") - ) - - except Exception as e: - print(f"Error training with codebook_num={codebook_num}, embed_dim={embed_dim}: {e}") - - # Create results dataframe - results_df = pd.DataFrame([(r['codebook_num'], r['general_embed_dim'], r['mse']) - for r in results], - columns=['codebook_num', 'general_embed_dim', 'mse']) - - # Save results - results_df.to_csv(os.path.join(output_dir, "parameter_search_results.csv"), index=False) - - # Find best parameters - best_idx = results_df['mse'].idxmin() - best_params = results_df.loc[best_idx] - - print(f"Parameter search complete. Best parameters:") - print(f" codebook_num: {best_params['codebook_num']}") - print(f" general_embed_dim: {best_params['general_embed_dim']}") - print(f" MSE: {best_params['mse']}") - - # Plot results heatmap - plot_parameter_search_results(results_df, output_dir) - - return best_params, results_df - - -def plot_parameter_search_results(results_df, output_dir): - """Plot heatmap of parameter search results.""" - # Create pivot table for heatmap - pivot_df = results_df.pivot(index='codebook_num', columns='general_embed_dim', values='mse') - - plt.figure(figsize=(10, 8)) - plt.imshow(pivot_df, cmap='viridis_r') # Reverse colormap so darker is better (lower MSE) - - # Set labels - plt.colorbar(label='MSE (lower is better)') - plt.title('Parameter Search Results') - plt.xlabel('General Embedding Dimension') - plt.ylabel('Codebook Number') - - # Set tick labels - plt.xticks(range(len(pivot_df.columns)), pivot_df.columns) - plt.yticks(range(len(pivot_df.index)), pivot_df.index) - - # Add text annotations - for i in range(len(pivot_df.index)): - for j in range(len(pivot_df.columns)): - value = pivot_df.iloc[i, j] - if not np.isnan(value): - plt.text(j, i, f'{value:.4f}', ha='center', va='center', - color='white' if value > pivot_df.values.mean() else 'black') - - plt.tight_layout() - plt.savefig(os.path.join(output_dir, "parameter_search_heatmap.png")) - plt.close() - - -def run_scq_pipeline(data_path, output_dir="test_tmp", run_param_search=True, - batch_size=4, epochs=20, learning_rate=0.001, - codebook_num=5, general_embed_dim=128, codebook_dim=32, heads=8): - """ - Main function to run the complete SCQ pipeline with optional parameter search. - """ - # Load and prepare data - X_train, X_test, seq_length, feature_dim = load_data(data_path) - - # Create output directory - os.makedirs(output_dir, exist_ok=True) - - # Save input data - np.save(os.path.join(output_dir, "input_data.npy"), X_test) - - if run_param_search: - # Run parameter search to find optimal values - best_params, results_df = parameter_search( - X_train, X_test, feature_dim, - batch_size=batch_size, - epochs=epochs, - learning_rate=learning_rate, - output_dir=os.path.join(output_dir, "param_search") - ) - - # Use best parameters for final model - ensure they are integers - codebook_num = int(best_params['codebook_num']) - general_embed_dim = int(best_params['general_embed_dim']) - - # Train final model with selected/best parameters - print(f"Training final model with codebook_num={codebook_num}, general_embed_dim={general_embed_dim}") - final_model, final_history, final_mse = train_scq_model( - X_train, X_test, feature_dim, - general_embed_dim=general_embed_dim, - codebook_dim=codebook_dim, - codebook_num=codebook_num, - batch_size=batch_size, - epochs=epochs, - learning_rate=learning_rate, - heads=heads, - output_dir=output_dir - ) - - # Evaluate the final model - test_dataset = create_dataset(X_test, batch_size=batch_size, is_training=False) - decoded_outputs, zq_outputs, pj_outputs = evaluate_model(final_model, test_dataset) - - # Create visualizations - history_df = pd.DataFrame(final_history.history) - plot_training_history( - history_df, - title=f"Final Model Training History (codebook_num={codebook_num}, embed_dim={general_embed_dim})", - output_path=os.path.join(output_dir, "final_model_history_plot.png") - ) - - plot_reconstruction_comparison( - X_test, - np.vstack(decoded_outputs), - n_samples=5, - output_path=os.path.join(output_dir, "reconstruction_comparison.png") - ) - - print(f"Pipeline completed successfully.") - print(f"Final model MSE: {final_mse}") - print(f"Final model parameters: codebook_num={codebook_num}, general_embed_dim={general_embed_dim}") - print(f"Results saved to {output_dir}") - - return final_model, final_mse, (codebook_num, general_embed_dim) - - -# Example usage: -if __name__ == "__main__": - # Example usage of the pipeline - data_path = "../data/Pep2Vec/wrapper_mhc1.parquet" - - # # Run full pipeline with parameter search - # model, mse, best_params = run_scq_pipeline( - # data_path=data_path, - # output_dir="scq_results", - # run_param_search=True, - # batch_size=4, - # epochs=20 - # ) - - # Alternatively, run with specific parameters (no search) - model, mse, params = run_scq_pipeline( - data_path=data_path, - output_dir="scq_results_fixed", - run_param_search=False, - codebook_num=7, - general_embed_dim=256 - ) \ No newline at end of file From d04667a405479cb46e8db12ecd312c94e0e86999 Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 17 Apr 2025 17:08:56 +0200 Subject: [PATCH 12/83] implemented the VQ1DUnet --- run_pMHC_DL.py | 263 ++++++++++++++++++++++++++++++++++++++++++++- utils/model.py | 281 ++++++++++++++++++++++++++++++++++++++++++++++++- 2 files changed, 540 insertions(+), 4 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index 463e76160..5b9ff443f 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -542,9 +542,9 @@ def simple_run(batch_size=1): # traceback.print_exc() # simple run simple_run()''' +from sklearn.model_selection import train_test_split - -import os +'''import os import numpy as np import pandas as pd import tensorflow as tf @@ -562,6 +562,7 @@ def create_dataset(X, batch_size=4, is_training=True): if is_training: dataset = dataset.shuffle(buffer_size=len(X)) dataset = dataset.batch(batch_size) + dataset = dataset.prefetch(tf.data.AUTOTUNE) return dataset @@ -909,4 +910,260 @@ def run_scq_pipeline(data_path, output_dir="test_tmp", run_param_search=True, batch_size=1, general_embed_dim=256, epochs=20 - ) \ No newline at end of file + )''' + +# example of running VQUnet +from utils.model import VQ1DUnet + +# TODO implement a simple training pipeline for VQUnet +import tensorflow as tf +import numpy as np +import time # To time training +import pandas as pd + +# Assume VectorQuantizer and VQUnet classes are defined above this code +# Or import them: +# from your_module import VectorQuantizer, VQUnet + +# --- Configuration --- +INPUT_SHAPE = (64, 64, 1) # IMPORTANT: Adjust to your MHC1 data's shape (height, width, channels) +NUM_EMBEDDINGS = 128 # Number of clusters/codes in the codebook +EMBEDDING_DIM = 32 # Dimension of each codebook vector (latent dim in bottleneck) +BATCH_SIZE = 32 +EPOCHS = 10 # Number of training epochs +LEARNING_RATE = 1e-4 +NUM_TRAIN_SAMPLES = 1000 # Replace with actual number +NUM_VAL_SAMPLES = 200 # Replace with actual number (optional) + +# --- Data Loading and Preparation --- +# TODO: Replace this section with your actual MHC1 data loading +# def load_mhc1_placeholder_data(num_samples, shape): +# """Generates random placeholder data.""" +# print(f"Generating {num_samples} placeholder samples with shape {shape}...") +# # Generate random data (e.g., pixel values between 0 and 1) +# data = np.random.rand(num_samples, *shape).astype(np.float32) +# print("Placeholder data generated.") +# return data + +def create_dataset(X, batch_size=4, is_training=True): + """Create a TensorFlow dataset from input array X.""" + dataset = tf.data.Dataset.from_tensor_slices(X) + if is_training: + dataset = dataset.shuffle(buffer_size=len(X)) + dataset = dataset.batch(batch_size) + dataset = dataset.prefetch(tf.data.AUTOTUNE) + return dataset + + +def load_data(data_path, test_size=0.2, random_state=42): + """Load and prepare data for training.""" + # Load data + embeddings = pd.read_parquet(data_path) + + # Select the latent columns + latent_columns = [col for col in embeddings.columns if 'latent' in col] + print(f"Found {len(latent_columns)} latent columns") + + # Extract values and reshape + X = embeddings[latent_columns].values + seq_length = len(latent_columns) + feature_dim = 1 + X = X.reshape(-1, seq_length, feature_dim) + + # Split into train and test sets + X_train, X_test = train_test_split(X, test_size=test_size, random_state=random_state) + + return X_train, X_test, seq_length, feature_dim + +data_path = "data/Pep2Vec/wrapper_mhc1.parquet" +# Load or generate data +print("Loading/Generating Training Data...") +train_data, test_data, seq_length, feature_dim = load_data(data_path, test_size=0.2, random_state=42) # Load training data + +# Create tf.data Datasets for efficient training +# For reconstruction, input and target are the same (x, x) +print("Creating TensorFlow Datasets...") +train_dataset = create_dataset(train_data, batch_size=BATCH_SIZE, is_training=True) +val_dataset = create_dataset(test_data, batch_size=BATCH_SIZE, is_training=False) +print("Datasets created.") + + + +# --- Model Instantiation --- +print("Building the VQ-UNet model...") +input_shape = (seq_length, feature_dim) + +model = VQ1DUnet( + input_dim=input_shape, + num_embeddings=NUM_EMBEDDINGS, + embedding_dim=EMBEDDING_DIM, + commitment_beta=0.25, +) +model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=LEARNING_RATE)) +history = model.fit(train_dataset, epochs=EPOCHS, validation_data=val_dataset) + +print("Model built.") + +# --- Compile the Model --- +# The loss calculation is handled within the train_step, +# but we still need to provide an optimizer. +print("Compiling the model...") +model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=LEARNING_RATE)) +print("Model compiled.") + +# --- Training --- +print(f"Starting training for {EPOCHS} epochs...") +start_time = time.time() + +history = model.fit( + train_dataset, + epochs=EPOCHS, + validation_data=val_dataset # Pass validation data here +) + +end_time = time.time() +print(f"\nTraining finished in {end_time - start_time:.2f} seconds.") + +# --- (Optional) Post-Training --- +print("\nTraining History:") +print(history.history) + +# Example: Get reconstruction and latent codes for a batch from validation set +print("\nExample inference on validation data:") +example_batch = next(iter(val_dataset)) # Get one batch +output = model.predict(example_batch) +if isinstance(output, (list, tuple)) and len(output) == 3: + reconstruction, quantized_latent, cluster_indices = output +else: + reconstruction = output + +# Visualize or save the reconstruction +# TODO: Implement visualization or saving of the reconstruction +end_time = time.time() +print(f"\nTraining finished in {end_time - start_time:.2f} seconds.") + +# --- Visualize Training Metrics --- +import matplotlib.pyplot as plt + + +def plot_training_metrics(history): + """Plot the training metrics over epochs.""" + fig, axes = plt.subplots(3, 1, figsize=(12, 15), sharex=True) + + # Plot total loss + axes[0].plot(history.history['total_loss'], 'b-', label='Train') + if 'val_total_loss' in history.history: + axes[0].plot(history.history['val_total_loss'], 'r-', label='Validation') + axes[0].set_title('Total Loss') + axes[0].set_ylabel('Loss') + axes[0].grid(True) + axes[0].legend() + + # Plot reconstruction loss + axes[1].plot(history.history['recon_loss'], 'b-', label='Train') + if 'val_recon_loss' in history.history: + axes[1].plot(history.history['val_recon_loss'], 'r-', label='Validation') + axes[1].set_title('Reconstruction Loss') + axes[1].set_ylabel('Loss') + axes[1].grid(True) + axes[1].legend() + + # Plot VQ loss + axes[2].plot(history.history['vq_loss'], 'b-', label='Train') + if 'val_vq_loss' in history.history: + axes[2].plot(history.history['val_vq_loss'], 'r-', label='Validation') + axes[2].set_title('VQ Loss') + axes[2].set_xlabel('Epochs') + axes[2].set_ylabel('Loss') + axes[2].grid(True) + axes[2].legend() + + plt.tight_layout() + plt.savefig('vqvae_training_metrics.png') + plt.show() + + +# Plot the training metrics +print("\nPlotting training history...") +plot_training_metrics(history) + +# --- Example Inference and Visualization --- +print("\nPerforming example inference on validation data...") +example_batch = next(iter(val_dataset)) # Get one batch +output = model(example_batch, training=False) + +# Unpack the output +reconstruction, quantized_latent, cluster_indices, _ = output + + +# Visualize reconstructions +def plot_reconstructions(original, reconstructed, n_samples=5): + """Plot comparison between original and reconstructed sequences.""" + n_samples = min(n_samples, len(original)) + plt.figure(figsize=(15, 3 * n_samples)) + + for i in range(n_samples): + # Plot original sequence + plt.subplot(n_samples, 2, 2 * i + 1) + plt.plot(original[i, :, 0]) # Assuming last dim is feature dim with size 1 + plt.title(f"Original Sequence {i + 1}") + plt.grid(True) + + # Plot reconstructed sequence + plt.subplot(n_samples, 2, 2 * i + 2) + plt.plot(reconstructed[i, :, 0]) # Assuming same shape as original + plt.title(f"Reconstructed Sequence {i + 1}") + plt.grid(True) + + plt.tight_layout() + plt.savefig('vqvae_reconstructions.png') + plt.show() + + +print("\nVisualizing reconstructions...") +plot_reconstructions(example_batch.numpy(), reconstruction.numpy()) + + +# Visualize codebook usage distribution +def plot_codebook_usage(indices, num_embeddings): + """Visualize the usage distribution of codebook vectors.""" + # Flatten all indices + flat_indices = tf.reshape(indices, [-1]).numpy() + + # Count occurrences of each index + unique_indices, counts = np.unique(flat_indices, return_counts=True) + + # Create a histogram for all possible indices (including unused ones) + full_histogram = np.zeros(num_embeddings) + for idx, count in zip(unique_indices, counts): + full_histogram[idx] = count + + # Plot the histogram + plt.figure(figsize=(12, 6)) + plt.bar(range(num_embeddings), full_histogram) + plt.xlabel('Codebook Index') + plt.ylabel('Usage Count') + plt.title('Codebook Vector Usage Distribution') + plt.grid(True, axis='y') + + # Calculate and display codebook utilization + utilization = len(unique_indices) / num_embeddings * 100 + plt.text(0.5, 0.9, f'Codebook Utilization: {utilization:.1f}% ({len(unique_indices)}/{num_embeddings})', + transform=plt.gca().transAxes, ha='center', fontsize=12, + bbox=dict(facecolor='white', alpha=0.8)) + + plt.tight_layout() + plt.savefig('vqvae_codebook_usage.png') + plt.show() + + +print("\nAnalyzing codebook usage...") +plot_codebook_usage(cluster_indices, NUM_EMBEDDINGS) + +# Save the model +model.save_weights('vqvae_model_weights.h5') +print("\nModel weights saved to 'vqvae_model_weights.h5'") + +# You can now save the model weights if needed +# model.save_weights('vq_unet_mhc1_weights.h5') +# print("Model weights saved.") \ No newline at end of file diff --git a/utils/model.py b/utils/model.py index bfca1051e..c8593e22a 100644 --- a/utils/model.py +++ b/utils/model.py @@ -491,6 +491,49 @@ def compute_losses(self, x, decoded, vq_loss, out_P_proj): } +class UNet(tf.keras.models.Model): + def __init__(self, input_dim=1024, base_filters=64): + super().__init__() + self.input_dim = input_dim + + # Encoder layers + self.enc1 = layers.Dense(base_filters, activation='relu') + self.enc2 = layers.Dense(base_filters * 2, activation='relu') + self.enc3 = layers.Dense(base_filters * 4, activation='relu') + self.enc4 = layers.Dense(base_filters * 8, activation='relu') + + # Bottleneck + self.bottleneck = layers.Dense(base_filters * 16, activation='relu') + + # Decoder layers + self.dec4 = layers.Dense(base_filters * 8, activation='relu') + self.dec3 = layers.Dense(base_filters * 4, activation='relu') + self.dec2 = layers.Dense(base_filters * 2, activation='relu') + self.dec1 = layers.Dense(base_filters, activation='relu') + + # Output layer + self.output_layer = layers.Dense(input_dim, activation='sigmoid') + + def call(self, x): + # Encoder path + e1 = self.enc1(x) + e2 = self.enc2(e1) + e3 = self.enc3(e2) + e4 = self.enc4(e3) + + # Bottleneck + b = self.bottleneck(e4) + + # Decoder path with skip connections + d4 = self.dec4(b) + e4 + d3 = self.dec3(d4) + e3 + d2 = self.dec2(d3) + e2 + d1 = self.dec1(d2) + e1 + + # Output + return self.output_layer(d1) + + '''import tensorflow as tf import tensorflow as tf @@ -529,7 +572,7 @@ def random_one_hot_sequence(batch, seq_len, num_classes=21, class_probs=None): # Apply one-hot encoding one_hot_encoded = tf.one_hot(random_indices, depth=num_classes) - return one_hot_encoded''' + return one_hot_encoded def create_dataset(X, batch_size=1, is_training=True): @@ -645,5 +688,241 @@ def create_dataset(X, batch_size=1, is_training=True): # print("Training complete. Model history saved as 'model_history.csv'.") # print("Input and output arrays saved as 'input_data.npy' and 'output_data.npz'.") # print("Shape of model outputs:", np.vstack(pj_outputs).shape) +''' + +import tensorflow as tf +from tensorflow import keras +from tensorflow.keras import layers + +class VQ_Layer(tf.keras.layers.Layer): + def __init__(self, embedding_dim, num_embeddings, beta, **kwargs): + super().__init__(**kwargs) + self.embedding_dim = embedding_dim + self.num_embeddings = num_embeddings + self.beta = beta + + w_init = tf.random_uniform_initializer() + self.embeddings = tf.Variable( + initial_value=w_init(shape=(self.num_embeddings, self.embedding_dim), dtype="float32"), + trainable=True, + name="embeddings_vq" + ) + + def call(self, inputs): + input_shape = tf.shape(inputs) + flat_inputs = tf.reshape(inputs, [-1, self.embedding_dim]) # (B*T, emb_dim) + + # Compute squared L2 distances + a_sq = tf.reduce_sum(flat_inputs ** 2, axis=1, keepdims=True) # (B*T, 1) + ab = 2 * tf.matmul(flat_inputs, tf.transpose(self.embeddings)) # (B*T, num_embeddings) + b_sq = tf.reduce_sum(self.embeddings ** 2, axis=1) # (num_embeddings,) + b_sq = tf.reshape(b_sq, [1, -1]) # (1, num_embeddings) + + distances = a_sq - ab + b_sq # (B*T, num_embeddings) + + # Find closest embeddings and proceed as before + encoding_indices = tf.argmin(distances, axis=1) + encodings = tf.one_hot(encoding_indices, self.num_embeddings) + quantized = tf.matmul(encodings, self.embeddings) + quantized = tf.reshape(quantized, input_shape) + + # Optionally compute perplexity + avg_probs = tf.reduce_mean(encodings, axis=0) + perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) + + indices_reshaped = tf.reshape(encoding_indices, input_shape[:-1]) + return quantized, indices_reshaped, perplexity + + def get_config(self): + config = super().get_config() + config.update({ + "embedding_dim": self.embedding_dim, + "num_embeddings": self.num_embeddings, + "beta": self.beta + }) + return config + + +# Helper function for convolutional blocks +def conv_block(filters, kernel_size=3, activation='relu', padding='same', batch_norm=True, input_shape=None, name=None): + layers_list = [] + conv_kwargs = dict( + filters=filters, + kernel_size=kernel_size, + padding=padding, + kernel_initializer='he_normal' + ) + if input_shape: + conv_kwargs['input_shape'] = input_shape + layers_list.append(layers.Conv1D(**conv_kwargs)) + + if batch_norm: + layers_list.append(layers.BatchNormalization()) + layers_list.append(layers.Activation(activation)) + + # 2nd Conv Layer + layers_list.append(layers.Conv1D( + filters=filters, + kernel_size=kernel_size, + padding=padding, + kernel_initializer='he_normal' + )) + if batch_norm: + layers_list.append(layers.BatchNormalization()) + layers_list.append(layers.Activation(activation)) + + return keras.Sequential(layers_list, name=name) + +def upconv_block(filters, kernel_size=3, activation='relu', padding='same', batch_norm=True, name_prefix=None): + transpose_conv_name = f"{name_prefix}_transpose" if name_prefix else None + conv_block_name = f"{name_prefix}_conv" if name_prefix else None + + upconv = layers.Conv1DTranspose( + filters=filters, + kernel_size=2, + strides=2, + padding=padding, + name=transpose_conv_name + ) + conv = conv_block( + filters=filters, + kernel_size=kernel_size, + activation=activation, + padding=padding, + batch_norm=batch_norm, + name=conv_block_name + ) + return upconv, conv + + +class VQ1DUnet(keras.Model): + def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, **kwargs): + super().__init__(**kwargs) + self.input_channels = input_dim[-1] + self.seq_length = input_dim[0] + self.embedding_dim = embedding_dim + self.num_embeddings = num_embeddings + self.commitment_beta = commitment_beta + + # Encoder + self.enc1 = conv_block(64, name='enc1') + self.pool1 = layers.MaxPooling1D(2, name='pool1') + self.enc2 = conv_block(128, name='enc2') + self.pool2 = layers.MaxPooling1D(2, name='pool2') + self.enc3 = conv_block(256, name='enc3') + self.pool3 = layers.MaxPooling1D(2, name='pool3') + self.enc4 = conv_block(512, name='enc4') + self.pool4 = layers.MaxPooling1D(2, name='pool4') + + self.bottleneck = conv_block(self.embedding_dim, kernel_size=1, activation='linear', name='bottleneck') + + # VQ Layer + self.vq_layer = VQ_Layer(self.embedding_dim, self.num_embeddings, self.commitment_beta, name="vq_layer") + + # Decoder + self.up4_trans, self.dec4_conv = upconv_block(512, name_prefix='dec4') + self.up3_trans, self.dec3_conv = upconv_block(256, name_prefix='dec3') + self.up2_trans, self.dec2_conv = upconv_block(128, name_prefix='dec2') + self.up1_trans, self.dec1_conv = upconv_block(64, name_prefix='dec1') + + self.output_layer = layers.Conv1D(self.input_channels, 1, activation='linear', padding='same', name='output') + + # Loss trackers + self.total_loss_tracker = keras.metrics.Mean(name="total_loss") + self.recon_loss_tracker = keras.metrics.Mean(name="recon_loss") + self.vq_loss_tracker = keras.metrics.Mean(name="vq_loss") + + def call(self, inputs, training=False): + # --- Encoding --- + x1 = self.enc1(inputs) + x2 = self.enc2(self.pool1(x1)) + x3 = self.enc3(self.pool2(x2)) + x4 = self.enc4(self.pool3(x3)) + x_bottleneck = self.bottleneck(self.pool4(x4)) + + # --- Vector Quantization --- + quantized, indices, perplexity = self.vq_layer(x_bottleneck) + + # --- Decoding --- + y = self.up4_trans(quantized) + y = tf.concat([y, x4], axis=-1) + y = self.dec4_conv(y) + + y = self.up3_trans(y) + y = tf.concat([y, x3], axis=-1) + y = self.dec3_conv(y) + + y = self.up2_trans(y) + y = tf.concat([y, x2], axis=-1) + y = self.dec2_conv(y) + + y = self.up1_trans(y) + y = tf.concat([y, x1], axis=-1) + y = self.dec1_conv(y) + + output = self.output_layer(y) + vq_loss = tf.add_n(self.vq_layer.losses) if self.vq_layer.losses else tf.constant(0.0) + + return output, quantized, indices, vq_loss + + @property + def metrics(self): + return [self.total_loss_tracker, self.recon_loss_tracker, self.vq_loss_tracker] + + def train_step(self, data): + if isinstance(data, tuple): + x = data[0] + y = data[1] if len(data) > 1 else data[0] + else: + x = y = data + + with tf.GradientTape() as tape: + reconstruction, _, _, vq_loss = self(x, training=True) + recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) + total_loss = recon_loss + vq_loss + + grads = tape.gradient(total_loss, self.trainable_variables) + self.optimizer.apply_gradients(zip(grads, self.trainable_variables)) + self.total_loss_tracker.update_state(total_loss) + self.recon_loss_tracker.update_state(recon_loss) + self.vq_loss_tracker.update_state(vq_loss) + + return {m.name: m.result() for m in self.metrics} + + def test_step(self, data): + if isinstance(data, tuple): + x = data[0] + y = data[1] if len(data) > 1 else data[0] + else: + x = y = data + + reconstruction, _, _, vq_loss = self(x, training=False) + recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) + total_loss = recon_loss + vq_loss + + self.total_loss_tracker.update_state(total_loss) + self.recon_loss_tracker.update_state(recon_loss) + self.vq_loss_tracker.update_state(vq_loss) + + return {m.name: m.result() for m in self.metrics} + + +# Example Usage: +# Assuming input images are 128x128 pixels with 3 channels +# input_shape = (128, 128, 3) +# num_clusters = 512 # Number of desired clusters (codebook size) +# latent_dim = 64 # Dimension of each vector in the codebook and bottleneck + +# model = VQUnet(input_shape=input_shape, num_embeddings=num_clusters, embedding_dim=latent_dim) +# model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=1e-4)) + +# # Prepare your dataset (e.g., tf.data.Dataset) +# # train_dataset = ... +# # test_dataset = ... +# # Train the model +# # model.fit(train_dataset, epochs=10, validation_data=test_dataset) +# # After training, you can get outputs: +# # test_images, _ = next(iter(test_dataset.batch(4))) +# # reconstruction, quantized_latent, cluster_map = model.predict(test_images) \ No newline at end of file From 7c66491f91ee927b5b40188c579e98f564934b06 Mon Sep 17 00:00:00 2001 From: amirreza Date: Mon, 21 Apr 2025 12:24:04 +0200 Subject: [PATCH 13/83] refactor model and run script: adjust embedding parameters and enhance training configuration --- run_pMHC_DL.py | 14 ++++++-------- utils/model.py | 10 +++++----- 2 files changed, 11 insertions(+), 13 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index 5b9ff443f..848149578 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -926,14 +926,12 @@ def run_scq_pipeline(data_path, output_dir="test_tmp", run_param_search=True, # from your_module import VectorQuantizer, VQUnet # --- Configuration --- -INPUT_SHAPE = (64, 64, 1) # IMPORTANT: Adjust to your MHC1 data's shape (height, width, channels) -NUM_EMBEDDINGS = 128 # Number of clusters/codes in the codebook -EMBEDDING_DIM = 32 # Dimension of each codebook vector (latent dim in bottleneck) -BATCH_SIZE = 32 -EPOCHS = 10 # Number of training epochs -LEARNING_RATE = 1e-4 -NUM_TRAIN_SAMPLES = 1000 # Replace with actual number -NUM_VAL_SAMPLES = 200 # Replace with actual number (optional) +# INPUT_SHAPE = (64, 64, 1) # IMPORTANT: Adjust to your MHC1 data's shape (height, width, channels) +NUM_EMBEDDINGS = 64 # Number of clusters/codes in the codebook +EMBEDDING_DIM = 16 # Dimension of each codebook vector (latent dim in bottleneck) +BATCH_SIZE = 8 +EPOCHS = 1000 # Number of training epochs +LEARNING_RATE = 1e-5 # --- Data Loading and Preparation --- # TODO: Replace this section with your actual MHC1 data loading diff --git a/utils/model.py b/utils/model.py index c8593e22a..ad35c6224 100644 --- a/utils/model.py +++ b/utils/model.py @@ -845,19 +845,19 @@ def call(self, inputs, training=False): # --- Decoding --- y = self.up4_trans(quantized) - y = tf.concat([y, x4], axis=-1) + # y = tf.concat([y, x4], axis=-1) y = self.dec4_conv(y) y = self.up3_trans(y) - y = tf.concat([y, x3], axis=-1) + # y = tf.concat([y, x3], axis=-1) y = self.dec3_conv(y) y = self.up2_trans(y) - y = tf.concat([y, x2], axis=-1) + # y = tf.concat([y, x2], axis=-1) y = self.dec2_conv(y) y = self.up1_trans(y) - y = tf.concat([y, x1], axis=-1) + # y = tf.concat([y, x1], axis=-1) y = self.dec1_conv(y) output = self.output_layer(y) @@ -879,7 +879,7 @@ def train_step(self, data): with tf.GradientTape() as tape: reconstruction, _, _, vq_loss = self(x, training=True) recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) - total_loss = recon_loss + vq_loss + total_loss = recon_loss + vq_loss + self.commitment_beta * tf.reduce_mean(tf.math.squared_difference(x, reconstruction)) grads = tape.gradient(total_loss, self.trainable_variables) self.optimizer.apply_gradients(zip(grads, self.trainable_variables)) From 1c69c79840a9b25113cc5ccff6514bb590688e14 Mon Sep 17 00:00:00 2001 From: amirreza Date: Mon, 21 Apr 2025 12:43:00 +0200 Subject: [PATCH 14/83] VQ loss fixed --- run_netmhcpan_script.py | 73 ++++++++++++++++++++++++++--------------- utils/model.py | 16 ++++++++- 2 files changed, 61 insertions(+), 28 deletions(-) diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py index 32ad4321d..a12041d98 100644 --- a/run_netmhcpan_script.py +++ b/run_netmhcpan_script.py @@ -226,14 +226,35 @@ def process_data(mhc_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", return el_data_0, el_data_1, ba_data -def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number, mhc_class): +def safe_remove(path, is_dir=False): + try: + if is_dir: + shutil.rmtree(path) + else: + os.remove(path) + print(f"Successfully removed: {path}") + except PermissionError: + print(f"Permission denied: {path}") + except FileNotFoundError: + print(f"File/Directory not found: {path}") + except OSError as e: + print(f"Error removing {path}: {str(e)}") + except Exception as e: + print(f"Unexpected error with {path}: {str(e)}") + + +def run_netmhcpan_(el_data, true_label, tmp_path, results_dir, chunk_number, mhc_class): # chunk_dataframe = pd.DataFrame(columns=["MHC", "Peptide", "Of", "Core", "Core_Rel", "Inverted", "Identity", "Score_EL", "%Rank_EL", "Exp_Bind", "Score_BA", "%Rank_BA", "Affinity(nM)", "long_mer", "cell_line_id"]) chunk_df_path = os.path.join(results_dir, f"el{true_label}_chunk_{chunk_number}.csv") - dropped_rows = pd.DataFrame() dropped_rows_path = os.path.join(results_dir, f"el{true_label}_dropped_rows_{chunk_number}.csv") for idx, cell_row in tqdm(el_data.iterrows(), total=el_data.shape[0], desc=f"Processing chunk {chunk_number}"): + dropped_rows = pd.DataFrame( + columns=["MHC", "Peptide", "Of", "Core", "Core_Rel", "Inverted", "Identity", "Score_EL", "%Rank_EL", + "Exp_Bind", "Score_BA", "%Rank_BA", "Affinity(nM)", "long_mer", "cell_line_id"]) number_of_alleles = len(eval(cell_row["allele"])) - result_data = pd.DataFrame(columns=["MHC", "Peptide", "Of", "Core", "Core_Rel", "Inverted", "Identity", "Score_EL", "%Rank_EL", "Exp_Bind", "Score_BA", "%Rank_BA", "Affinity(nM)", "long_mer", "cell_line_id"]) + result_data = pd.DataFrame( + columns=["MHC", "Peptide", "Of", "Core", "Core_Rel", "Inverted", "Identity", "Score_EL", "%Rank_EL", + "Exp_Bind", "Score_BA", "%Rank_BA", "Affinity(nM)", "long_mer", "cell_line_id"]) peptide = cell_row["peptide"] for allele in eval(cell_row["allele"]): # get the unique id for peptide @@ -277,43 +298,41 @@ def run_netmhcpan_(el_data, true_label ,tmp_path, results_dir, chunk_number, mh except Exception as e: print(f"Error processing peptide {peptide} with allele {allele}: {str(e)}") # Clean up temporary files - if os.path.exists(peptide_fasta_path): - os.remove(peptide_fasta_path) + safe_remove(peptide_fasta_path) - # Get the actual directory path + # Clean up peptide_fasta directory peptide_fasta_dir = os.path.dirname(peptide_fasta_path) - try: - shutil.rmtree(peptide_fasta_dir) - except PermissionError: - print(f"Warning: Could not remove directory {peptide_fasta_dir} due to permission error") + if peptide_fasta_dir: # Prevent removing root/current directory + safe_remove(peptide_fasta_dir, is_dir=True) - try: - shutil.rmtree(output_dir) - except PermissionError: - print(f"Warning: Could not remove directory {output_dir} due to permission error") + # Clean up output directory + safe_remove(output_dir, is_dir=True) # save the results to disk if not result_data.empty: # assert len(result_data) == number_of_alleles if len(result_data) != number_of_alleles: print(f"Warning: Expected {number_of_alleles} results but got {len(result_data)}") - result_data['assigned_label'] = result_data['Score_BA'].apply(lambda x: 1 if eval(x) > 0.426 else 0) + result_data['assigned_label'] = result_data['Score_BA'].apply(lambda x: 1 if eval(x) >= 0.426 else 0) if true_label == 1: - # if at least one label is not 1, select the highest score_BA and set the labels to 1, then save the allele in a list - # Create a mask for cell lines with at least one positive label - positive_cell_lines = result_data.groupby('cell_line_id')['assigned_label'].max() == 1 - positive_cell_lines = positive_cell_lines[positive_cell_lines].index.tolist() - # Filter rows - mask = result_data['cell_line_id'].isin(positive_cell_lines) - dropped_df = result_data[~mask].copy() - result_data = result_data[mask].copy() - # Save dropped rows to separate file if there are any - if not dropped_df.empty: - dropped_rows = pd.concat([dropped_rows, dropped_df]) + # Identify cell lines with at least one positive label + positive_cell_lines = result_data.groupby('cell_line_id')['assigned_label'].transform('max') == 1 + + # Separate dropped and kept rows without creating full copies + mask = result_data['cell_line_id'].isin( + result_data.loc[positive_cell_lines, 'cell_line_id'].unique() + ) + dropped_rows = pd.concat([dropped_rows, result_data[~mask]]) + result_data = result_data[mask] + + if true_label == 0: + # Directly concat and filter rows with label == 1 + dropped_rows = pd.concat([dropped_rows, result_data[result_data['assigned_label'] == 1]]) + result_data = result_data[result_data['assigned_label'] == 0] # save the results to the chunk_dataframe directly to the disk using append method result_data.to_csv(chunk_df_path, mode="a", header=not os.path.exists(chunk_df_path), index=False) - dropped_rows.to_csv(dropped_rows_path, index=False) + dropped_rows.to_csv(dropped_rows_path, mode="a", header=not os.path.exists(dropped_rows_path), index=False) diff --git a/utils/model.py b/utils/model.py index ad35c6224..08837024d 100644 --- a/utils/model.py +++ b/utils/model.py @@ -720,12 +720,25 @@ def call(self, inputs): distances = a_sq - ab + b_sq # (B*T, num_embeddings) - # Find closest embeddings and proceed as before + # Find closest embeddings encoding_indices = tf.argmin(distances, axis=1) encodings = tf.one_hot(encoding_indices, self.num_embeddings) quantized = tf.matmul(encodings, self.embeddings) + + # Reshape quantized values to match input shape quantized = tf.reshape(quantized, input_shape) + # Calculate VQ losses - straight-through estimator + commitment_loss = tf.reduce_mean(tf.square(tf.stop_gradient(quantized) - inputs)) + codebook_loss = tf.reduce_mean(tf.square(quantized - tf.stop_gradient(inputs))) + vq_loss = commitment_loss + self.beta * codebook_loss + + # Add loss to layer's loss collection + self.add_loss(vq_loss) + + # Straight-through estimator (copy gradients from quantized to inputs) + quantized = inputs + tf.stop_gradient(quantized - inputs) + # Optionally compute perplexity avg_probs = tf.reduce_mean(encodings, axis=0) perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) @@ -880,6 +893,7 @@ def train_step(self, data): reconstruction, _, _, vq_loss = self(x, training=True) recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) total_loss = recon_loss + vq_loss + self.commitment_beta * tf.reduce_mean(tf.math.squared_difference(x, reconstruction)) + vq_loss = tf.add_n(self.vq_layer.losses) if self.vq_layer.losses else tf.constant(0.0) grads = tape.gradient(total_loss, self.trainable_variables) self.optimizer.apply_gradients(zip(grads, self.trainable_variables)) From 38b7256d6789f332f59d75322936d202783187df Mon Sep 17 00:00:00 2001 From: amirreza Date: Mon, 21 Apr 2025 17:35:55 +0200 Subject: [PATCH 15/83] Best effort for SQC - refactor model and run script: update to SCQ1DAutoEncoder, enhance training metrics and codebook usage tracking --- run_pMHC_DL.py | 232 +++++++++++++++++--------- utils/model.py | 434 ++++++++++++++++++++++++++++++++++++++++++++++--- 2 files changed, 563 insertions(+), 103 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index 848149578..ed47acd8c 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -913,7 +913,7 @@ def run_scq_pipeline(data_path, output_dir="test_tmp", run_param_search=True, )''' # example of running VQUnet -from utils.model import VQ1DUnet +from utils.model import SCQ1DAutoEncoder # TODO implement a simple training pipeline for VQUnet import tensorflow as tf @@ -921,20 +921,16 @@ def run_scq_pipeline(data_path, output_dir="test_tmp", run_param_search=True, import time # To time training import pandas as pd -# Assume VectorQuantizer and VQUnet classes are defined above this code -# Or import them: -# from your_module import VectorQuantizer, VQUnet # --- Configuration --- # INPUT_SHAPE = (64, 64, 1) # IMPORTANT: Adjust to your MHC1 data's shape (height, width, channels) -NUM_EMBEDDINGS = 64 # Number of clusters/codes in the codebook -EMBEDDING_DIM = 16 # Dimension of each codebook vector (latent dim in bottleneck) -BATCH_SIZE = 8 -EPOCHS = 1000 # Number of training epochs -LEARNING_RATE = 1e-5 +NUM_EMBEDDINGS = 16 # Number of clusters/codes in the codebook +EMBEDDING_DIM = 64 # Dimension of each codebook vector (latent dim in bottleneck) +BATCH_SIZE = 4 +EPOCHS = 10 # Number of training epochs +LEARNING_RATE = 1e-3 # --- Data Loading and Preparation --- -# TODO: Replace this section with your actual MHC1 data loading # def load_mhc1_placeholder_data(num_samples, shape): # """Generates random placeholder data.""" # print(f"Generating {num_samples} placeholder samples with shape {shape}...") @@ -972,7 +968,7 @@ def load_data(data_path, test_size=0.2, random_state=42): X_train, X_test = train_test_split(X, test_size=test_size, random_state=random_state) return X_train, X_test, seq_length, feature_dim - + data_path = "data/Pep2Vec/wrapper_mhc1.parquet" # Load or generate data print("Loading/Generating Training Data...") @@ -986,12 +982,11 @@ def load_data(data_path, test_size=0.2, random_state=42): print("Datasets created.") - # --- Model Instantiation --- -print("Building the VQ-UNet model...") +print("Building the SCQ1DAutoEncoder model...") input_shape = (seq_length, feature_dim) -model = VQ1DUnet( +model = SCQ1DAutoEncoder( input_dim=input_shape, num_embeddings=NUM_EMBEDDINGS, embedding_dim=EMBEDDING_DIM, @@ -1036,7 +1031,6 @@ def load_data(data_path, test_size=0.2, random_state=42): reconstruction = output # Visualize or save the reconstruction -# TODO: Implement visualization or saving of the reconstruction end_time = time.time() print(f"\nTraining finished in {end_time - start_time:.2f} seconds.") @@ -1045,40 +1039,49 @@ def load_data(data_path, test_size=0.2, random_state=42): def plot_training_metrics(history): - """Plot the training metrics over epochs.""" - fig, axes = plt.subplots(3, 1, figsize=(12, 15), sharex=True) - - # Plot total loss - axes[0].plot(history.history['total_loss'], 'b-', label='Train') - if 'val_total_loss' in history.history: - axes[0].plot(history.history['val_total_loss'], 'r-', label='Validation') - axes[0].set_title('Total Loss') - axes[0].set_ylabel('Loss') - axes[0].grid(True) - axes[0].legend() - - # Plot reconstruction loss - axes[1].plot(history.history['recon_loss'], 'b-', label='Train') - if 'val_recon_loss' in history.history: - axes[1].plot(history.history['val_recon_loss'], 'r-', label='Validation') - axes[1].set_title('Reconstruction Loss') - axes[1].set_ylabel('Loss') - axes[1].grid(True) - axes[1].legend() - - # Plot VQ loss - axes[2].plot(history.history['vq_loss'], 'b-', label='Train') - if 'val_vq_loss' in history.history: - axes[2].plot(history.history['val_vq_loss'], 'r-', label='Validation') - axes[2].set_title('VQ Loss') - axes[2].set_xlabel('Epochs') - axes[2].set_ylabel('Loss') - axes[2].grid(True) - axes[2].legend() - - plt.tight_layout() - plt.savefig('vqvae_training_metrics.png') - plt.show() + """Plot the training metrics over epochs.""" + fig, axes = plt.subplots(4, 1, figsize=(12, 20), sharex=True) + + # Plot total loss + axes[0].plot(history.history['total_loss'], 'b-', label='Train') + if 'val_total_loss' in history.history: + axes[0].plot(history.history['val_total_loss'], 'r-', label='Validation') + axes[0].set_title('Total Loss') + axes[0].set_ylabel('Loss') + axes[0].grid(True) + axes[0].legend() + + # Plot reconstruction loss + axes[1].plot(history.history['recon_loss'], 'b-', label='Train') + if 'val_recon_loss' in history.history: + axes[1].plot(history.history['val_recon_loss'], 'r-', label='Validation') + axes[1].set_title('Reconstruction Loss') + axes[1].set_ylabel('Loss') + axes[1].grid(True) + axes[1].legend() + + # Plot VQ loss + axes[2].plot(history.history['vq_loss'], 'b-', label='Train') + if 'val_vq_loss' in history.history: + axes[2].plot(history.history['val_vq_loss'], 'r-', label='Validation') + axes[2].set_title('VQ Loss') + axes[2].set_ylabel('Loss') + axes[2].grid(True) + axes[2].legend() + + # Plot perplexity + axes[3].plot(history.history['perplexity'], 'b-', label='Train') + if 'val_perplexity' in history.history: + axes[3].plot(history.history['val_perplexity'], 'r-', label='Validation') + axes[3].set_title('Perplexity') + axes[3].set_xlabel('Epochs') + axes[3].set_ylabel('Perplexity') + axes[3].grid(True) + axes[3].legend() + + plt.tight_layout() + plt.savefig('vqvae_training_metrics.png') + plt.show() # Plot the training metrics @@ -1091,7 +1094,7 @@ def plot_training_metrics(history): output = model(example_batch, training=False) # Unpack the output -reconstruction, quantized_latent, cluster_indices, _ = output +reconstruction, quantized_latent, cluster_indices, vq_loss, perplexity= output # Visualize reconstructions @@ -1123,45 +1126,116 @@ def plot_reconstructions(original, reconstructed, n_samples=5): # Visualize codebook usage distribution -def plot_codebook_usage(indices, num_embeddings): - """Visualize the usage distribution of codebook vectors.""" - # Flatten all indices - flat_indices = tf.reshape(indices, [-1]).numpy() +def plot_codebook_usage(indices, num_embeddings, save_path='codebook_usage.png'): + """ + Visualize the usage distribution of codebook vectors. + # we have a list of float values around 100 unique values, but we only have 32 codebook vectors + # we need to assign the float values to the codebook vectors with a deviation threshold based on num_embeddings + # define N ranges between 0 to 1 such that N == num_embeddings + # assign the float values to the ranges and replace the float values with the index of the range + + Args: + indices: Tensor containing the indices of the codebook vectors used + num_embeddings: Total number of vectors in the codebook + save_path: Path to save the visualization + """ + + # Convert to numpy if it's a tensor + if isinstance(indices, tf.Tensor): + indices = indices.numpy() + + # Flatten the indices if they're not already flattened + flat_indices = indices.flatten() + + # Check if we need to quantize float values to discrete indices + if np.issubdtype(flat_indices.dtype, np.floating): + print(f"Detected floating point indices, quantizing to {num_embeddings} discrete values") + min_val = np.min(flat_indices) + max_val = np.max(flat_indices) + print(f"Index range: {min_val} to {max_val}") + + # Create quantization bins + bins = np.linspace(min_val, max_val, num_embeddings + 1) + + # Digitize the indices (assign each to a bin) + discrete_indices = np.digitize(flat_indices, bins) - 1 + + # Clip to ensure valid range + discrete_indices = np.clip(discrete_indices, 0, num_embeddings - 1) + flat_indices = discrete_indices + + # Count occurrences of each codebook vector + unique, counts = np.unique(flat_indices, return_counts=True) + + # Create a complete distribution including zeros for unused vectors + full_distribution = np.zeros(num_embeddings) + for idx, count in zip(unique, counts): + if 0 <= idx < num_embeddings: + full_distribution[int(idx)] = count + + # Calculate usage statistics + used_vectors = np.sum(full_distribution > 0) + usage_percentage = (used_vectors / num_embeddings) * 100 + + # Create the figure + plt.figure(figsize=(12, 6)) + + # Create bar plot + bar_positions = np.arange(num_embeddings) + bars = plt.bar(bar_positions, full_distribution) + + # Add a color gradient based on frequency + max_count = np.max(full_distribution) + if max_count > 0: # Avoid division by zero + for i, bar in enumerate(bars): + intensity = full_distribution[i] / max_count + bar.set_color(plt.cm.viridis(intensity)) + + # Add labels and title + plt.xlabel('Codebook Vector Index') + plt.ylabel('Usage Count') + plt.title(f'Codebook Vector Usage Distribution\n{used_vectors}/{num_embeddings} vectors used ({usage_percentage:.1f}%)') + + # Add grid for better readability + plt.grid(axis='y', linestyle='--', alpha=0.7) + + # Add a colorbar as a usage intensity reference + sm = plt.cm.ScalarMappable(cmap=plt.cm.viridis, norm=plt.Normalize(0, max_count)) + sm.set_array([]) + cbar = plt.colorbar(sm) + cbar.set_label('Frequency') + + # Improve layout + plt.tight_layout() + + # Save the plot + plt.savefig(save_path) + + # Display statistics + print(f"Codebook usage statistics:") + print(f"- Total vectors in codebook: {num_embeddings}") + print(f"- Number of vectors used: {used_vectors} ({usage_percentage:.1f}%)") + if used_vectors > 0: + print(f"- Most used vector: {np.argmax(full_distribution)} (used {np.max(full_distribution)} times)") + used_indices = np.where(full_distribution > 0)[0] + min_used_idx = used_indices[np.argmin(full_distribution[used_indices])] + print(f"- Least used vector: {min_used_idx} (used {full_distribution[min_used_idx]} times)") - # Count occurrences of each index - unique_indices, counts = np.unique(flat_indices, return_counts=True) - - # Create a histogram for all possible indices (including unused ones) - full_histogram = np.zeros(num_embeddings) - for idx, count in zip(unique_indices, counts): - full_histogram[idx] = count + plt.show() - # Plot the histogram - plt.figure(figsize=(12, 6)) - plt.bar(range(num_embeddings), full_histogram) - plt.xlabel('Codebook Index') - plt.ylabel('Usage Count') - plt.title('Codebook Vector Usage Distribution') - plt.grid(True, axis='y') - - # Calculate and display codebook utilization - utilization = len(unique_indices) / num_embeddings * 100 - plt.text(0.5, 0.9, f'Codebook Utilization: {utilization:.1f}% ({len(unique_indices)}/{num_embeddings})', - transform=plt.gca().transAxes, ha='center', fontsize=12, - bbox=dict(facecolor='white', alpha=0.8)) + return used_vectors, usage_percentage - plt.tight_layout() - plt.savefig('vqvae_codebook_usage.png') - plt.show() print("\nAnalyzing codebook usage...") plot_codebook_usage(cluster_indices, NUM_EMBEDDINGS) # Save the model -model.save_weights('vqvae_model_weights.h5') +model.save_weights('tmp_directory/vqvae_model_weights.h5') print("\nModel weights saved to 'vqvae_model_weights.h5'") # You can now save the model weights if needed # model.save_weights('vq_unet_mhc1_weights.h5') -# print("Model weights saved.") \ No newline at end of file +# print("Model weights saved.") + +# TODO draw a U-MAP plot of the latent space diff --git a/utils/model.py b/utils/model.py index 08837024d..5866a3965 100644 --- a/utils/model.py +++ b/utils/model.py @@ -1,3 +1,4 @@ +import numpy as np import tensorflow as tf import keras from keras import layers @@ -8,7 +9,7 @@ # ------------------------------ class SCQ(layers.Layer): def __init__(self, num_embed=64, dim_embed=32, dim_input=128, lambda_reg=0.1, proj_iter=10, - descrete_loss=False, beta_loss=0.25, **kwargs): + discrete_loss=False, beta_loss=0.25, **kwargs): """ Soft Convex Quantization (SCQ) layer. @@ -18,10 +19,10 @@ def __init__(self, num_embed=64, dim_embed=32, dim_input=128, lambda_reg=0.1, pr dim_input: Dimension of input features (projected to dim_embed). lambda_reg: Regularization parameter in the SCQ objective. proj_iter: Number of iterations for the iterative simplex projection. - descrete_loss: if True, commitment and codebook loss are calculated similar + discrete_loss: if True, commitment and codebook loss are calculated similar to VQ-VAE loss, with stop-gradient operation. If False, only quantization error is calculated as loss |Z_q - Z_e|**2 - beta_loss: A float to be used in VQ loss. Only used if descrete_loss==True. + beta_loss: A float to be used in VQ loss. Only used if discrete_loss==True. multiplied to (1-b)*commitment_loss + b*codebook_loss """ super().__init__(**kwargs) @@ -30,7 +31,7 @@ def __init__(self, num_embed=64, dim_embed=32, dim_input=128, lambda_reg=0.1, pr self.dim_input = dim_input self.lambda_reg = lambda_reg self.proj_iter = proj_iter - self.descrete_loss = descrete_loss + self.discrete_loss = discrete_loss self.beta_loss = beta_loss self.epsilon = 1e-5 @@ -112,7 +113,7 @@ def call(self, inputs): Zq = tf.transpose(Zq_flat) # (B*N, dim_embed) # 6. calculate quantization loss, combined commitment and codebook losses - if not self.descrete_loss: + if not self.discrete_loss: loss = tf.reduce_mean((Zq - flat_inputs) ** 2) # (B*N, dim_embed) else: commitment_loss = tf.reduce_mean((tf.stop_gradient(Zq) - flat_inputs) ** 2) @@ -328,14 +329,14 @@ def layernorm(self, inputs): class SCQ_model(tf.keras.models.Model): def __init__(self, input_dim=1024, general_embed_dim=128, codebook_dim=16, codebook_num=64, - descrete_loss=False, heads=4, names='SCQ_model', + discrete_loss=False, heads=4, names='SCQ_model', weight_recon=1, weight_vq=0.2, **kwargs): super().__init__() self.input_dim = input_dim self.general_embed_dim = general_embed_dim self.codebook_dim = codebook_dim self.codebook_num = codebook_num - self.descrete_loss = descrete_loss + self.discrete_loss = discrete_loss self.heads = heads self.names = names self.weight_recon = tf.cast(weight_recon, tf.float32) @@ -345,7 +346,7 @@ def __init__(self, input_dim=1024, general_embed_dim=128, codebook_dim=16, code self.encoder = Encoder(dim_input=self.input_dim, dim_embed=self.general_embed_dim, heads=self.heads) self.scq = SCQ(dim_input=self.general_embed_dim, dim_embed=self.codebook_dim, - num_embed=self.codebook_num, descrete_loss=self.descrete_loss) + num_embed=self.codebook_num, discrete_loss=self.discrete_loss) self.decoder = Decoder(dim_input=self.codebook_dim, dim_embed=self.general_embed_dim, dim_output=self.input_dim, heads=self.heads) @@ -617,7 +618,7 @@ def create_dataset(X, batch_size=1, is_training=True): # # Generate random input data (batch_size, seq_length, feature_dim) # x_train = random_one_hot_sequence(batch_size, seq_length, feature_dim) # # Initialize SCQ model -# model = SCQ_model(input_dim=feature_dim, general_embed_dim=128, codebook_dim=32, codebook_num=5, descrete_loss=False, heads=8) +# model = SCQ_model(input_dim=feature_dim, general_embed_dim=128, codebook_dim=32, codebook_num=5, discrete_loss=False, heads=8) # # Compile model # model.compile(optimizer=keras.optimizers.Adam(learning_rate=0.001)) # # Train model and capture history @@ -657,7 +658,7 @@ def create_dataset(X, batch_size=1, is_training=True): # test_dataset = create_dataset(X_test, batch_size=batch_size, is_training=False) # # # Initialize SCQ model -# model = SCQ_model(input_dim=feature_dim, general_embed_dim=128, codebook_dim=32, codebook_num=5, descrete_loss=False, heads=8) +# model = SCQ_model(input_dim=feature_dim, general_embed_dim=128, codebook_dim=32, codebook_num=5, discrete_loss=False, heads=8) # # Compile model # model.compile(optimizer=keras.optimizers.Adam(learning_rate=0.001)) # # Train model and capture history @@ -694,6 +695,266 @@ def create_dataset(X, batch_size=1, is_training=True): from tensorflow import keras from tensorflow.keras import layers +# original SCQ +class SCQ_layer(layers.Layer): + def __init__(self, num_embed=64, dim_embed=32, lambda_reg=0.5, proj_iter=10, + discrete_loss=False, beta_loss=0.25, reset_dead_codes=True, + usage_threshold=1e-5, reset_interval=100, **kwargs): + """ + Soft Convex Quantization (SCQ) layer. + + Args: + num_embed: Number of codebook vectors. + dim_embed: Embedding dimension (for both encoder and codebook). + lambda_reg: Regularization parameter in the SCQ objective. + proj_iter: Number of iterations for the iterative simplex projection. + discrete_loss: if True, commitment and codebook loss are calculated similar + to VQ-VAE loss, with stop-gradient operation. If False, only quantization error + is calculated as loss |Z_q - Z_e|**2 + beta_loss: A float to be used in VQ loss. Only used if discrete_loss==True. + multiplied to (1-b)*commitment_loss + b*codebook_loss + reset_dead_codes: Whether to reset dead codebook vectors + usage_threshold: Threshold below which a codebook vector is considered "dead" + reset_interval: Reset dead codes every this many calls to the layer + """ + super().__init__(**kwargs) + self.num_embed = num_embed + self.dim_embed = dim_embed + self.lambda_reg = lambda_reg + self.proj_iter = proj_iter + self.discrete_loss = discrete_loss + self.beta_loss = beta_loss + self.epsilon = 1e-5 + + # Codebook reset parameters + self.call_count = 0 + self.reset_dead_codes = True + self.usage_threshold = 1e-4 + self.reset_interval = 50 + + def build(self, input_shape): + # Learnable scale and bias for layer normalization. + self.gamma = self.add_weight( + shape=(self.dim_embed,), + initializer="ones", + trainable=True, + name="ln_gamma") + self.beta = self.add_weight( + shape=(self.dim_embed,), + initializer="zeros", + trainable=True, + name="ln_beta") + # Codebook: each column is one codebook vector. + self.embed_w = self.add_weight( + shape=(self.dim_embed, self.num_embed), + initializer='uniform', + trainable=True, + name='scq_embedding') + # Projection weights to map input features into the embedding space. + self.d_w = self.add_weight( + shape=(self.dim_embed, self.dim_embed), + initializer='random_normal', + trainable=True, + name='scq_w') + self.d_b = self.add_weight( + shape=(self.dim_embed,), + initializer='zeros', + trainable=True, + name='scq_b') + + # Usage tracking for codebook vectors + self.code_usage = self.add_weight( + shape=(self.num_embed,), + initializer='zeros', + trainable=False, + name='code_usage', + dtype=tf.float32 + ) + + def call(self, inputs): + """ + Forward pass for SCQ. + Args: + inputs: Tensor of shape (B, N, dim_input) + Returns: + Quantized output: Tensor of shape (B, N, dim_embed) + """ + # 1. Project inputs to the embedding space and apply layer normalization. + x = tf.matmul(inputs, self.d_w) + self.d_b # (B, N, dim_embed) + x = self.layernorm(x) + + input_shape = tf.shape(x) # (B, N, dim_embed) + flat_inputs = tf.reshape(x, [-1, self.dim_embed]) # (B*N, dim_embed) + + # 2. Compute hard VQ assignments as initialization. + flat_detached = tf.stop_gradient(flat_inputs) + x_norm_sq = tf.reduce_sum(flat_detached ** 2, axis=1, keepdims=True) # (B*N, 1) + codebook_norm_sq = tf.reduce_sum(self.embed_w ** 2, axis=0, keepdims=True) # (1, num_embed) + dot_product = tf.matmul(flat_detached, self.embed_w) # (B*N, num_embed) + distances = x_norm_sq + codebook_norm_sq - 2 * dot_product # (B*N, num_embed) + + assign_indices = tf.argmin(distances, axis=1) # (B*N,) + P_tilde = tf.one_hot(assign_indices, depth=self.num_embed, dtype=tf.float32) # (B*N, num_embed) + P_tilde = tf.transpose(P_tilde) # (num_embed, B*N) + + # Track codebook usage + if self.reset_dead_codes: + # Update usage counts (moving average) + batch_usage = tf.reduce_mean(tf.transpose(P_tilde), axis=0) # (num_embed,) + decay = 0.99 # Exponential moving average decay factor + self.code_usage.assign(decay * self.code_usage + (1 - decay) * batch_usage) + + # Periodically check for dead codes and reset them + self.call_count += 1 + if self.call_count % self.reset_interval == 0: + self._reset_dead_codes(flat_inputs) + + # 3. Solve the SCQ optimization via a linear system. + C = self.embed_w # (dim_embed, num_embed) + Z = tf.transpose(flat_inputs) # (dim_embed, B*N) + CtC = tf.matmul(C, C, transpose_a=True) # (num_embed, num_embed) + I = tf.eye(self.num_embed, dtype=tf.float32) + A = CtC + self.lambda_reg * I # (num_embed, num_embed) + CtZ = tf.matmul(C, Z, transpose_a=True) # (num_embed, B*N) + b = CtZ + self.lambda_reg * P_tilde # (num_embed, B*N) + P_sol = tf.linalg.solve(A, b) # Unconstrained solution: (num_embed, B*N) + + # 4. Project each column of P_sol onto the probability simplex. + P_proj = self.project_columns_to_simplex(P_sol) # (num_embed, B*N) + # P_proj = tf.nn.softmax(P_sol, axis=0) + out_P_proj = tf.transpose(P_proj) # (B*N, num_embed) + out_P_proj = tf.reshape(out_P_proj, (input_shape[0], input_shape[1], -1)) # (B,N,num_embed) + # out_P_proj = tf.reduce_mean(out_P_proj, axis=-1, keepdims=True) #(B,N,1) + + # 5. Reconstruct quantized output: Z_q = C * P_proj. + Zq_flat = tf.matmul(C, P_proj) # (dim_embed, B*N) + Zq = tf.transpose(Zq_flat) # (B*N, dim_embed) + + # 6. calculate quantization loss, combined commitment and codebook losses + if not self.discrete_loss: + # Add regularization to encourage more uniform codebook usage + p_uniform = tf.ones([self.num_embed], dtype=tf.float32) / tf.cast(self.num_embed, tf.float32) + p_mean = tf.reduce_mean(out_P_proj, axis=[0, 1]) # Average usage across batch + entropy_reg = -tf.reduce_sum(p_mean * tf.math.log(p_mean + 1e-10)) # Maximize entropy + + # Calculate cosine similarities between codebook vectors + norm_codebook = tf.nn.l2_normalize(self.embed_w, axis=0) # (dim_embed, num_embed) + similarities = tf.matmul(tf.transpose(norm_codebook), norm_codebook) # (num_embed, num_embed) + + # Create a mask to ignore self-similarities + mask = tf.ones_like(similarities) - tf.eye(self.num_embed) + masked_similarities = similarities * mask + + # Penalize high similarities between different codebook vectors + diversity_loss = tf.reduce_mean(tf.nn.relu(masked_similarities - 0.1)) # Penalize similarities > 0.1 + + # Combine with existing loss + loss = tf.reduce_mean((Zq - flat_inputs) ** 2) + 0.5 * entropy_reg + 0.2 * diversity_loss + + else: + commitment_loss = tf.reduce_mean((tf.stop_gradient(Zq) - flat_inputs) ** 2) + codebook_loss = tf.reduce_mean((Zq - flat_detached) ** 2) + loss = ( + (tf.cast(1 - self.beta_loss, tf.float32) * commitment_loss) + + (tf.cast(self.beta_loss, tf.float32) * codebook_loss) + ) + + Zq = tf.reshape(Zq, input_shape) # (B, N, dim_embed) + self.add_loss(loss) # Register the loss with the layer + + # 7. Calculate perplexity (similar to VQ layer) + # Reshape out_P_proj to simplify calculations + flat_P_proj = tf.reshape(out_P_proj, [-1, self.num_embed]) # (B*N, num_embed) + + # Calculate average probability per codebook vector across batch + avg_probs = tf.reduce_mean(flat_P_proj, axis=0) # (num_embed,) + + # Calculate perplexity: 2^(entropy) + # Higher perplexity means more uniform codebook usage + perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) + + return Zq, out_P_proj, loss, perplexity # (B,N,embed_dim), #(B,N,num_embed), (1,), (1,) + + def project_columns_to_simplex(self, P_sol): + """Projects columns of a matrix to the probability simplex.""" + # Transpose to work with rows instead of columns + P_t = tf.transpose(P_sol) # (B*N, num_embed) + # Sort rows in descending order + sorted_P = tf.sort(P_t, axis=1, direction='DESCENDING') + # Compute cumulative sums and thresholds + cumsum = tf.cumsum(sorted_P, axis=1) + k = tf.range(1, tf.shape(sorted_P)[1] + 1, dtype=tf.float32) + thresholds = (cumsum - 1.0) / k + # Find maximum valid index per row (cast to int32 explicitly) + valid_mask = sorted_P > thresholds + max_indices = tf.argmax( + tf.cast(valid_mask, tf.int32) * + tf.range(tf.shape(sorted_P)[1], dtype=tf.int32), + axis=1 + ) + max_indices = tf.cast(max_indices, tf.int32) # Explicit cast to int32 + # Gather required cumulative sums + batch_indices = tf.range(tf.shape(P_t)[0], dtype=tf.int32) + gather_indices = tf.stack([batch_indices, max_indices], axis=1) + # Rest of the code remains the same... + selected_cumsum = tf.gather_nd(cumsum, gather_indices) + theta = (selected_cumsum - 1.0) / tf.cast(max_indices + 1, tf.float32) + # Apply projection and transpose back + P_projected = tf.nn.relu(P_t - theta[:, tf.newaxis]) + return tf.transpose(P_projected) + + def layernorm(self, inputs): + """ + Custom layer normalization over the last dimension. + """ + mean = tf.reduce_mean(inputs, axis=-1, keepdims=True) + variance = tf.math.reduce_variance(inputs, axis=-1, keepdims=True) + normed = (inputs - mean) / tf.sqrt(variance + self.epsilon) + return self.gamma * normed + self.beta + + def _reset_dead_codes(self, encoder_outputs): + """ + Reset dead (unused) codebook vectors with improved strategy. + + Args: + encoder_outputs: Tensor of encoder outputs (B*N, dim_embed) + """ + # Find dead codes (those with usage below threshold) + dead_codes = tf.where(self.code_usage < self.usage_threshold) + num_dead = tf.shape(dead_codes)[0] + + if num_dead > 0: + tf.print(f"Resetting {num_dead} dead codebook vectors") + + # Identify most used codes + most_used_idx = tf.argsort(self.code_usage, direction='DESCENDING')[:tf.maximum(3, num_dead)] + most_used = tf.gather(tf.transpose(self.embed_w), most_used_idx) + + # Strategy: Use a mix of random encoder outputs and perturbations of most used vectors + batch_size = tf.shape(encoder_outputs)[0] + + for i in range(num_dead): + dead_idx = tf.cast(dead_codes[i][0], tf.int32) + + if i % 2 == 0 and batch_size > 0: # Even indices: use encoder outputs + random_idx = tf.random.uniform(shape=[], minval=0, maxval=batch_size, dtype=tf.int32) + new_vector = encoder_outputs[random_idx] + else: # Odd indices: perturb most used vectors + source_idx = i % tf.shape(most_used)[0] + source_vector = most_used[source_idx] + # Add significant noise to create meaningful variation + noise = tf.random.normal(shape=tf.shape(source_vector), stddev=0.3) + new_vector = source_vector + noise + # Normalize to maintain scale + new_vector = new_vector / (tf.norm(new_vector) + 1e-8) * tf.norm(source_vector) + + # Update the embeddings at the dead code position + self.embed_w[:, dead_idx].assign(tf.reshape(new_vector, [self.dim_embed])) + # Reset usage counter for the revived code + self.code_usage[dead_idx].assign( + tf.ones_like(self.code_usage[dead_idx]) * 0.2) # Start with higher usage + + class VQ_Layer(tf.keras.layers.Layer): def __init__(self, embedding_dim, num_embeddings, beta, **kwargs): super().__init__(**kwargs) @@ -786,6 +1047,7 @@ def conv_block(filters, kernel_size=3, activation='relu', padding='same', batch_ return keras.Sequential(layers_list, name=name) + def upconv_block(filters, kernel_size=3, activation='relu', padding='same', batch_norm=True, name_prefix=None): transpose_conv_name = f"{name_prefix}_transpose" if name_prefix else None conv_block_name = f"{name_prefix}_conv" if name_prefix else None @@ -808,7 +1070,7 @@ def upconv_block(filters, kernel_size=3, activation='relu', padding='same', batc return upconv, conv -class VQ1DUnet(keras.Model): +class SCQ1DAutoEncoder(keras.Model): def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, **kwargs): super().__init__(**kwargs) self.input_channels = input_dim[-1] @@ -830,7 +1092,9 @@ def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, ** self.bottleneck = conv_block(self.embedding_dim, kernel_size=1, activation='linear', name='bottleneck') # VQ Layer - self.vq_layer = VQ_Layer(self.embedding_dim, self.num_embeddings, self.commitment_beta, name="vq_layer") + # self.vq_layer = VQ_Layer(self.embedding_dim, self.num_embeddings, self.commitment_beta, name="vq_layer") + self.vq_layer = SCQ_layer(num_embed=self.num_embeddings, dim_embed=self.embedding_dim, + beta_loss=self.commitment_beta, discrete_loss=False) # Decoder self.up4_trans, self.dec4_conv = upconv_block(512, name_prefix='dec4') @@ -844,6 +1108,7 @@ def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, ** self.total_loss_tracker = keras.metrics.Mean(name="total_loss") self.recon_loss_tracker = keras.metrics.Mean(name="recon_loss") self.vq_loss_tracker = keras.metrics.Mean(name="vq_loss") + self.perplexity_tracker = keras.metrics.Mean(name="perplexity") def call(self, inputs, training=False): # --- Encoding --- @@ -854,33 +1119,34 @@ def call(self, inputs, training=False): x_bottleneck = self.bottleneck(self.pool4(x4)) # --- Vector Quantization --- - quantized, indices, perplexity = self.vq_layer(x_bottleneck) + quantized, indices, vq_loss, perplexity = self.vq_layer(x_bottleneck) # --- Decoding --- y = self.up4_trans(quantized) - # y = tf.concat([y, x4], axis=-1) y = self.dec4_conv(y) y = self.up3_trans(y) - # y = tf.concat([y, x3], axis=-1) y = self.dec3_conv(y) y = self.up2_trans(y) - # y = tf.concat([y, x2], axis=-1) y = self.dec2_conv(y) y = self.up1_trans(y) - # y = tf.concat([y, x1], axis=-1) y = self.dec1_conv(y) output = self.output_layer(y) vq_loss = tf.add_n(self.vq_layer.losses) if self.vq_layer.losses else tf.constant(0.0) - return output, quantized, indices, vq_loss + return output, quantized, indices, vq_loss, perplexity @property def metrics(self): - return [self.total_loss_tracker, self.recon_loss_tracker, self.vq_loss_tracker] + return [ + self.total_loss_tracker, + self.recon_loss_tracker, + self.vq_loss_tracker, + self.perplexity_tracker + ] def train_step(self, data): if isinstance(data, tuple): @@ -890,16 +1156,50 @@ def train_step(self, data): x = y = data with tf.GradientTape() as tape: - reconstruction, _, _, vq_loss = self(x, training=True) + reconstruction, quantized, indices, vq_loss, perplexity = self(x, training=True) + + # Basic reconstruction loss recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) - total_loss = recon_loss + vq_loss + self.commitment_beta * tf.reduce_mean(tf.math.squared_difference(x, reconstruction)) - vq_loss = tf.add_n(self.vq_layer.losses) if self.vq_layer.losses else tf.constant(0.0) + + # Add feature matching loss by comparing intermediate features + with tape.stop_recording(): + _, mid_features, _, _, _ = self(reconstruction, training=False) + orig_mid_features = quantized + + # Feature matching loss to maintain semantic information + feature_loss = tf.reduce_mean(tf.math.squared_difference(orig_mid_features, mid_features)) + + # Combine losses with adjusted weights + total_loss = recon_loss + vq_loss + 0.1 * feature_loss + + # Add codebook usage penalty if perplexity is too low + usage_penalty = tf.cond( + perplexity < self.num_embeddings * 0.5, + lambda: 0.1 * (self.num_embeddings * 0.5 - perplexity), + lambda: 0.0 + ) + total_loss += usage_penalty grads = tape.gradient(total_loss, self.trainable_variables) + + # Clip gradients to prevent instability + grads, _ = tf.clip_by_global_norm(grads, 5.0) + self.optimizer.apply_gradients(zip(grads, self.trainable_variables)) + + # Update all the trackers self.total_loss_tracker.update_state(total_loss) self.recon_loss_tracker.update_state(recon_loss) self.vq_loss_tracker.update_state(vq_loss) + self.perplexity_tracker.update_state(perplexity) + + # Print the perplexity every 100 steps + step = self.optimizer.iterations + tf.cond( + tf.equal(tf.math.floormod(step, 100), 0), + lambda: tf.print("Step:", step, "Perplexity:", perplexity, "Target:", self.num_embeddings * 0.5), + lambda: tf.no_op() + ) return {m.name: m.result() for m in self.metrics} @@ -910,17 +1210,103 @@ def test_step(self, data): else: x = y = data - reconstruction, _, _, vq_loss = self(x, training=False) + reconstruction, _, _, vq_loss, perplexity = self(x, training=False) recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) - total_loss = recon_loss + vq_loss + total_loss = recon_loss + vq_loss + self.commitment_beta * tf.reduce_mean( + tf.math.squared_difference(x, reconstruction)) self.total_loss_tracker.update_state(total_loss) self.recon_loss_tracker.update_state(recon_loss) self.vq_loss_tracker.update_state(vq_loss) + self.perplexity_tracker.update_state(perplexity) # Now actually updating the perplexity tracker + + # tf.print("Perplexity:", perplexity) # Print the actual perplexity value # Print the actual perplexity value return {m.name: m.result() for m in self.metrics} +class CodebookUsageCallback(tf.keras.callbacks.Callback): + """ + Callback to monitor and adjust codebook usage during training. + """ + + def __init__(self, test_input, plot_freq=5, min_perplexity_ratio=0.5): + """ + Args: + test_input: A small batch of test data to monitor codebook usage + plot_freq: How often to check usage (in epochs) + min_perplexity_ratio: Minimum ratio of perplexity to num_embeddings + """ + super().__init__() + self.test_input = test_input + self.plot_freq = plot_freq + self.min_perplexity_ratio = min_perplexity_ratio + self.usage_history = [] + self.perplexity_history = [] + + def on_epoch_end(self, epoch, logs=None): + # Get the current model outputs for test data + outputs = self.model(self.test_input, training=False) + _, _, indices, _, perplexity = outputs + + # Convert indices to flat array if using VQ + if isinstance(indices, tf.Tensor) and len(indices.shape) > 1: + indices = tf.reshape(indices, [-1]) + + # Compute usage statistics + if hasattr(self.model, 'vq_layer') and hasattr(self.model.vq_layer, 'code_usage'): + # If using SCQ with explicit usage tracking + usage = self.model.vq_layer.code_usage.numpy() + elif isinstance(indices, tf.Tensor): + # For VQ, compute usage from indices + unique_indices, counts = tf.unique_with_counts(indices) + usage = np.zeros(self.model.num_embeddings) + for idx, count in zip(unique_indices.numpy(), counts.numpy()): + usage[idx] = count / tf.size(indices).numpy() + + # Record history + self.usage_history.append(usage) + self.perplexity_history.append(perplexity.numpy()) + + # Print status + if epoch % self.plot_freq == 0: + perplexity_ratio = perplexity.numpy() / self.model.num_embeddings + num_used = np.sum(usage > 0.001) # Codes with >0.1% usage + + print(f"\nEpoch {epoch} - Codebook stats:") + print(f" Perplexity: {perplexity.numpy():.2f} / {self.model.num_embeddings} = {perplexity_ratio:.2%}") + print( + f" Active codes: {num_used} / {self.model.num_embeddings} = {num_used / self.model.num_embeddings:.2%}") + + # Take corrective action if usage is too low + if perplexity_ratio < self.min_perplexity_ratio: + print(" WARNING: Low codebook usage detected!") + + # If we have SCQ layer, modify parameters + if hasattr(self.model, 'vq_layer') and hasattr(self.model.vq_layer, 'lambda_reg'): + # Decrease regularization to allow more code usage + old_lambda = self.model.vq_layer.lambda_reg + new_lambda = max(old_lambda * 0.8, 0.05) # Decrease by 20% with a minimum + print(f" Adjusting lambda_reg: {old_lambda:.4f} -> {new_lambda:.4f}") + self.model.vq_layer.lambda_reg = new_lambda + + # Force code reset + if hasattr(self.model.vq_layer, '_reset_dead_codes'): + # Get encoder outputs from test data + # This assumes encoder output is the input to vq_layer + # You may need to adjust based on your actual architecture + encoder_output = self.test_input + for layer in self.model.layers: + if layer == self.model.vq_layer: + break + encoder_output = layer(encoder_output) + + # Force reset of dead codes + flat_encoder_output = tf.reshape(encoder_output, [-1, self.model.embedding_dim]) + self.model.vq_layer._reset_dead_codes(flat_encoder_output) + print(" Forced reset of dead codebook vectors") + + # Example Usage: # Assuming input images are 128x128 pixels with 3 channels # input_shape = (128, 128, 3) From 544d3829b4033f510f5ed387cb5b6e9a901f0c54 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 22 Apr 2025 14:00:58 +0200 Subject: [PATCH 16/83] refactor model and run script: update SCQ parameters, enhance training configuration, and add UMAP visualization for quantized latent space --- pip_requirements.txt | 11 ++- run_pMHC_DL.py | 161 ++++++++++++++++++++++++++++++++++++++----- utils/model.py | 32 +++++---- 3 files changed, 172 insertions(+), 32 deletions(-) diff --git a/pip_requirements.txt b/pip_requirements.txt index 137a8f9bb..e00722504 100644 --- a/pip_requirements.txt +++ b/pip_requirements.txt @@ -19,4 +19,13 @@ urllib3==1.26.14 Levenshtein==0.27.1 tqdm==4.67.1 pyarrow==19.0.1 -scikit-learn==1.6.1 \ No newline at end of file +scikit-learn==1.6.1 +scipy==1.9.3 # required by tensorflow 2.11 +umap-learn==0.5.7 +scikit-image==0.22.0 +pandas==2.2.3 +matplotlib==3.6.3 +datashader==0.17.0 +bokeh==3.4.3 +holoviews==1.20.2 +colorcet==3.1.0 \ No newline at end of file diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index ed47acd8c..75da1ddd5 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -924,21 +924,13 @@ def run_scq_pipeline(data_path, output_dir="test_tmp", run_param_search=True, # --- Configuration --- # INPUT_SHAPE = (64, 64, 1) # IMPORTANT: Adjust to your MHC1 data's shape (height, width, channels) -NUM_EMBEDDINGS = 16 # Number of clusters/codes in the codebook -EMBEDDING_DIM = 64 # Dimension of each codebook vector (latent dim in bottleneck) -BATCH_SIZE = 4 -EPOCHS = 10 # Number of training epochs -LEARNING_RATE = 1e-3 +NUM_EMBEDDINGS = 32 # Number of clusters/codes in the codebook +EMBEDDING_DIM = 32 # Dimension of each codebook vector (latent dim in bottleneck) +BATCH_SIZE = 1 +EPOCHS = 100 # Number of training epochs +LEARNING_RATE = 1e-5 # --- Data Loading and Preparation --- -# def load_mhc1_placeholder_data(num_samples, shape): -# """Generates random placeholder data.""" -# print(f"Generating {num_samples} placeholder samples with shape {shape}...") -# # Generate random data (e.g., pixel values between 0 and 1) -# data = np.random.rand(num_samples, *shape).astype(np.float32) -# print("Placeholder data generated.") -# return data - def create_dataset(X, batch_size=4, is_training=True): """Create a TensorFlow dataset from input array X.""" dataset = tf.data.Dataset.from_tensor_slices(X) @@ -992,9 +984,6 @@ def load_data(data_path, test_size=0.2, random_state=42): embedding_dim=EMBEDDING_DIM, commitment_beta=0.25, ) -model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=LEARNING_RATE)) -history = model.fit(train_dataset, epochs=EPOCHS, validation_data=val_dataset) - print("Model built.") # --- Compile the Model --- @@ -1139,6 +1128,7 @@ def plot_codebook_usage(indices, num_embeddings, save_path='codebook_usage.png') num_embeddings: Total number of vectors in the codebook save_path: Path to save the visualization """ + print("Cluster indices", cluster_indices) # Convert to numpy if it's a tensor if isinstance(indices, tf.Tensor): @@ -1226,7 +1216,6 @@ def plot_codebook_usage(indices, num_embeddings, save_path='codebook_usage.png') return used_vectors, usage_percentage - print("\nAnalyzing codebook usage...") plot_codebook_usage(cluster_indices, NUM_EMBEDDINGS) @@ -1238,4 +1227,140 @@ def plot_codebook_usage(indices, num_embeddings, save_path='codebook_usage.png') # model.save_weights('vq_unet_mhc1_weights.h5') # print("Model weights saved.") -# TODO draw a U-MAP plot of the latent space +# --- Get Latent Space --- +# Get the quantized latent space of the whole dataset +print("\nGetting quantized latent space...") +# whole dataset from train_dataset and val_dataset +whole_dataset = tf.data.Dataset.concatenate(train_dataset, val_dataset) +quantized_latent = [] +cluster_indices_all = [] # To store the indices for coloring +for batch in whole_dataset: + # Get the quantized latent representation + output, q_latent, indices, vq_loss, perplexity = model(batch, training=False) + quantized_latent.append(q_latent.numpy()) + cluster_indices_all.append(indices.numpy()) +quantized_latent = np.concatenate(quantized_latent, axis=0) +cluster_indices_all = np.concatenate(cluster_indices_all, axis=0) +print(f"Quantized latent shape: {quantized_latent.shape}") +# Save the quantized latent space +np.save('quantized_latent.npy', quantized_latent) +print("Quantized latent space saved to 'quantized_latent.npy'") + + +# --- U-MAP Visualization --- +import umap +import pandas as pd +import numpy as np +from sklearn.preprocessing import LabelEncoder + +# Get the latent representations for visualization +print("Preparing latent space visualization...") +# Process whole dataset to get quantized latent representations and track sample identity +quantized_latents = [] +cluster_indices = [] +sample_ids = [] # To track individual sample IDs + +# First process training data +print("Extracting latent representations from training data...") +sample_counter = 0 +for batch in train_dataset: + _, q_latent, indices, _, _ = model(batch, training=False) + quantized_latents.append(q_latent.numpy()) + cluster_indices.append(indices.numpy()) + # Assign a unique ID to each sample in the batch + for i in range(q_latent.shape[0]): + sample_ids.extend([sample_counter] * q_latent.shape[1]) # Repeat ID for each sequence step + sample_counter += 1 + +# Then process validation data +print("Extracting latent representations from validation data...") +for batch in val_dataset: + _, q_latent, indices, _, _ = model(batch, training=False) + quantized_latents.append(q_latent.numpy()) + cluster_indices.append(indices.numpy()) + # Continue assigning unique IDs + for i in range(q_latent.shape[0]): + sample_ids.extend([sample_counter] * q_latent.shape[1]) # Repeat ID for each sequence step + sample_counter += 1 + +# Combine all latent vectors and indices +quantized_latent = np.concatenate(quantized_latents, axis=0) +cluster_indices = np.concatenate(cluster_indices, axis=0) +sample_ids = np.array(sample_ids) + +print(f"Combined latent shape: {quantized_latent.shape}") +print(f"Total unique samples: {len(np.unique(sample_ids))}") + +# Reshape the latent vectors properly for UMAP +if quantized_latent.ndim > 2: + # Reshape from (batch_size, sequence_length, embedding_dim) to (batch_size * sequence_length, embedding_dim) + latent_2d = quantized_latent.reshape(-1, quantized_latent.shape[-1]) + # Reshape the cluster indices as well + if cluster_indices.ndim > 1: + cluster_indices = cluster_indices.reshape(-1) +else: + latent_2d = quantized_latent + +print(f"Reshaped latent for UMAP: {latent_2d.shape}") + +# Apply UMAP dimensionality reduction +print("Computing UMAP projection...") +mapper = umap.UMAP(n_neighbors=30, min_dist=0.1, metric='euclidean', random_state=42) +embedding = mapper.fit_transform(latent_2d) + +# Visualize the embedding with distinct colors for each sample +plt.figure(figsize=(12, 10)) + +# Use sample IDs for coloring (each sample gets a unique color) +scatter = plt.scatter( + embedding[:, 0], + embedding[:, 1], + c=sample_ids, + cmap='tab20', # Colormap with distinct colors + s=10, + alpha=0.7 +) + +# Add legend and labels +cbar = plt.colorbar(scatter, label='Sample ID') +cbar.set_label('Sample ID') +plt.title('UMAP Projection of Quantized Latent Space (colored by sample)', fontsize=14) +plt.xlabel('UMAP Dimension 1', fontsize=12) +plt.ylabel('UMAP Dimension 2', fontsize=12) + +# Add a grid for better readability +plt.grid(linestyle='--', alpha=0.6) + +# Save with higher DPI for better quality +plt.savefig('scqvae_latent_umap_by_sample.png', dpi=300, bbox_inches='tight') +plt.show() + +# Create a second visualization colored by cluster assignment +plt.figure(figsize=(12, 10)) +scatter = plt.scatter( + embedding[:, 0], + embedding[:, 1], + c=cluster_indices, + cmap='viridis', + s=10, + alpha=0.7 +) + +# Add legend and labels +cbar = plt.colorbar(scatter, label='Codebook Vector Index') +plt.title('UMAP Projection of Quantized Latent Space (colored by codebook vector)', fontsize=14) +plt.xlabel('UMAP Dimension 1', fontsize=12) +plt.ylabel('UMAP Dimension 2', fontsize=12) +plt.grid(linestyle='--', alpha=0.6) +plt.savefig('scqvae_latent_umap_by_cluster.png', dpi=300, bbox_inches='tight') +plt.show() + +# Save the embeddings for potential further analysis +np.savez( + 'umap_results.npz', + embedding=embedding, + sample_ids=sample_ids, + cluster_indices=cluster_indices, + latent_vectors=latent_2d +) +print("UMAP visualization complete. Results saved with sample-based coloring.") diff --git a/utils/model.py b/utils/model.py index 5866a3965..139352688 100644 --- a/utils/model.py +++ b/utils/model.py @@ -50,9 +50,10 @@ def build(self, input_shape): # Codebook: each column is one codebook vector. self.embed_w = self.add_weight( shape=(self.dim_embed, self.num_embed), - initializer='uniform', + initializer='glorot_normal', trainable=True, - name='scq_embedding') + name='scq_embedding' + ) # Projection weights to map input features into the embedding space. self.d_w = self.add_weight( shape=(self.dim_input, self.dim_embed), @@ -697,9 +698,9 @@ def create_dataset(X, batch_size=1, is_training=True): # original SCQ class SCQ_layer(layers.Layer): - def __init__(self, num_embed=64, dim_embed=32, lambda_reg=0.5, proj_iter=10, + def __init__(self, num_embed, dim_embed, lambda_reg=0.5, proj_iter=10, discrete_loss=False, beta_loss=0.25, reset_dead_codes=True, - usage_threshold=1e-5, reset_interval=100, **kwargs): + usage_threshold=1e-3, reset_interval=10, **kwargs): """ Soft Convex Quantization (SCQ) layer. @@ -728,9 +729,9 @@ def __init__(self, num_embed=64, dim_embed=32, lambda_reg=0.5, proj_iter=10, # Codebook reset parameters self.call_count = 0 - self.reset_dead_codes = True - self.usage_threshold = 1e-4 - self.reset_interval = 50 + self.reset_dead_codes = reset_dead_codes + self.usage_threshold = usage_threshold + self.reset_interval = reset_interval def build(self, input_shape): # Learnable scale and bias for layer normalization. @@ -753,7 +754,7 @@ def build(self, input_shape): # Projection weights to map input features into the embedding space. self.d_w = self.add_weight( shape=(self.dim_embed, self.dim_embed), - initializer='random_normal', + initializer='glorot_uniform', trainable=True, name='scq_w') self.d_b = self.add_weight( @@ -786,6 +787,9 @@ def call(self, inputs): input_shape = tf.shape(x) # (B, N, dim_embed) flat_inputs = tf.reshape(x, [-1, self.dim_embed]) # (B*N, dim_embed) + # add a small epsilon to avoid numerical issues + flat_inputs = flat_inputs + tf.random.normal(tf.shape(flat_inputs), stddev=0.01) + # 2. Compute hard VQ assignments as initialization. flat_detached = tf.stop_gradient(flat_inputs) x_norm_sq = tf.reduce_sum(flat_detached ** 2, axis=1, keepdims=True) # (B*N, 1) @@ -846,10 +850,10 @@ def call(self, inputs): masked_similarities = similarities * mask # Penalize high similarities between different codebook vectors - diversity_loss = tf.reduce_mean(tf.nn.relu(masked_similarities - 0.1)) # Penalize similarities > 0.1 + diversity_loss = tf.reduce_mean(tf.nn.relu(masked_similarities - 0.05)) # Penalize similarities > 0.05 # Combine with existing loss - loss = tf.reduce_mean((Zq - flat_inputs) ** 2) + 0.5 * entropy_reg + 0.2 * diversity_loss + loss = tf.reduce_mean((Zq - flat_inputs) ** 2) + 1.0 * entropy_reg + 0.5 * diversity_loss else: commitment_loss = tf.reduce_mean((tf.stop_gradient(Zq) - flat_inputs) ** 2) @@ -862,6 +866,8 @@ def call(self, inputs): Zq = tf.reshape(Zq, input_shape) # (B, N, dim_embed) self.add_loss(loss) # Register the loss with the layer + hard_indices = tf.argmax(out_P_proj, axis=-1) # (B,N) + # 7. Calculate perplexity (similar to VQ layer) # Reshape out_P_proj to simplify calculations flat_P_proj = tf.reshape(out_P_proj, [-1, self.num_embed]) # (B*N, num_embed) @@ -873,7 +879,7 @@ def call(self, inputs): # Higher perplexity means more uniform codebook usage perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) - return Zq, out_P_proj, loss, perplexity # (B,N,embed_dim), #(B,N,num_embed), (1,), (1,) + return Zq, hard_indices, loss, perplexity # (B,N,embed_dim), #(B,N,num_embed), (1,), (1,) def project_columns_to_simplex(self, P_sol): """Projects columns of a matrix to the probability simplex.""" @@ -943,7 +949,7 @@ def _reset_dead_codes(self, encoder_outputs): source_idx = i % tf.shape(most_used)[0] source_vector = most_used[source_idx] # Add significant noise to create meaningful variation - noise = tf.random.normal(shape=tf.shape(source_vector), stddev=0.3) + noise = tf.random.normal(shape=tf.shape(source_vector), stddev=0.5) new_vector = source_vector + noise # Normalize to maintain scale new_vector = new_vector / (tf.norm(new_vector) + 1e-8) * tf.norm(source_vector) @@ -1175,7 +1181,7 @@ def train_step(self, data): # Add codebook usage penalty if perplexity is too low usage_penalty = tf.cond( perplexity < self.num_embeddings * 0.5, - lambda: 0.1 * (self.num_embeddings * 0.5 - perplexity), + lambda: 0.5 * (self.num_embeddings * 0.5 - perplexity), lambda: 0.0 ) total_loss += usage_penalty From 7a2bf42c45701bf7c9219d026e67be6dbd77be81 Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 23 Apr 2025 15:29:14 +0200 Subject: [PATCH 17/83] add Pep2Vec installation and k-fold cross-validation functionality --- README.md | 1 + install.sh | 18 +++++- run_pep2vec.py | 105 ++++++++++++++++++++++++++++++++++ utils/processing_functions.py | 57 ++++++++++++++++++ 4 files changed, 180 insertions(+), 1 deletion(-) create mode 100644 run_pep2vec.py diff --git a/README.md b/README.md index 3bb9a4864..c3f58c030 100644 --- a/README.md +++ b/README.md @@ -24,6 +24,7 @@ sequences. CUDA-enabled GPU (required for AlphaFold) Modeller (requires a license key) Git + git-lfs (for large files) ``` Follow these steps to set up PMGen on your system: diff --git a/install.sh b/install.sh index 998610e8e..c15634e91 100755 --- a/install.sh +++ b/install.sh @@ -42,6 +42,8 @@ echo "4. AlphaFold - GitHub: https://github.com/google-deepmind/alphafold" echo " Paper: https://www.nature.com/articles/s41586-021-03819-2" echo "5. ProteinMPNN - Github https://github.com/dauparas/ProteinMPNN" echo " Paper: https://www.science.org/doi/10.1126/science.add2187" +echo "6. Pep2Vec - GitHub: https://github.com/Genentech/Pep2Vec" +echo " Paper: https://www.biorxiv.org/content/10.1101/2024.10.14.618255v1" echo "########################################################" # Step 1: Ask for Modeller License Key @@ -125,7 +127,21 @@ mv "data/modified_files/PMHC.py" "$PANDORA_PMHC_PATH" echo "ProteinMPNN installation" git clone https://github.com/dauparas/ProteinMPNN.git echo "✔ ProteinMPNN setup is done. " -# Step 12: Cleanup and Completion + +# Step 11: Install Pep2Vec +echo "Pep2Vec installation" +git lfs install +git clone https://github.com/Genentech/Pep2Vec +git lfs pull +# verify pep2vec.bin is downloaded +if [ ! -f "Pep2Vec/pep2vec.bin" ]; then + echo "⚠ pep2vec.bin not found. Please check the Pep2Vec repository." + exit 1 +fi +echo "✔ Pep2Vec setup is done. " + + +# Step 13: Cleanup and Completion cd "$CURRENT_DIR" echo "✔ Installation completed successfully!" echo "Please check and modify 'user_setting.py' file to customize for your usage" diff --git a/run_pep2vec.py b/run_pep2vec.py new file mode 100644 index 000000000..15a3bc929 --- /dev/null +++ b/run_pep2vec.py @@ -0,0 +1,105 @@ +# load Conbotnet subset data +import os +import sys +import pandas as pd +import numpy as np +from utils.processing_functions import create_k_fold_leave_one_out_stratified_cross_validation + +def load_data(file_path, sep=","): + """ + Load data from a file and return a DataFrame. + """ + if not os.path.exists(file_path): + raise FileNotFoundError(f"File {file_path} does not exist.") + + df = pd.read_csv(file_path, sep=sep) + return df + +def select_columns(df, columns): + """ + Select specific columns from a DataFrame. + """ + print("DF columns:", df.columns) + print("Selected columns:", columns) + return df[columns] + +def main(): + # Conbotnet dataset paths + # ConBotNet only contains mhc class II + train_dataset_path = os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "train.csv") + test_dataset_path = os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "test_all.csv") + output_dir = os.path.join(os.path.dirname(__file__), "data", "Pep2Vec", "Conbotnet") + os.makedirs(output_dir, exist_ok=True) + + # Load datasets + train_df = load_data(train_dataset_path) + test_df = load_data(test_dataset_path) + print("Train dataset shape:", train_df.shape) + print("Test dataset shape:", test_df.shape) + # Select relevant columns + train_df = select_columns(train_df, ["allele", "long_mer", "binding_label"]) + test_df = select_columns(test_df, ["allele", "long_mer", "binding_label"]) + print("Train dataset shape after column selection:", train_df.shape) + print("Test dataset shape after column selection:", test_df.shape) + + # Rename columns + train_df.columns = ["allotype", "peptide", "binding_label"] + test_df.columns = ["allotype", "peptide", "binding_label"] + + # Remove duplicates + train_df = train_df.drop_duplicates(subset=["allotype", "peptide"]) + test_df = test_df.drop_duplicates(subset=["allotype", "peptide"]) + + # Remove rows with NaN values + train_df = train_df.dropna() + test_df = test_df.dropna() + print("Train dataset shape after removing duplicates and NaN values:", train_df.shape) + print("Test dataset shape after removing duplicates and NaN values:", test_df.shape) + + # Create k-fold cross-validation splits + k = 5 + folds = create_k_fold_leave_one_out_stratified_cross_validation( + train_df, k=k, target_col="binding_label", id_col="allotype", train_size=0.8, subset_prop=0.01 + ) + # Unpack the folds to get train and validation sets + train_dfs = [fold[0] for fold in folds] + val_dfs = [fold[1] for fold in folds] + held_out_id = [fold[2] for fold in folds] + + print("Number of training sets:", len(train_dfs)) + print("Number of validation sets:", len(val_dfs)) + # mkdir folds + os.makedirs(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds"), exist_ok=True) + if os.path.exists(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", "held_out_ids.txt")): + os.remove(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", "held_out_ids.txt")) + + for i, (train_set, val_set, held_out_id) in enumerate(zip(train_dfs, val_dfs, held_out_id)): + train_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"train_set_fold_{i}.csv"), index=False) + val_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"val_set_fold_{i}.csv"), index=False) + with open(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"held_out_ids.txt"), "a") as f: + f.write(f"Fold {i}: {held_out_id}\n") + + # Save the test set + test_df.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet","folds", "test_set.csv"), index=False) + print("Test dataset saved.") + + # drop the label column from the train and validation sets + for i in range(k): + train_set = pd.read_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"train_set_fold_{i}.csv")) + val_set = pd.read_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"val_set_fold_{i}.csv")) + train_set = train_set.drop(columns=["binding_label"]) + val_set = val_set.drop(columns=["binding_label"]) + # drop nans + train_set = train_set.dropna() + val_set = val_set.dropna() + # save the train and validation sets + train_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"train_set_fold_{i}.csv"), index=True) + val_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"val_set_fold_{i}.csv"), index=True) + + # run Pep2Vec for fold 0 training set + os.system(f"./Pep2Vec/pep2vec.bin --dataset {os.path.join(os.path.dirname(__file__), 'data', 'Conbotnet', 'folds', 'train_set_fold_1.csv')} " + f"--output_location {os.path.join(output_dir, 'pep2vec_output_fold_0.parquet')} " + f"--mhctype mhc2") + +if __name__ == "__main__": + main() \ No newline at end of file diff --git a/utils/processing_functions.py b/utils/processing_functions.py index c0ea4f83b..e91578833 100644 --- a/utils/processing_functions.py +++ b/utils/processing_functions.py @@ -16,6 +16,7 @@ warnings.filterwarnings("ignore") sys.path.append(os.path.abspath(os.path.join(os.path.dirname(__file__), '..'))) from user_setting import netmhcipan_path, netmhciipan_path, pmgen_abs_dir +from sklearn.model_selection import train_test_split def process_dataframe(df): # Step 1: Sort IDs with 2 or 5 parts @@ -1058,3 +1059,59 @@ def fetch_polypeptide_sequences(pdb_path): return sequences +# write a function that produces 5 fold cross validation from the df, each fold must have one allele to be left out completely and produce a stratified train and validation based on the label. +# take into account the subset proportion. +def create_k_fold_leave_one_out_stratified_cross_validation(df, k=5, target_col="label", id_col="allele", + subset_prop=1.0, train_size=0.8, random_state=42): + """ + Creates k folds for cross-validation where each fold leaves one unique ID out + and splits the remaining data into stratified train/validation sets. + + Args: + df (pd.DataFrame): The input dataframe. + k (int): The number of folds. + target_col (str): The name of the column containing the target labels for stratification. + id_col (str): The name of the column containing the IDs (alleles) to leave out. + subset_prop (float): The proportion of the remaining data to use for the training set. + train_size (float): The proportion of the non-held-out data to use for training. + random_state (int): Random state for reproducibility of the stratified split. + + Returns: + list: A list of tuples, where each tuple contains (train_df, val_df, left_out_id) for a fold. + The left_out_id is the ID that was completely held out for that fold. + """ + # take a subset of the dataframe + df = df.sample(frac=subset_prop, random_state=random_state) + + # Get unique IDs (alleles) + unique_ids = df[id_col].unique() + + # Check if k is larger than the number of unique IDs + if k > len(unique_ids): + raise ValueError(f"k must be less than or equal to the number of unique IDs ({len(unique_ids)}).") + + # Select k IDs to leave out (one per fold) + np.random.seed(random_state) + selected_ids = np.random.choice(unique_ids, k, replace=False) + + folds = [] + for leave_out_id in selected_ids: + print("leave out ID:", leave_out_id) + # Create a mask for the ID to leave out + leave_out_mask = df[id_col] == leave_out_id + + # Get remaining data (exclude the left out ID) + remaining_df = df[~leave_out_mask].copy() + + # Create stratified train/validation split on the remaining data + train_df, val_df = train_test_split( + remaining_df, + train_size=train_size, + stratify=remaining_df[target_col], + random_state=random_state + ) + + # Include the left_out_id in the tuple + folds.append((train_df, val_df, leave_out_id)) + + return folds From 1c642b4fefc4f30ddcd4ad69760b2efc4dfb711f Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 23 Apr 2025 16:44:41 +0200 Subject: [PATCH 18/83] pep2vec pipeline fixed, scq-vae pipeline is now as a function --- run_pMHC_DL.py | 684 +++++++++++++++++++++++++++---------------------- run_pep2vec.py | 50 ++-- utils/model.py | 134 +++++----- 3 files changed, 471 insertions(+), 397 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index 75da1ddd5..cf155b2b3 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -912,122 +912,87 @@ def run_scq_pipeline(data_path, output_dir="test_tmp", run_param_search=True, epochs=20 )''' -# example of running VQUnet -from utils.model import SCQ1DAutoEncoder # TODO implement a simple training pipeline for VQUnet -import tensorflow as tf -import numpy as np -import time # To time training -import pandas as pd - - -# --- Configuration --- -# INPUT_SHAPE = (64, 64, 1) # IMPORTANT: Adjust to your MHC1 data's shape (height, width, channels) -NUM_EMBEDDINGS = 32 # Number of clusters/codes in the codebook -EMBEDDING_DIM = 32 # Dimension of each codebook vector (latent dim in bottleneck) -BATCH_SIZE = 1 -EPOCHS = 100 # Number of training epochs -LEARNING_RATE = 1e-5 - -# --- Data Loading and Preparation --- -def create_dataset(X, batch_size=4, is_training=True): - """Create a TensorFlow dataset from input array X.""" - dataset = tf.data.Dataset.from_tensor_slices(X) - if is_training: - dataset = dataset.shuffle(buffer_size=len(X)) - dataset = dataset.batch(batch_size) - dataset = dataset.prefetch(tf.data.AUTOTUNE) - return dataset - - -def load_data(data_path, test_size=0.2, random_state=42): - """Load and prepare data for training.""" - # Load data - embeddings = pd.read_parquet(data_path) - - # Select the latent columns - latent_columns = [col for col in embeddings.columns if 'latent' in col] - print(f"Found {len(latent_columns)} latent columns") - - # Extract values and reshape - X = embeddings[latent_columns].values - seq_length = len(latent_columns) - feature_dim = 1 - X = X.reshape(-1, seq_length, feature_dim) +def train_and_evaluate_scqvae( + data_path, + num_embeddings=32, + embedding_dim=32, + batch_size=1, + epochs=10, + learning_rate=1e-4, + commitment_beta=0.25, + output_dir='vqvae_output', + visualize=True, + save_model=True, + random_state=42, + test_size=0.2 +): + """ + Train and evaluate a VQ-VAE model on peptide embedding data. - # Split into train and test sets - X_train, X_test = train_test_split(X, test_size=test_size, random_state=random_state) + Args: + data_path: Path to the parquet file containing peptide embeddings + num_embeddings: Number of clusters/codes in the codebook + embedding_dim: Dimension of each codebook vector + batch_size: Batch size for training + epochs: Number of training epochs + learning_rate: Learning rate for the optimizer + commitment_beta: Beta parameter for commitment loss + output_dir: Directory to save outputs + visualize: Whether to generate visualizations + save_model: Whether to save model weights + random_state: Random seed for reproducibility + test_size: Fraction of data to use for validation - return X_train, X_test, seq_length, feature_dim + Returns: + model: Trained model + history: Training history + latent_data: Dictionary containing latent representations and indices + """ + import os + import tensorflow as tf + import numpy as np + import pandas as pd + import time + import matplotlib.pyplot as plt + from sklearn.model_selection import train_test_split + from utils.model import SCQ1DAutoEncoder -data_path = "data/Pep2Vec/wrapper_mhc1.parquet" -# Load or generate data -print("Loading/Generating Training Data...") -train_data, test_data, seq_length, feature_dim = load_data(data_path, test_size=0.2, random_state=42) # Load training data + # Create output directory + os.makedirs(output_dir, exist_ok=True) -# Create tf.data Datasets for efficient training -# For reconstruction, input and target are the same (x, x) -print("Creating TensorFlow Datasets...") -train_dataset = create_dataset(train_data, batch_size=BATCH_SIZE, is_training=True) -val_dataset = create_dataset(test_data, batch_size=BATCH_SIZE, is_training=False) -print("Datasets created.") + # --- Helper Functions --- + def create_dataset(X, batch_size=4, is_training=True): + """Create a TensorFlow dataset from input array X.""" + dataset = tf.data.Dataset.from_tensor_slices(X) + if is_training: + dataset = dataset.shuffle(buffer_size=len(X)) + dataset = dataset.batch(batch_size) + dataset = dataset.prefetch(tf.data.AUTOTUNE) + return dataset + + def load_data(data_path, test_size=0.2, random_state=42): + """Load and prepare data for training.""" + # Load data + embeddings = pd.read_parquet(data_path) + # Select the latent columns + latent_columns = [col for col in embeddings.columns if 'latent' in col] + print(f"Found {len(latent_columns)} latent columns") -# --- Model Instantiation --- -print("Building the SCQ1DAutoEncoder model...") -input_shape = (seq_length, feature_dim) + # Extract values and reshape + X = embeddings[latent_columns].values + seq_length = len(latent_columns) + feature_dim = 1 + X = X.reshape(-1, seq_length, feature_dim) -model = SCQ1DAutoEncoder( - input_dim=input_shape, - num_embeddings=NUM_EMBEDDINGS, - embedding_dim=EMBEDDING_DIM, - commitment_beta=0.25, -) -print("Model built.") - -# --- Compile the Model --- -# The loss calculation is handled within the train_step, -# but we still need to provide an optimizer. -print("Compiling the model...") -model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=LEARNING_RATE)) -print("Model compiled.") - -# --- Training --- -print(f"Starting training for {EPOCHS} epochs...") -start_time = time.time() - -history = model.fit( - train_dataset, - epochs=EPOCHS, - validation_data=val_dataset # Pass validation data here -) - -end_time = time.time() -print(f"\nTraining finished in {end_time - start_time:.2f} seconds.") - -# --- (Optional) Post-Training --- -print("\nTraining History:") -print(history.history) - -# Example: Get reconstruction and latent codes for a batch from validation set -print("\nExample inference on validation data:") -example_batch = next(iter(val_dataset)) # Get one batch -output = model.predict(example_batch) -if isinstance(output, (list, tuple)) and len(output) == 3: - reconstruction, quantized_latent, cluster_indices = output -else: - reconstruction = output - -# Visualize or save the reconstruction -end_time = time.time() -print(f"\nTraining finished in {end_time - start_time:.2f} seconds.") - -# --- Visualize Training Metrics --- -import matplotlib.pyplot as plt + # Split into train and test sets + X_train, X_test = train_test_split(X, test_size=test_size, random_state=random_state) + return X_train, X_test, seq_length, feature_dim -def plot_training_metrics(history): + def plot_training_metrics(history, save_path=None): """Plot the training metrics over epochs.""" fig, axes = plt.subplots(4, 1, figsize=(12, 20), sharex=True) @@ -1069,67 +1034,43 @@ def plot_training_metrics(history): axes[3].legend() plt.tight_layout() - plt.savefig('vqvae_training_metrics.png') - plt.show() - - -# Plot the training metrics -print("\nPlotting training history...") -plot_training_metrics(history) - -# --- Example Inference and Visualization --- -print("\nPerforming example inference on validation data...") -example_batch = next(iter(val_dataset)) # Get one batch -output = model(example_batch, training=False) - -# Unpack the output -reconstruction, quantized_latent, cluster_indices, vq_loss, perplexity= output - - -# Visualize reconstructions -def plot_reconstructions(original, reconstructed, n_samples=5): - """Plot comparison between original and reconstructed sequences.""" - n_samples = min(n_samples, len(original)) - plt.figure(figsize=(15, 3 * n_samples)) - - for i in range(n_samples): - # Plot original sequence - plt.subplot(n_samples, 2, 2 * i + 1) - plt.plot(original[i, :, 0]) # Assuming last dim is feature dim with size 1 - plt.title(f"Original Sequence {i + 1}") - plt.grid(True) - - # Plot reconstructed sequence - plt.subplot(n_samples, 2, 2 * i + 2) - plt.plot(reconstructed[i, :, 0]) # Assuming same shape as original - plt.title(f"Reconstructed Sequence {i + 1}") - plt.grid(True) - - plt.tight_layout() - plt.savefig('vqvae_reconstructions.png') - plt.show() - - -print("\nVisualizing reconstructions...") -plot_reconstructions(example_batch.numpy(), reconstruction.numpy()) + if save_path: + plt.savefig(save_path) + if visualize: + plt.show() + else: + plt.close() + + def plot_reconstructions(original, reconstructed, n_samples=5, save_path=None): + """Plot comparison between original and reconstructed sequences.""" + n_samples = min(n_samples, len(original)) + plt.figure(figsize=(15, 3 * n_samples)) + + for i in range(n_samples): + # Plot original sequence + plt.subplot(n_samples, 2, 2 * i + 1) + plt.plot(original[i, :, 0]) # Assuming last dim is feature dim with size 1 + plt.title(f"Original Sequence {i + 1}") + plt.grid(True) + + # Plot reconstructed sequence + plt.subplot(n_samples, 2, 2 * i + 2) + plt.plot(reconstructed[i, :, 0]) # Assuming same shape as original + plt.title(f"Reconstructed Sequence {i + 1}") + plt.grid(True) + plt.tight_layout() + if save_path: + plt.savefig(save_path) + if visualize: + plt.show() + else: + plt.close() -# Visualize codebook usage distribution -def plot_codebook_usage(indices, num_embeddings, save_path='codebook_usage.png'): + def plot_codebook_usage(indices, num_embeddings, save_path=None): """ Visualize the usage distribution of codebook vectors. - # we have a list of float values around 100 unique values, but we only have 32 codebook vectors - # we need to assign the float values to the codebook vectors with a deviation threshold based on num_embeddings - # define N ranges between 0 to 1 such that N == num_embeddings - # assign the float values to the ranges and replace the float values with the index of the range - - Args: - indices: Tensor containing the indices of the codebook vectors used - num_embeddings: Total number of vectors in the codebook - save_path: Path to save the visualization """ - print("Cluster indices", cluster_indices) - # Convert to numpy if it's a tensor if isinstance(indices, tf.Tensor): indices = indices.numpy() @@ -1199,7 +1140,8 @@ def plot_codebook_usage(indices, num_embeddings, save_path='codebook_usage.png') plt.tight_layout() # Save the plot - plt.savefig(save_path) + if save_path: + plt.savefig(save_path) # Display statistics print(f"Codebook usage statistics:") @@ -1211,156 +1153,276 @@ def plot_codebook_usage(indices, num_embeddings, save_path='codebook_usage.png') min_used_idx = used_indices[np.argmin(full_distribution[used_indices])] print(f"- Least used vector: {min_used_idx} (used {full_distribution[min_used_idx]} times)") - plt.show() + if visualize: + plt.show() + else: + plt.close() return used_vectors, usage_percentage + # --- Main Pipeline --- + print("Loading/Generating Training Data...") + train_data, test_data, seq_length, feature_dim = load_data( + data_path, test_size=test_size, random_state=random_state + ) -print("\nAnalyzing codebook usage...") -plot_codebook_usage(cluster_indices, NUM_EMBEDDINGS) - -# Save the model -model.save_weights('tmp_directory/vqvae_model_weights.h5') -print("\nModel weights saved to 'vqvae_model_weights.h5'") - -# You can now save the model weights if needed -# model.save_weights('vq_unet_mhc1_weights.h5') -# print("Model weights saved.") - -# --- Get Latent Space --- -# Get the quantized latent space of the whole dataset -print("\nGetting quantized latent space...") -# whole dataset from train_dataset and val_dataset -whole_dataset = tf.data.Dataset.concatenate(train_dataset, val_dataset) -quantized_latent = [] -cluster_indices_all = [] # To store the indices for coloring -for batch in whole_dataset: - # Get the quantized latent representation - output, q_latent, indices, vq_loss, perplexity = model(batch, training=False) - quantized_latent.append(q_latent.numpy()) - cluster_indices_all.append(indices.numpy()) -quantized_latent = np.concatenate(quantized_latent, axis=0) -cluster_indices_all = np.concatenate(cluster_indices_all, axis=0) -print(f"Quantized latent shape: {quantized_latent.shape}") -# Save the quantized latent space -np.save('quantized_latent.npy', quantized_latent) -print("Quantized latent space saved to 'quantized_latent.npy'") - - -# --- U-MAP Visualization --- -import umap -import pandas as pd -import numpy as np -from sklearn.preprocessing import LabelEncoder - -# Get the latent representations for visualization -print("Preparing latent space visualization...") -# Process whole dataset to get quantized latent representations and track sample identity -quantized_latents = [] -cluster_indices = [] -sample_ids = [] # To track individual sample IDs - -# First process training data -print("Extracting latent representations from training data...") -sample_counter = 0 -for batch in train_dataset: - _, q_latent, indices, _, _ = model(batch, training=False) - quantized_latents.append(q_latent.numpy()) - cluster_indices.append(indices.numpy()) - # Assign a unique ID to each sample in the batch - for i in range(q_latent.shape[0]): - sample_ids.extend([sample_counter] * q_latent.shape[1]) # Repeat ID for each sequence step - sample_counter += 1 - -# Then process validation data -print("Extracting latent representations from validation data...") -for batch in val_dataset: - _, q_latent, indices, _, _ = model(batch, training=False) - quantized_latents.append(q_latent.numpy()) - cluster_indices.append(indices.numpy()) - # Continue assigning unique IDs - for i in range(q_latent.shape[0]): - sample_ids.extend([sample_counter] * q_latent.shape[1]) # Repeat ID for each sequence step - sample_counter += 1 - -# Combine all latent vectors and indices -quantized_latent = np.concatenate(quantized_latents, axis=0) -cluster_indices = np.concatenate(cluster_indices, axis=0) -sample_ids = np.array(sample_ids) - -print(f"Combined latent shape: {quantized_latent.shape}") -print(f"Total unique samples: {len(np.unique(sample_ids))}") - -# Reshape the latent vectors properly for UMAP -if quantized_latent.ndim > 2: - # Reshape from (batch_size, sequence_length, embedding_dim) to (batch_size * sequence_length, embedding_dim) - latent_2d = quantized_latent.reshape(-1, quantized_latent.shape[-1]) - # Reshape the cluster indices as well - if cluster_indices.ndim > 1: - cluster_indices = cluster_indices.reshape(-1) -else: - latent_2d = quantized_latent - -print(f"Reshaped latent for UMAP: {latent_2d.shape}") - -# Apply UMAP dimensionality reduction -print("Computing UMAP projection...") -mapper = umap.UMAP(n_neighbors=30, min_dist=0.1, metric='euclidean', random_state=42) -embedding = mapper.fit_transform(latent_2d) - -# Visualize the embedding with distinct colors for each sample -plt.figure(figsize=(12, 10)) - -# Use sample IDs for coloring (each sample gets a unique color) -scatter = plt.scatter( - embedding[:, 0], - embedding[:, 1], - c=sample_ids, - cmap='tab20', # Colormap with distinct colors - s=10, - alpha=0.7 -) - -# Add legend and labels -cbar = plt.colorbar(scatter, label='Sample ID') -cbar.set_label('Sample ID') -plt.title('UMAP Projection of Quantized Latent Space (colored by sample)', fontsize=14) -plt.xlabel('UMAP Dimension 1', fontsize=12) -plt.ylabel('UMAP Dimension 2', fontsize=12) - -# Add a grid for better readability -plt.grid(linestyle='--', alpha=0.6) - -# Save with higher DPI for better quality -plt.savefig('scqvae_latent_umap_by_sample.png', dpi=300, bbox_inches='tight') -plt.show() - -# Create a second visualization colored by cluster assignment -plt.figure(figsize=(12, 10)) -scatter = plt.scatter( - embedding[:, 0], - embedding[:, 1], - c=cluster_indices, - cmap='viridis', - s=10, - alpha=0.7 -) - -# Add legend and labels -cbar = plt.colorbar(scatter, label='Codebook Vector Index') -plt.title('UMAP Projection of Quantized Latent Space (colored by codebook vector)', fontsize=14) -plt.xlabel('UMAP Dimension 1', fontsize=12) -plt.ylabel('UMAP Dimension 2', fontsize=12) -plt.grid(linestyle='--', alpha=0.6) -plt.savefig('scqvae_latent_umap_by_cluster.png', dpi=300, bbox_inches='tight') -plt.show() - -# Save the embeddings for potential further analysis -np.savez( - 'umap_results.npz', - embedding=embedding, - sample_ids=sample_ids, - cluster_indices=cluster_indices, - latent_vectors=latent_2d -) -print("UMAP visualization complete. Results saved with sample-based coloring.") + # Create tf.data Datasets for efficient training + print("Creating TensorFlow Datasets...") + train_dataset = create_dataset(train_data, batch_size=batch_size, is_training=True) + val_dataset = create_dataset(test_data, batch_size=batch_size, is_training=False) + print("Datasets created.") + + # --- Model Instantiation --- + print("Building the SCQ1DAutoEncoder model...") + input_shape = (seq_length, feature_dim) + + model = SCQ1DAutoEncoder( + input_dim=input_shape, + num_embeddings=num_embeddings, + embedding_dim=embedding_dim, + commitment_beta=commitment_beta, + ) + print("Model built.") + + # --- Compile and Train the Model --- + print("Compiling the model...") + model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate)) + print("Model compiled.") + + # --- Training --- + print(f"Starting training for {epochs} epochs...") + start_time = time.time() + + history = model.fit( + train_dataset, + epochs=epochs, + validation_data=val_dataset + ) + + end_time = time.time() + print(f"\nTraining finished in {end_time - start_time:.2f} seconds.") + + # --- Evaluation and Visualization --- + if visualize: + # Plot training metrics + print("\nPlotting training history...") + plot_training_metrics( + history, + save_path=os.path.join(output_dir, 'vqvae_training_metrics.png') + ) + + # Example inference + print("\nPerforming example inference on validation data...") + example_batch = next(iter(val_dataset)) + output = model(example_batch, training=False) + reconstruction, quantized_latent, cluster_indices, vq_loss, perplexity, hard_indices = output + + # Plot reconstructions + print("\nVisualizing reconstructions...") + plot_reconstructions( + example_batch.numpy(), + reconstruction.numpy(), + save_path=os.path.join(output_dir, 'vqvae_reconstructions.png') + ) + + # Plot codebook usage + print("\nAnalyzing codebook usage...") + plot_codebook_usage( + hard_indices, + num_embeddings, + save_path=os.path.join(output_dir, 'codebook_usage.png') + ) + + # --- Save the model --- + if save_model: + model_dir = os.path.join(output_dir, 'model') + os.makedirs(model_dir, exist_ok=True) + model.save_weights(os.path.join(model_dir, 'vqvae_model_weights.h5')) + print(f"\nModel weights saved to '{os.path.join(model_dir, 'vqvae_model_weights.h5')}'") + + # --- Extract and save latent space --- + print("\nExtracting quantized latent space...") + whole_dataset = tf.data.Dataset.concatenate(train_dataset, val_dataset) + quantized_latents = [] + cluster_indices_all = [] + hard_indices_all = [] + + for batch in whole_dataset: + output, q_latent, indices, _, _, hard_indices = model(batch, training=False) + quantized_latents.append(q_latent.numpy()) + cluster_indices_all.append(indices.numpy()) + hard_indices_all.append(hard_indices.numpy()) + + quantized_latent = np.concatenate(quantized_latents, axis=0) + cluster_indices = np.concatenate(cluster_indices_all, axis=0) + hard_indices = np.concatenate(hard_indices_all, axis=0) + + # Save latent representations + np.save(os.path.join(output_dir, 'quantized_latent.npy'), quantized_latent) + np.save(os.path.join(output_dir, 'cluster_indices.npy'), cluster_indices) + np.save(os.path.join(output_dir, 'hard_indices.npy'), hard_indices) + print(f"Latent representations saved to {output_dir}") + + # --- Optional UMAP visualization --- + if visualize: + try: + import umap + print("\nComputing UMAP projection...") + + # Flatten and reshape for UMAP + hard_indices_flat = hard_indices.flatten().reshape(-1, 1) + + # Compute 1D UMAP projection + mapper_1d = umap.UMAP(n_components=1, n_neighbors=15, min_dist=0.1, + metric='euclidean', random_state=random_state) + embedding_1d = mapper_1d.fit_transform(hard_indices_flat) + + # Create sample IDs for visualization + sample_ids = [] + sample_counter = 0 + for batch in val_dataset: + batch_size = batch.shape[0] + for i in range(batch_size): + sample_ids.extend([sample_counter] * seq_length) + sample_counter += 1 + sample_ids = np.array(sample_ids) + + # Visualize 1D UMAP + plt.figure(figsize=(12, 4)) + y_jitter = np.random.rand(embedding_1d.shape[0]) * 0.1 + scatter_1d = plt.scatter(embedding_1d[:, 0], y_jitter, + c=sample_ids[:embedding_1d.shape[0]], + cmap='tab20', s=10, alpha=0.7) + plt.colorbar(scatter_1d, label='Sample ID') + plt.title('1D UMAP Projection of Latent Space', fontsize=14) + plt.xlabel('UMAP Dimension 1', fontsize=12) + plt.yticks([]) + plt.grid(axis='x', linestyle='--', alpha=0.6) + plt.savefig(os.path.join(output_dir, 'umap_projection.png')) + if visualize: + plt.show() + else: + plt.close() + except ImportError: + print("UMAP not installed. Skipping UMAP visualization.") + + # Return results + latent_data = { + 'quantized_latent': quantized_latent, + 'cluster_indices': cluster_indices, + 'hard_indices': hard_indices + } + + return model, history, latent_data + +# Example usage: +if __name__ == "__main__": + model, history, latent_data = train_and_evaluate_scqvae( + data_path="data/Pep2Vec/Conbotnet/pep2vec_output_fold_0.parquet", + num_embeddings=32, + embedding_dim=32, + batch_size=1, + epochs=10, + output_dir="vqvae_results" + ) + +# # Create a 1D UMAP projection colored by cluster indices +# print("Computing 1D UMAP colored by cluster indices...") +# # Use the same 1D UMAP projection, but color by cluster indices +# plt.figure(figsize=(12, 4)) +# cluster_indices_flat = cluster_indices.flatten().reshape(-1, 1) +# embedding_1d = mapper_1d.fit_transform(cluster_indices_flat) +# +# # Regenerate y_jitter to match the new embedding size +# y_jitter = np.random.rand(embedding_1d.shape[0]) * 0.1 +# +# # Check shapes and ensure they match +# print(f"embedding_1d shape: {embedding_1d.shape}") +# print(f"cluster_indices shape: {cluster_indices.shape}") +# +# # Ensure cluster_indices is properly shaped for plotting +# if cluster_indices.ndim > 1: +# cluster_indices_plot = cluster_indices.flatten() +# else: +# cluster_indices_plot = cluster_indices +# +# # Make sure lengths match +# if len(cluster_indices_plot) != len(embedding_1d): +# # Reshape or slice cluster_indices to match embedding_1d +# if len(cluster_indices_plot) > embedding_1d.shape[0]: +# cluster_indices_plot = cluster_indices_plot[:embedding_1d.shape[0]] +# else: +# # If you need to extend, you might repeat values or use a different strategy +# cluster_indices_plot = np.pad(cluster_indices_plot, (0, embedding_1d.shape[0] - len(cluster_indices_plot)), 'edge') +# print(f"Adjusted cluster_indices shape: {cluster_indices_plot.shape}") +# +# scatter_clusters = plt.scatter(embedding_1d[:, 0], y_jitter, c=cluster_indices_plot, cmap='viridis', s=10, alpha=0.7) +# cbar = plt.colorbar(scatter_clusters, label='Cluster Index') +# plt.title('1D UMAP Projection Colored by Cluster Indices', fontsize=14) +# plt.xlabel('UMAP Dimension 1', fontsize=12) +# plt.yticks([]) +# plt.grid(axis='x', linestyle='--', alpha=0.6) +# plt.savefig('umap_clusters.png') +# plt.show() + +# # Apply UMAP dimensionality reduction +# print("Computing UMAP projection...") +# mapper = umap.UMAP(n_neighbors=30, min_dist=0.1, metric='euclidean', random_state=42) +# embedding = mapper.fit_transform(latent_2d) +# +# # Visualize the embedding with distinct colors for each sample +# plt.figure(figsize=(12, 10)) +# +# # Use sample IDs for coloring (each sample gets a unique color) +# scatter = plt.scatter( +# embedding[:, 0], +# embedding[:, 1], +# c=sample_ids, +# cmap='tab20', # Colormap with distinct colors +# s=10, +# alpha=0.7 +# ) +# +# # Add legend and labels +# cbar = plt.colorbar(scatter, label='Sample ID') +# cbar.set_label('Sample ID') +# plt.title('UMAP Projection of Quantized Latent Space (colored by sample)', fontsize=14) +# plt.xlabel('UMAP Dimension 1', fontsize=12) +# plt.ylabel('UMAP Dimension 2', fontsize=12) +# +# # Add a grid for better readability +# plt.grid(linestyle='--', alpha=0.6) +# +# # Save with higher DPI for better quality +# plt.savefig('scqvae_latent_umap_by_sample.png', dpi=300, bbox_inches='tight') +# plt.show() +# +# # Create a second visualization colored by cluster assignment +# plt.figure(figsize=(12, 10)) +# scatter = plt.scatter( +# embedding[:, 0], +# embedding[:, 1], +# c=cluster_indices, +# cmap='viridis', +# s=10, +# alpha=0.7 +# ) +# +# # Add legend and labels +# cbar = plt.colorbar(scatter, label='Codebook Vector Index') +# plt.title('UMAP Projection of Quantized Latent Space (colored by codebook vector)', fontsize=14) +# plt.xlabel('UMAP Dimension 1', fontsize=12) +# plt.ylabel('UMAP Dimension 2', fontsize=12) +# plt.grid(linestyle='--', alpha=0.6) +# plt.savefig('scqvae_latent_umap_by_cluster.png', dpi=300, bbox_inches='tight') +# plt.show() +# +# # Save the embeddings for potential further analysis +# np.savez( +# 'umap_results.npz', +# embedding=embedding, +# sample_ids=sample_ids, +# cluster_indices=cluster_indices, +# latent_vectors=latent_2d +# ) +# print("UMAP visualization complete. Results saved with sample-based coloring.") diff --git a/run_pep2vec.py b/run_pep2vec.py index 15a3bc929..2163e9879 100644 --- a/run_pep2vec.py +++ b/run_pep2vec.py @@ -4,6 +4,7 @@ import pandas as pd import numpy as np from utils.processing_functions import create_k_fold_leave_one_out_stratified_cross_validation +from run_pMHC_DL import train_and_evaluate_scqvae def load_data(file_path, sep=","): """ @@ -43,8 +44,8 @@ def main(): print("Test dataset shape after column selection:", test_df.shape) # Rename columns - train_df.columns = ["allotype", "peptide", "binding_label"] - test_df.columns = ["allotype", "peptide", "binding_label"] + train_df = train_df.rename(columns={"allele": "allotype", "long_mer": "peptide", "binding_label": "binding_label"}) + test_df = test_df.rename(columns={"allele": "allotype", "long_mer": "peptide", "binding_label": "binding_label"}) # Remove duplicates train_df = train_df.drop_duplicates(subset=["allotype", "peptide"]) @@ -59,7 +60,7 @@ def main(): # Create k-fold cross-validation splits k = 5 folds = create_k_fold_leave_one_out_stratified_cross_validation( - train_df, k=k, target_col="binding_label", id_col="allotype", train_size=0.8, subset_prop=0.01 + train_df, k=k, target_col="binding_label", id_col="allotype", train_size=0.8, subset_prop=0.1 ) # Unpack the folds to get train and validation sets train_dfs = [fold[0] for fold in folds] @@ -68,38 +69,49 @@ def main(): print("Number of training sets:", len(train_dfs)) print("Number of validation sets:", len(val_dfs)) + # TODO Fix later, why header is not saved after the first fold # mkdir folds os.makedirs(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds"), exist_ok=True) if os.path.exists(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", "held_out_ids.txt")): os.remove(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", "held_out_ids.txt")) for i, (train_set, val_set, held_out_id) in enumerate(zip(train_dfs, val_dfs, held_out_id)): - train_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"train_set_fold_{i}.csv"), index=False) - val_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"val_set_fold_{i}.csv"), index=False) + train_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"train_set_fold_{i}.csv"), index=True, header=True) + val_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"val_set_fold_{i}.csv"), index=True, header=True) with open(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"held_out_ids.txt"), "a") as f: f.write(f"Fold {i}: {held_out_id}\n") # Save the test set - test_df.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet","folds", "test_set.csv"), index=False) + test_df.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet","folds", "test_set.csv"), index=True, header=True) print("Test dataset saved.") - # drop the label column from the train and validation sets - for i in range(k): - train_set = pd.read_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"train_set_fold_{i}.csv")) - val_set = pd.read_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"val_set_fold_{i}.csv")) - train_set = train_set.drop(columns=["binding_label"]) - val_set = val_set.drop(columns=["binding_label"]) - # drop nans - train_set = train_set.dropna() - val_set = val_set.dropna() - # save the train and validation sets - train_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"train_set_fold_{i}.csv"), index=True) - val_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"val_set_fold_{i}.csv"), index=True) + ################### Pep2Vec ################### + # # prepare data for pep2vec + # for i in range(k): + # train_set = pd.read_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"train_set_fold_{i}.csv")) + # val_set = pd.read_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"val_set_fold_{i}.csv")) + # train_set = train_set.drop(columns=["binding_label"]) + # val_set = val_set.drop(columns=["binding_label"]) + # + # # save the train and validation sets + # train_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"train_set_fold_{i}.csv"), index=True, header=True) + # val_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"val_set_fold_{i}.csv"), index=True, header=True) + # TODO write for loop for all folds # run Pep2Vec for fold 0 training set - os.system(f"./Pep2Vec/pep2vec.bin --dataset {os.path.join(os.path.dirname(__file__), 'data', 'Conbotnet', 'folds', 'train_set_fold_1.csv')} " + os.system(f"./Pep2Vec/pep2vec.bin --dataset {os.path.join(os.path.dirname(__file__), 'data', 'Conbotnet', 'folds', 'train_set_fold_0.csv')} " f"--output_location {os.path.join(output_dir, 'pep2vec_output_fold_0.parquet')} " f"--mhctype mhc2") + ############################################### + + # run SCQ_Autoencoder + # Load the parquet file generated by Pep2Vec + parquet_path = os.path.join(output_dir, f'pep2vec_output_fold_0.parquet') + print(f"Loading Pep2Vec embeddings from: {parquet_path}") + pep2vec_data = pd.read_parquet(parquet_path) + print(f"Pep2Vec data shape: {pep2vec_data.shape}") + + train_and_evaluate_scqvae(parquet_path) if __name__ == "__main__": main() \ No newline at end of file diff --git a/utils/model.py b/utils/model.py index 139352688..54dad2805 100644 --- a/utils/model.py +++ b/utils/model.py @@ -315,7 +315,7 @@ def call(self, inputs): # out = tf.nn.softmax(out) # Disable softmax for regression tasks # out = tf.nn.sigmoid(out) # mlp head - out = self.mlp_head1(out) + # out = self.mlp_head1(out) return out def layernorm(self, inputs): @@ -879,7 +879,7 @@ def call(self, inputs): # Higher perplexity means more uniform codebook usage perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) - return Zq, hard_indices, loss, perplexity # (B,N,embed_dim), #(B,N,num_embed), (1,), (1,) + return Zq, out_P_proj, loss, perplexity, hard_indices # (B,N,embed_dim), #(B,N,num_embed), (1,), (1,) def project_columns_to_simplex(self, P_sol): """Projects columns of a matrix to the probability simplex.""" @@ -961,66 +961,66 @@ def _reset_dead_codes(self, encoder_outputs): tf.ones_like(self.code_usage[dead_idx]) * 0.2) # Start with higher usage -class VQ_Layer(tf.keras.layers.Layer): - def __init__(self, embedding_dim, num_embeddings, beta, **kwargs): - super().__init__(**kwargs) - self.embedding_dim = embedding_dim - self.num_embeddings = num_embeddings - self.beta = beta - - w_init = tf.random_uniform_initializer() - self.embeddings = tf.Variable( - initial_value=w_init(shape=(self.num_embeddings, self.embedding_dim), dtype="float32"), - trainable=True, - name="embeddings_vq" - ) - - def call(self, inputs): - input_shape = tf.shape(inputs) - flat_inputs = tf.reshape(inputs, [-1, self.embedding_dim]) # (B*T, emb_dim) - - # Compute squared L2 distances - a_sq = tf.reduce_sum(flat_inputs ** 2, axis=1, keepdims=True) # (B*T, 1) - ab = 2 * tf.matmul(flat_inputs, tf.transpose(self.embeddings)) # (B*T, num_embeddings) - b_sq = tf.reduce_sum(self.embeddings ** 2, axis=1) # (num_embeddings,) - b_sq = tf.reshape(b_sq, [1, -1]) # (1, num_embeddings) - - distances = a_sq - ab + b_sq # (B*T, num_embeddings) - - # Find closest embeddings - encoding_indices = tf.argmin(distances, axis=1) - encodings = tf.one_hot(encoding_indices, self.num_embeddings) - quantized = tf.matmul(encodings, self.embeddings) - - # Reshape quantized values to match input shape - quantized = tf.reshape(quantized, input_shape) - - # Calculate VQ losses - straight-through estimator - commitment_loss = tf.reduce_mean(tf.square(tf.stop_gradient(quantized) - inputs)) - codebook_loss = tf.reduce_mean(tf.square(quantized - tf.stop_gradient(inputs))) - vq_loss = commitment_loss + self.beta * codebook_loss - - # Add loss to layer's loss collection - self.add_loss(vq_loss) - - # Straight-through estimator (copy gradients from quantized to inputs) - quantized = inputs + tf.stop_gradient(quantized - inputs) - - # Optionally compute perplexity - avg_probs = tf.reduce_mean(encodings, axis=0) - perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) - - indices_reshaped = tf.reshape(encoding_indices, input_shape[:-1]) - return quantized, indices_reshaped, perplexity - - def get_config(self): - config = super().get_config() - config.update({ - "embedding_dim": self.embedding_dim, - "num_embeddings": self.num_embeddings, - "beta": self.beta - }) - return config +# class VQ_Layer(tf.keras.layers.Layer): +# def __init__(self, embedding_dim, num_embeddings, beta, **kwargs): +# super().__init__(**kwargs) +# self.embedding_dim = embedding_dim +# self.num_embeddings = num_embeddings +# self.beta = beta +# +# w_init = tf.random_uniform_initializer() +# self.embeddings = tf.Variable( +# initial_value=w_init(shape=(self.num_embeddings, self.embedding_dim), dtype="float32"), +# trainable=True, +# name="embeddings_vq" +# ) +# +# def call(self, inputs): +# input_shape = tf.shape(inputs) +# flat_inputs = tf.reshape(inputs, [-1, self.embedding_dim]) # (B*T, emb_dim) +# +# # Compute squared L2 distances +# a_sq = tf.reduce_sum(flat_inputs ** 2, axis=1, keepdims=True) # (B*T, 1) +# ab = 2 * tf.matmul(flat_inputs, tf.transpose(self.embeddings)) # (B*T, num_embeddings) +# b_sq = tf.reduce_sum(self.embeddings ** 2, axis=1) # (num_embeddings,) +# b_sq = tf.reshape(b_sq, [1, -1]) # (1, num_embeddings) +# +# distances = a_sq - ab + b_sq # (B*T, num_embeddings) +# +# # Find closest embeddings +# encoding_indices = tf.argmin(distances, axis=1) +# encodings = tf.one_hot(encoding_indices, self.num_embeddings) +# quantized = tf.matmul(encodings, self.embeddings) +# +# # Reshape quantized values to match input shape +# quantized = tf.reshape(quantized, input_shape) +# +# # Calculate VQ losses - straight-through estimator +# commitment_loss = tf.reduce_mean(tf.square(tf.stop_gradient(quantized) - inputs)) +# codebook_loss = tf.reduce_mean(tf.square(quantized - tf.stop_gradient(inputs))) +# vq_loss = commitment_loss + self.beta * codebook_loss +# +# # Add loss to layer's loss collection +# self.add_loss(vq_loss) +# +# # Straight-through estimator (copy gradients from quantized to inputs) +# quantized = inputs + tf.stop_gradient(quantized - inputs) +# +# # Optionally compute perplexity +# avg_probs = tf.reduce_mean(encodings, axis=0) +# perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) +# +# indices_reshaped = tf.reshape(encoding_indices, input_shape[:-1]) +# return quantized, indices_reshaped, perplexity +# +# def get_config(self): +# config = super().get_config() +# config.update({ +# "embedding_dim": self.embedding_dim, +# "num_embeddings": self.num_embeddings, +# "beta": self.beta +# }) +# return config # Helper function for convolutional blocks @@ -1125,7 +1125,7 @@ def call(self, inputs, training=False): x_bottleneck = self.bottleneck(self.pool4(x4)) # --- Vector Quantization --- - quantized, indices, vq_loss, perplexity = self.vq_layer(x_bottleneck) + quantized, indices, vq_loss, perplexity, hard_indices = self.vq_layer(x_bottleneck) # --- Decoding --- y = self.up4_trans(quantized) @@ -1143,7 +1143,7 @@ def call(self, inputs, training=False): output = self.output_layer(y) vq_loss = tf.add_n(self.vq_layer.losses) if self.vq_layer.losses else tf.constant(0.0) - return output, quantized, indices, vq_loss, perplexity + return output, quantized, indices, vq_loss, perplexity, hard_indices @property def metrics(self): @@ -1162,14 +1162,14 @@ def train_step(self, data): x = y = data with tf.GradientTape() as tape: - reconstruction, quantized, indices, vq_loss, perplexity = self(x, training=True) + reconstruction, quantized, indices, vq_loss, perplexity, hard_indices = self(x, training=True) # Basic reconstruction loss recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) # Add feature matching loss by comparing intermediate features with tape.stop_recording(): - _, mid_features, _, _, _ = self(reconstruction, training=False) + _, mid_features, _, _, _, _ = self(reconstruction, training=False) orig_mid_features = quantized # Feature matching loss to maintain semantic information @@ -1216,7 +1216,7 @@ def test_step(self, data): else: x = y = data - reconstruction, _, _, vq_loss, perplexity = self(x, training=False) + reconstruction, _, _, vq_loss, perplexity, hard_indices = self(x, training=False) recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) total_loss = recon_loss + vq_loss + self.commitment_beta * tf.reduce_mean( tf.math.squared_difference(x, reconstruction)) From 66d47117801107eeecc794b21882ee98423d6bc4 Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 24 Apr 2025 15:33:33 +0200 Subject: [PATCH 19/83] handling ConvNeXT --- run_pep2vec.py | 287 ++++++++++++++++++++++++++++++++++++------------- 1 file changed, 215 insertions(+), 72 deletions(-) diff --git a/run_pep2vec.py b/run_pep2vec.py index 2163e9879..5aa349cbe 100644 --- a/run_pep2vec.py +++ b/run_pep2vec.py @@ -24,94 +24,237 @@ def select_columns(df, columns): print("Selected columns:", columns) return df[columns] -def main(): + +# def get_netmhcpan_allele(allele, netmhcpan_dataset=None, allele_cache={}): +# """ +# Get the allele from the sequence in NetMHCpan dataset. +# Returns the allele with the highest sequence similarity. +# +# Parameters: +# ----------- +# allele : str or list +# Allele(s) to format and match in NetMHCpan format +# netmhcpan_dataset : pd.DataFrame, optional +# Pre-loaded NetMHCpan dataset to avoid repeated file reading +# allele_cache : dict, optional +# Cache of previously processed alleles +# +# Returns: +# -------- +# str or dict +# Matching allele(s) in NetMHCpan format +# """ +# # Check if we're processing a single allele or multiple alleles +# if isinstance(allele, list) or isinstance(allele, np.ndarray): +# # Process unique alleles and create a mapping +# unique_alleles = set(allele) +# allele_map = {} +# for a in unique_alleles: +# allele_map[a] = get_netmhcpan_allele(a, netmhcpan_dataset, allele_cache) +# return allele_map +# +# # Check if this allele is already in cache +# if allele in allele_cache: +# return allele_cache[allele] +# +# # Load dataset if not provided +# if netmhcpan_dataset is None: +# netmhcpan_dataset = pd.read_csv("data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv") +# +# # Format allele name to NetMHCpan format +# formatted_allele = format_allele(allele) +# +# # First, try exact match (case-insensitive) +# exact_matches = netmhcpan_dataset[netmhcpan_dataset['allele'].str.lower() == formatted_allele.lower()] +# +# if not exact_matches.empty: +# result = exact_matches.iloc[0]['allele'] +# else: +# # If no exact match, try partial match +# partial_matches = netmhcpan_dataset[netmhcpan_dataset['allele'].str.contains(formatted_allele, case=False)] +# +# if not partial_matches.empty: +# result = partial_matches.iloc[0]['allele'] +# else: +# # If no match at all, report and use formatted allele +# print(f"No match found for allele: {allele} (formatted as {formatted_allele})") +# result = formatted_allele +# +# # Cache the result +# allele_cache[allele] = result +# return result +# +# def format_allele(allele): +# """Helper function to format allele names to NetMHCpan format""" +# # Format DRB alleles (like DRB11402 to DRB1*14:02) +# if allele.startswith('DRB') and not '-' in allele: +# locus = allele[:4] +# allele_num = allele[4:] +# if len(allele_num) >= 4: +# return f"{locus}*{allele_num[:2]}:{allele_num[2:]}" +# +# # Format MHC-II heterodimers (like HLA-DQA10501-DQB10301 to HLA-DQA1*05:01-DQB1*03:01) +# elif '-' in allele and not '*' in allele: +# parts = allele.split('-') +# if len(parts) == 2 and '-' in parts[1]: # Handle cases with another hyphen +# prefix, alpha_beta = parts +# alpha, beta = alpha_beta.split('-') +# +# # Format alpha and beta chains +# alpha = format_chain(alpha) +# beta = format_chain(beta) +# +# return f"{prefix}-{alpha}-{beta}" +# elif len(parts) == 3: # Format like HLA-DQA10501-DQB10301 +# prefix, alpha, beta = parts +# +# # Format alpha and beta chains +# alpha = format_chain(alpha) +# beta = format_chain(beta) +# +# return f"{prefix}-{alpha}-{beta}" +# +# # Default case - return allele as is +# return allele +# +# def format_chain(chain): +# """Format an MHC chain like DQA10501 to DQA1*05:01""" +# if len(chain) >= 7: # e.g., DQA10501 +# locus = chain[:4] +# num = chain[4:] +# return f"{locus}*{num[:2]}:{num[2:]}" +# return chain + +def main(dataset_name="Conbotnet", mhc_type="mhc2"): # Conbotnet dataset paths # ConBotNet only contains mhc class II - train_dataset_path = os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "train.csv") - test_dataset_path = os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "test_all.csv") - output_dir = os.path.join(os.path.dirname(__file__), "data", "Pep2Vec", "Conbotnet") + + # Setup paths + base_dir = os.path.dirname(__file__) + data_dir = os.path.join(base_dir, "data") + conbotnet_dir = os.path.join(data_dir, dataset_name) + folds_dir = os.path.join(conbotnet_dir, "folds") + output_dir = os.path.join(data_dir, "Pep2Vec", dataset_name) + + # Create directories os.makedirs(output_dir, exist_ok=True) + os.makedirs(folds_dir, exist_ok=True) + + # Define datasets + paths = { + 'train': os.path.join(conbotnet_dir, "train.csv"), + 'test': os.path.join(conbotnet_dir, "test_all.csv") + } + + # Column configuration + columns = ["allele", "long_mer", "binding_label"] + rename_map = {"allele": "allotype", "long_mer": "peptide"} + + # Load and process datasets + datasets = {} + for name, path in paths.items(): + df = load_data(path) + print(f"{name.capitalize()} dataset shape: {df.shape}") + + # Process dataframe + df = (select_columns(df, columns) + .rename(columns=rename_map) + .drop_duplicates(subset=["allotype", "peptide"]) + .dropna()) - # Load datasets - train_df = load_data(train_dataset_path) - test_df = load_data(test_dataset_path) - print("Train dataset shape:", train_df.shape) - print("Test dataset shape:", test_df.shape) - # Select relevant columns - train_df = select_columns(train_df, ["allele", "long_mer", "binding_label"]) - test_df = select_columns(test_df, ["allele", "long_mer", "binding_label"]) - print("Train dataset shape after column selection:", train_df.shape) - print("Test dataset shape after column selection:", test_df.shape) - - # Rename columns - train_df = train_df.rename(columns={"allele": "allotype", "long_mer": "peptide", "binding_label": "binding_label"}) - test_df = test_df.rename(columns={"allele": "allotype", "long_mer": "peptide", "binding_label": "binding_label"}) - - # Remove duplicates - train_df = train_df.drop_duplicates(subset=["allotype", "peptide"]) - test_df = test_df.drop_duplicates(subset=["allotype", "peptide"]) - - # Remove rows with NaN values - train_df = train_df.dropna() - test_df = test_df.dropna() - print("Train dataset shape after removing duplicates and NaN values:", train_df.shape) - print("Test dataset shape after removing duplicates and NaN values:", test_df.shape) + print(f"{name.capitalize()} dataset shape after processing: {df.shape}") + datasets[name] = df + + # # change the allele names to the ones in the NetMHCpan dataset + # # Load the NetMHCpan dataset once + # netmhcpan_dataset = pd.read_csv("data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv") + # # Create a shared cache for alleles + # allele_cache = {} + # + # # Apply to train and test datasets with shared resources + # datasets['train']['allotype'] = datasets['train']['allotype'].apply( + # lambda x: get_netmhcpan_allele(x, netmhcpan_dataset, allele_cache)) + # datasets['test']['allotype'] = datasets['test']['allotype'].apply( + # lambda x: get_netmhcpan_allele(x, netmhcpan_dataset, allele_cache)) # Create k-fold cross-validation splits k = 5 folds = create_k_fold_leave_one_out_stratified_cross_validation( - train_df, k=k, target_col="binding_label", id_col="allotype", train_size=0.8, subset_prop=0.1 + datasets['train'], k=k, target_col="binding_label", + id_col="allotype", train_size=0.8, subset_prop=0.1 ) - # Unpack the folds to get train and validation sets - train_dfs = [fold[0] for fold in folds] - val_dfs = [fold[1] for fold in folds] - held_out_id = [fold[2] for fold in folds] - - print("Number of training sets:", len(train_dfs)) - print("Number of validation sets:", len(val_dfs)) - # TODO Fix later, why header is not saved after the first fold - # mkdir folds - os.makedirs(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds"), exist_ok=True) - if os.path.exists(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", "held_out_ids.txt")): - os.remove(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", "held_out_ids.txt")) - - for i, (train_set, val_set, held_out_id) in enumerate(zip(train_dfs, val_dfs, held_out_id)): - train_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"train_set_fold_{i}.csv"), index=True, header=True) - val_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"val_set_fold_{i}.csv"), index=True, header=True) - with open(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"held_out_ids.txt"), "a") as f: + + # Clear previous held_out_ids file if it exists + held_out_ids_path = os.path.join(folds_dir, "held_out_ids.txt") + if os.path.exists(held_out_ids_path): + os.remove(held_out_ids_path) + + # Save folds + for i, (train_set, val_set, held_out_id) in enumerate(folds): + # only keep the allele and peptide columns + train_set = train_set[["allotype", "peptide"]] + val_set = val_set[["allotype", "peptide"]] + # drop nan and duplicates + train_set = train_set.dropna().drop_duplicates(subset=["allotype", "peptide"]) + val_set = val_set.dropna().drop_duplicates(subset=["allotype", "peptide"]) + # TODO find a better solution later - pep2vec can't handle long peptides longer than ~25 might work upto 29 + train_set = train_set[train_set["peptide"].str.len() <= 25] + val_set = val_set[val_set["peptide"].str.len() <= 25] + + # reset the index + train_set.reset_index(drop=True, inplace=True) + val_set.reset_index(drop=True, inplace=True) + with open(os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"train_set_fold_{i}.csv"), mode="w", encoding="utf-8") as train_file: + train_set.to_csv(train_file, sep=",", index=True, header=True) + with open(os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"val_set_fold_{i}.csv"), mode="w", encoding="utf-8") as val_file: + val_set.to_csv(val_file, sep=",", index=True, header=True) + with open(held_out_ids_path, "a") as f: f.write(f"Fold {i}: {held_out_id}\n") # Save the test set - test_df.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet","folds", "test_set.csv"), index=True, header=True) + datasets['test'].to_csv(os.path.join(folds_dir, "test_set.csv"), index=False, header=True) print("Test dataset saved.") ################### Pep2Vec ################### - # # prepare data for pep2vec - # for i in range(k): - # train_set = pd.read_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"train_set_fold_{i}.csv")) - # val_set = pd.read_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"val_set_fold_{i}.csv")) - # train_set = train_set.drop(columns=["binding_label"]) - # val_set = val_set.drop(columns=["binding_label"]) - # - # # save the train and validation sets - # train_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"train_set_fold_{i}.csv"), index=True, header=True) - # val_set.to_csv(os.path.join(os.path.dirname(__file__), "data", "Conbotnet", "folds", f"val_set_fold_{i}.csv"), index=True, header=True) - - # TODO write for loop for all folds - # run Pep2Vec for fold 0 training set - os.system(f"./Pep2Vec/pep2vec.bin --dataset {os.path.join(os.path.dirname(__file__), 'data', 'Conbotnet', 'folds', 'train_set_fold_0.csv')} " - f"--output_location {os.path.join(output_dir, 'pep2vec_output_fold_0.parquet')} " - f"--mhctype mhc2") - ############################################### + # TODO pep2vec fails for some alleles, need to check the error + # split each file to subsets for each unique allele and run pep2vec + # create tmp directory + # os.makedirs(os.path.join(output_dir, "tmp"), exist_ok=True) + # unique_alleles = datasets['train']['allotype'].unique() + # for allele in unique_alleles: + # allele_df = datasets['train'][datasets['train']['allotype'] == allele] + # allele_df.to_csv(os.path.join(output_dir, "tmp", f"pep2vec_input_{allele}.csv"), index=False, header=True) + # # run pep2vec for each allele + # failed_alleles_file = os.path.join(output_dir, "failed_alleles.txt") + # for allele in unique_alleles: + # try: + # input_file = os.path.join(output_dir,"tmp", f"pep2vec_input_{allele}.csv") + # output_file = os.path.join(output_dir, f"pep2vec_output_{allele}.parquet") + # exit_code = os.system( + # f"./Pep2Vec/pep2vec.bin --num_processes 20 --num_threads 10 --dataset {input_file} --output_location {output_file} --mhctype {mhc_type}") + # if exit_code != 0: + # with open(failed_alleles_file, "a") as f: + # f.write(f"{allele}\n") + # print(f"Failed to process allele: {allele}") + # except Exception as e: + # with open(failed_alleles_file, "a") as f: + # f.write(f"{allele} (Error: {str(e)})\n") + # print(f"Error processing allele {allele}: {str(e)}") - # run SCQ_Autoencoder - # Load the parquet file generated by Pep2Vec - parquet_path = os.path.join(output_dir, f'pep2vec_output_fold_0.parquet') - print(f"Loading Pep2Vec embeddings from: {parquet_path}") - pep2vec_data = pd.read_parquet(parquet_path) - print(f"Pep2Vec data shape: {pep2vec_data.shape}") + for i in range(k): + train_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"train_set_fold_{i}.csv") + output_file = os.path.join(output_dir, f"pep2vec_output_fold_{i}.parquet") + os.system(f"./Pep2Vec/pep2vec.bin --num_processes 20 --num_threads 10 --dataset {train_file} --output_location {output_file} --mhctype {mhc_type}") + validation_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"val_set_fold_{i}.csv") + output_file = os.path.join(output_dir, f"pep2vec_output_val_fold_{i}.parquet") + os.system(f"./Pep2Vec/pep2vec.bin --num_processes 20 --num_threads 10 --dataset {validation_file} --output_location {output_file} --mhctype {mhc_type}") + # test set + test_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", "test_set.csv") + output_file = os.path.join(output_dir, f"pep2vec_output_test_fold_{i}.parquet") + os.system(f"./Pep2Vec/pep2vec.bin --num_processes 20 --num_threads 10 --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") + ############################################### - train_and_evaluate_scqvae(parquet_path) if __name__ == "__main__": - main() \ No newline at end of file + main("Conbotnet", "mhc2") + main("ConvNeXT-MHC", "mhc1") From 170c2f53053d9bdb90a1c55ba3db232c1d1bb927 Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 24 Apr 2025 17:25:51 +0200 Subject: [PATCH 20/83] changing to a simpler dense network, enhance model architecture, improve codebook initialization, and adjust training parameters --- run_pMHC_DL.py | 254 ++++++----------------- utils/model.py | 535 ++++++++++++++++++------------------------------- 2 files changed, 265 insertions(+), 524 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index cf155b2b3..d28330fb5 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -1,13 +1,14 @@ -'''import os -import json + +import os +import tensorflow as tf import numpy as np import pandas as pd -import tensorflow as tf +import time import matplotlib.pyplot as plt -from sklearn.model_selection import KFold -from utils.model import SCQ_model -import keras - +from sklearn.model_selection import train_test_split +from sklearn.cluster import KMeans +from utils.model import SCQ1DAutoEncoder +''' # Set TensorFlow logging level for more information tf.get_logger().setLevel('INFO') @@ -917,25 +918,27 @@ def run_scq_pipeline(data_path, output_dir="test_tmp", run_param_search=True, def train_and_evaluate_scqvae( data_path, num_embeddings=32, - embedding_dim=32, - batch_size=1, - epochs=10, - learning_rate=1e-4, + embedding_dim=64, # Increased from 32 + batch_num=32, # Increased from 1 + epochs=20, # Increased from 10 + learning_rate=1e-3, # Adjusted from 1e-4 commitment_beta=0.25, - output_dir='vqvae_output', + output_dir='data/SCQvae', visualize=True, save_model=True, random_state=42, - test_size=0.2 + test_size=0.2, + return_quantize_whole_dataset=False, + **kwargs ): """ - Train and evaluate a VQ-VAE model on peptide embedding data. + Train and evaluate a VQ-VAE model on peptide embedding data with improved codebook utilization. Args: data_path: Path to the parquet file containing peptide embeddings num_embeddings: Number of clusters/codes in the codebook embedding_dim: Dimension of each codebook vector - batch_size: Batch size for training + batch_num: Batch size for training epochs: Number of training epochs learning_rate: Learning rate for the optimizer commitment_beta: Beta parameter for commitment loss @@ -950,20 +953,11 @@ def train_and_evaluate_scqvae( history: Training history latent_data: Dictionary containing latent representations and indices """ - import os - import tensorflow as tf - import numpy as np - import pandas as pd - import time - import matplotlib.pyplot as plt - from sklearn.model_selection import train_test_split - from utils.model import SCQ1DAutoEncoder - # Create output directory os.makedirs(output_dir, exist_ok=True) # --- Helper Functions --- - def create_dataset(X, batch_size=4, is_training=True): + def create_dataset(X, batch_size=32, is_training=True): """Create a TensorFlow dataset from input array X.""" dataset = tf.data.Dataset.from_tensor_slices(X) if is_training: @@ -974,29 +968,25 @@ def create_dataset(X, batch_size=4, is_training=True): def load_data(data_path, test_size=0.2, random_state=42): """Load and prepare data for training.""" - # Load data embeddings = pd.read_parquet(data_path) - - # Select the latent columns latent_columns = [col for col in embeddings.columns if 'latent' in col] print(f"Found {len(latent_columns)} latent columns") - - # Extract values and reshape X = embeddings[latent_columns].values seq_length = len(latent_columns) - feature_dim = 1 - X = X.reshape(-1, seq_length, feature_dim) - - # Split into train and test sets + X = X.reshape(-1, seq_length) X_train, X_test = train_test_split(X, test_size=test_size, random_state=random_state) + return X_train, X_test, seq_length - return X_train, X_test, seq_length, feature_dim + def initialize_codebook_with_kmeans(X_train, num_embeddings, embedding_dim): + """Initialize codebook vectors using k-means clustering.""" + kmeans = KMeans(n_clusters=num_embeddings, random_state=random_state) + flat_data = X_train.reshape(-1, X_train.shape[-1]) + kmeans.fit(flat_data) + return kmeans.cluster_centers_.astype(np.float32) def plot_training_metrics(history, save_path=None): """Plot the training metrics over epochs.""" fig, axes = plt.subplots(4, 1, figsize=(12, 20), sharex=True) - - # Plot total loss axes[0].plot(history.history['total_loss'], 'b-', label='Train') if 'val_total_loss' in history.history: axes[0].plot(history.history['val_total_loss'], 'r-', label='Validation') @@ -1005,7 +995,6 @@ def plot_training_metrics(history, save_path=None): axes[0].grid(True) axes[0].legend() - # Plot reconstruction loss axes[1].plot(history.history['recon_loss'], 'b-', label='Train') if 'val_recon_loss' in history.history: axes[1].plot(history.history['val_recon_loss'], 'r-', label='Validation') @@ -1014,7 +1003,6 @@ def plot_training_metrics(history, save_path=None): axes[1].grid(True) axes[1].legend() - # Plot VQ loss axes[2].plot(history.history['vq_loss'], 'b-', label='Train') if 'val_vq_loss' in history.history: axes[2].plot(history.history['val_vq_loss'], 'r-', label='Validation') @@ -1023,7 +1011,6 @@ def plot_training_metrics(history, save_path=None): axes[2].grid(True) axes[2].legend() - # Plot perplexity axes[3].plot(history.history['perplexity'], 'b-', label='Train') if 'val_perplexity' in history.history: axes[3].plot(history.history['val_perplexity'], 'r-', label='Validation') @@ -1045,20 +1032,15 @@ def plot_reconstructions(original, reconstructed, n_samples=5, save_path=None): """Plot comparison between original and reconstructed sequences.""" n_samples = min(n_samples, len(original)) plt.figure(figsize=(15, 3 * n_samples)) - for i in range(n_samples): - # Plot original sequence plt.subplot(n_samples, 2, 2 * i + 1) - plt.plot(original[i, :, 0]) # Assuming last dim is feature dim with size 1 + plt.plot(original[i]) plt.title(f"Original Sequence {i + 1}") plt.grid(True) - - # Plot reconstructed sequence plt.subplot(n_samples, 2, 2 * i + 2) - plt.plot(reconstructed[i, :, 0]) # Assuming same shape as original + plt.plot(reconstructed[i]) plt.title(f"Reconstructed Sequence {i + 1}") plt.grid(True) - plt.tight_layout() if save_path: plt.savefig(save_path) @@ -1068,262 +1050,158 @@ def plot_reconstructions(original, reconstructed, n_samples=5, save_path=None): plt.close() def plot_codebook_usage(indices, num_embeddings, save_path=None): - """ - Visualize the usage distribution of codebook vectors. - """ - # Convert to numpy if it's a tensor + """Visualize the usage distribution of codebook vectors.""" if isinstance(indices, tf.Tensor): indices = indices.numpy() - - # Flatten the indices if they're not already flattened flat_indices = indices.flatten() - - # Check if we need to quantize float values to discrete indices if np.issubdtype(flat_indices.dtype, np.floating): print(f"Detected floating point indices, quantizing to {num_embeddings} discrete values") - min_val = np.min(flat_indices) - max_val = np.max(flat_indices) + min_val, max_val = np.min(flat_indices), np.max(flat_indices) print(f"Index range: {min_val} to {max_val}") - - # Create quantization bins bins = np.linspace(min_val, max_val, num_embeddings + 1) - - # Digitize the indices (assign each to a bin) discrete_indices = np.digitize(flat_indices, bins) - 1 + flat_indices = np.clip(discrete_indices, 0, num_embeddings - 1) - # Clip to ensure valid range - discrete_indices = np.clip(discrete_indices, 0, num_embeddings - 1) - flat_indices = discrete_indices - - # Count occurrences of each codebook vector unique, counts = np.unique(flat_indices, return_counts=True) - - # Create a complete distribution including zeros for unused vectors full_distribution = np.zeros(num_embeddings) for idx, count in zip(unique, counts): if 0 <= idx < num_embeddings: full_distribution[int(idx)] = count - # Calculate usage statistics used_vectors = np.sum(full_distribution > 0) usage_percentage = (used_vectors / num_embeddings) * 100 - # Create the figure plt.figure(figsize=(12, 6)) - - # Create bar plot bar_positions = np.arange(num_embeddings) bars = plt.bar(bar_positions, full_distribution) - - # Add a color gradient based on frequency max_count = np.max(full_distribution) - if max_count > 0: # Avoid division by zero + if max_count > 0: for i, bar in enumerate(bars): intensity = full_distribution[i] / max_count bar.set_color(plt.cm.viridis(intensity)) - # Add labels and title plt.xlabel('Codebook Vector Index') plt.ylabel('Usage Count') plt.title(f'Codebook Vector Usage Distribution\n{used_vectors}/{num_embeddings} vectors used ({usage_percentage:.1f}%)') - - # Add grid for better readability plt.grid(axis='y', linestyle='--', alpha=0.7) - - # Add a colorbar as a usage intensity reference sm = plt.cm.ScalarMappable(cmap=plt.cm.viridis, norm=plt.Normalize(0, max_count)) sm.set_array([]) cbar = plt.colorbar(sm) cbar.set_label('Frequency') - - # Improve layout plt.tight_layout() - # Save the plot if save_path: plt.savefig(save_path) - - # Display statistics - print(f"Codebook usage statistics:") - print(f"- Total vectors in codebook: {num_embeddings}") - print(f"- Number of vectors used: {used_vectors} ({usage_percentage:.1f}%)") - if used_vectors > 0: - print(f"- Most used vector: {np.argmax(full_distribution)} (used {np.max(full_distribution)} times)") - used_indices = np.where(full_distribution > 0)[0] - min_used_idx = used_indices[np.argmin(full_distribution[used_indices])] - print(f"- Least used vector: {min_used_idx} (used {full_distribution[min_used_idx]} times)") - + print(f"Codebook usage: {used_vectors}/{num_embeddings} vectors used ({usage_percentage:.1f}%)") if visualize: plt.show() else: plt.close() - return used_vectors, usage_percentage # --- Main Pipeline --- print("Loading/Generating Training Data...") - train_data, test_data, seq_length, feature_dim = load_data( - data_path, test_size=test_size, random_state=random_state - ) + train_data, test_data, seq_length = load_data(data_path, test_size=test_size, random_state=random_state) - # Create tf.data Datasets for efficient training + # Initialize codebook with k-means + print("Initializing codebook with k-means...") + initial_codebook = initialize_codebook_with_kmeans(train_data, num_embeddings, seq_length) + + # Create datasets print("Creating TensorFlow Datasets...") - train_dataset = create_dataset(train_data, batch_size=batch_size, is_training=True) - val_dataset = create_dataset(test_data, batch_size=batch_size, is_training=False) + train_dataset = create_dataset(train_data, batch_size=batch_num, is_training=True) + val_dataset = create_dataset(test_data, batch_size=batch_num, is_training=False) print("Datasets created.") # --- Model Instantiation --- print("Building the SCQ1DAutoEncoder model...") - input_shape = (seq_length, feature_dim) - + input_shape = (seq_length,) model = SCQ1DAutoEncoder( input_dim=input_shape, num_embeddings=num_embeddings, embedding_dim=embedding_dim, commitment_beta=commitment_beta, + scq_params={ + 'lambda_reg': 1.0, # Increased regularization + 'discrete_loss': True, # Use discrete loss + 'reset_dead_codes': True, # Reset underused vectors + 'usage_threshold': 1e-4, # Lower threshold + 'reset_interval': 5 # Frequent resets + }, + initial_codebook=initial_codebook # Pass k-means initialized codebook ) print("Model built.") - # --- Compile and Train the Model --- + # --- Compile and Train --- print("Compiling the model...") model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate)) print("Model compiled.") - # --- Training --- print(f"Starting training for {epochs} epochs...") start_time = time.time() - history = model.fit( train_dataset, epochs=epochs, validation_data=val_dataset ) - end_time = time.time() print(f"\nTraining finished in {end_time - start_time:.2f} seconds.") # --- Evaluation and Visualization --- if visualize: - # Plot training metrics print("\nPlotting training history...") - plot_training_metrics( - history, - save_path=os.path.join(output_dir, 'vqvae_training_metrics.png') - ) - - # Example inference - print("\nPerforming example inference on validation data...") + plot_training_metrics(history, save_path=os.path.join(output_dir, 'vqvae_training_metrics.png')) + print("\nPerforming example inference...") example_batch = next(iter(val_dataset)) output = model(example_batch, training=False) reconstruction, quantized_latent, cluster_indices, vq_loss, perplexity, hard_indices = output - - # Plot reconstructions print("\nVisualizing reconstructions...") - plot_reconstructions( - example_batch.numpy(), - reconstruction.numpy(), - save_path=os.path.join(output_dir, 'vqvae_reconstructions.png') - ) - - # Plot codebook usage + plot_reconstructions(example_batch.numpy(), reconstruction.numpy(), save_path=os.path.join(output_dir, 'vqvae_reconstructions.png')) print("\nAnalyzing codebook usage...") - plot_codebook_usage( - hard_indices, - num_embeddings, - save_path=os.path.join(output_dir, 'codebook_usage.png') - ) + plot_codebook_usage(hard_indices, num_embeddings, save_path=os.path.join(output_dir, 'codebook_usage.png')) - # --- Save the model --- + # --- Save Model --- if save_model: model_dir = os.path.join(output_dir, 'model') os.makedirs(model_dir, exist_ok=True) model.save_weights(os.path.join(model_dir, 'vqvae_model_weights.h5')) print(f"\nModel weights saved to '{os.path.join(model_dir, 'vqvae_model_weights.h5')}'") - # --- Extract and save latent space --- + # --- Extract Latent Space --- print("\nExtracting quantized latent space...") - whole_dataset = tf.data.Dataset.concatenate(train_dataset, val_dataset) - quantized_latents = [] - cluster_indices_all = [] - hard_indices_all = [] - + if return_quantize_whole_dataset: + whole_dataset = tf.data.Dataset.concatenate(train_dataset, val_dataset) + else: + whole_dataset = val_dataset + quantized_latents, cluster_indices_all, hard_indices_all = [], [], [] for batch in whole_dataset: output, q_latent, indices, _, _, hard_indices = model(batch, training=False) quantized_latents.append(q_latent.numpy()) cluster_indices_all.append(indices.numpy()) hard_indices_all.append(hard_indices.numpy()) - quantized_latent = np.concatenate(quantized_latents, axis=0) cluster_indices = np.concatenate(cluster_indices_all, axis=0) hard_indices = np.concatenate(hard_indices_all, axis=0) - - # Save latent representations np.save(os.path.join(output_dir, 'quantized_latent.npy'), quantized_latent) np.save(os.path.join(output_dir, 'cluster_indices.npy'), cluster_indices) np.save(os.path.join(output_dir, 'hard_indices.npy'), hard_indices) print(f"Latent representations saved to {output_dir}") - # --- Optional UMAP visualization --- - if visualize: - try: - import umap - print("\nComputing UMAP projection...") - - # Flatten and reshape for UMAP - hard_indices_flat = hard_indices.flatten().reshape(-1, 1) - - # Compute 1D UMAP projection - mapper_1d = umap.UMAP(n_components=1, n_neighbors=15, min_dist=0.1, - metric='euclidean', random_state=random_state) - embedding_1d = mapper_1d.fit_transform(hard_indices_flat) - - # Create sample IDs for visualization - sample_ids = [] - sample_counter = 0 - for batch in val_dataset: - batch_size = batch.shape[0] - for i in range(batch_size): - sample_ids.extend([sample_counter] * seq_length) - sample_counter += 1 - sample_ids = np.array(sample_ids) - - # Visualize 1D UMAP - plt.figure(figsize=(12, 4)) - y_jitter = np.random.rand(embedding_1d.shape[0]) * 0.1 - scatter_1d = plt.scatter(embedding_1d[:, 0], y_jitter, - c=sample_ids[:embedding_1d.shape[0]], - cmap='tab20', s=10, alpha=0.7) - plt.colorbar(scatter_1d, label='Sample ID') - plt.title('1D UMAP Projection of Latent Space', fontsize=14) - plt.xlabel('UMAP Dimension 1', fontsize=12) - plt.yticks([]) - plt.grid(axis='x', linestyle='--', alpha=0.6) - plt.savefig(os.path.join(output_dir, 'umap_projection.png')) - if visualize: - plt.show() - else: - plt.close() - except ImportError: - print("UMAP not installed. Skipping UMAP visualization.") - - # Return results latent_data = { 'quantized_latent': quantized_latent, 'cluster_indices': cluster_indices, 'hard_indices': hard_indices } - return model, history, latent_data -# Example usage: if __name__ == "__main__": model, history, latent_data = train_and_evaluate_scqvae( data_path="data/Pep2Vec/Conbotnet/pep2vec_output_fold_0.parquet", - num_embeddings=32, + num_embeddings=8, embedding_dim=32, - batch_size=1, + batch_num=8, epochs=10, - output_dir="vqvae_results" + output_dir="data/SCQvae/Conbotnet", ) # # Create a 1D UMAP projection colored by cluster indices diff --git a/utils/model.py b/utils/model.py index 54dad2805..6c8e9bdf9 100644 --- a/utils/model.py +++ b/utils/model.py @@ -1,7 +1,7 @@ -import numpy as np +# -*- coding: utf-8 -*- import tensorflow as tf -import keras -from keras import layers +from tensorflow import keras +from tensorflow.keras import layers # ------------------------------ @@ -691,33 +691,73 @@ def create_dataset(X, batch_size=1, is_training=True): # print("Input and output arrays saved as 'input_data.npy' and 'output_data.npz'.") # print("Shape of model outputs:", np.vstack(pj_outputs).shape) ''' +# class VQ_Layer(tf.keras.layers.Layer): +# def __init__(self, embedding_dim, num_embeddings, beta, **kwargs): +# super().__init__(**kwargs) +# self.embedding_dim = embedding_dim +# self.num_embeddings = num_embeddings +# self.beta = beta +# +# w_init = tf.random_uniform_initializer() +# self.embeddings = tf.Variable( +# initial_value=w_init(shape=(self.num_embeddings, self.embedding_dim), dtype="float32"), +# trainable=True, +# name="embeddings_vq" +# ) +# +# def call(self, inputs): +# input_shape = tf.shape(inputs) +# flat_inputs = tf.reshape(inputs, [-1, self.embedding_dim]) # (B*T, emb_dim) +# +# # Compute squared L2 distances +# a_sq = tf.reduce_sum(flat_inputs ** 2, axis=1, keepdims=True) # (B*T, 1) +# ab = 2 * tf.matmul(flat_inputs, tf.transpose(self.embeddings)) # (B*T, num_embeddings) +# b_sq = tf.reduce_sum(self.embeddings ** 2, axis=1) # (num_embeddings,) +# b_sq = tf.reshape(b_sq, [1, -1]) # (1, num_embeddings) +# +# distances = a_sq - ab + b_sq # (B*T, num_embeddings) +# +# # Find closest embeddings +# encoding_indices = tf.argmin(distances, axis=1) +# encodings = tf.one_hot(encoding_indices, self.num_embeddings) +# quantized = tf.matmul(encodings, self.embeddings) +# +# # Reshape quantized values to match input shape +# quantized = tf.reshape(quantized, input_shape) +# +# # Calculate VQ losses - straight-through estimator +# commitment_loss = tf.reduce_mean(tf.square(tf.stop_gradient(quantized) - inputs)) +# codebook_loss = tf.reduce_mean(tf.square(quantized - tf.stop_gradient(inputs))) +# vq_loss = commitment_loss + self.beta * codebook_loss +# +# # Add loss to layer's loss collection +# self.add_loss(vq_loss) +# +# # Straight-through estimator (copy gradients from quantized to inputs) +# quantized = inputs + tf.stop_gradient(quantized - inputs) +# +# # Optionally compute perplexity +# avg_probs = tf.reduce_mean(encodings, axis=0) +# perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) +# +# indices_reshaped = tf.reshape(encoding_indices, input_shape[:-1]) +# return quantized, indices_reshaped, perplexity +# +# def get_config(self): +# config = super().get_config() +# config.update({ +# "embedding_dim": self.embedding_dim, +# "num_embeddings": self.num_embeddings, +# "beta": self.beta +# }) +# return config -import tensorflow as tf -from tensorflow import keras -from tensorflow.keras import layers # original SCQ class SCQ_layer(layers.Layer): def __init__(self, num_embed, dim_embed, lambda_reg=0.5, proj_iter=10, - discrete_loss=False, beta_loss=0.25, reset_dead_codes=True, - usage_threshold=1e-3, reset_interval=10, **kwargs): - """ - Soft Convex Quantization (SCQ) layer. - - Args: - num_embed: Number of codebook vectors. - dim_embed: Embedding dimension (for both encoder and codebook). - lambda_reg: Regularization parameter in the SCQ objective. - proj_iter: Number of iterations for the iterative simplex projection. - discrete_loss: if True, commitment and codebook loss are calculated similar - to VQ-VAE loss, with stop-gradient operation. If False, only quantization error - is calculated as loss |Z_q - Z_e|**2 - beta_loss: A float to be used in VQ loss. Only used if discrete_loss==True. - multiplied to (1-b)*commitment_loss + b*codebook_loss - reset_dead_codes: Whether to reset dead codebook vectors - usage_threshold: Threshold below which a codebook vector is considered "dead" - reset_interval: Reset dead codes every this many calls to the layer - """ + discrete_loss=True, beta_loss=0.25, reset_dead_codes=True, + usage_threshold=1e-3, reset_interval=2, **kwargs): super().__init__(**kwargs) self.num_embed = num_embed self.dim_embed = dim_embed @@ -773,13 +813,6 @@ def build(self, input_shape): ) def call(self, inputs): - """ - Forward pass for SCQ. - Args: - inputs: Tensor of shape (B, N, dim_input) - Returns: - Quantized output: Tensor of shape (B, N, dim_embed) - """ # 1. Project inputs to the embedding space and apply layer normalization. x = tf.matmul(inputs, self.d_w) + self.d_b # (B, N, dim_embed) x = self.layernorm(x) @@ -825,10 +858,8 @@ def call(self, inputs): # 4. Project each column of P_sol onto the probability simplex. P_proj = self.project_columns_to_simplex(P_sol) # (num_embed, B*N) - # P_proj = tf.nn.softmax(P_sol, axis=0) out_P_proj = tf.transpose(P_proj) # (B*N, num_embed) out_P_proj = tf.reshape(out_P_proj, (input_shape[0], input_shape[1], -1)) # (B,N,num_embed) - # out_P_proj = tf.reduce_mean(out_P_proj, axis=-1, keepdims=True) #(B,N,1) # 5. Reconstruct quantized output: Z_q = C * P_proj. Zq_flat = tf.matmul(C, P_proj) # (dim_embed, B*N) @@ -869,246 +900,100 @@ def call(self, inputs): hard_indices = tf.argmax(out_P_proj, axis=-1) # (B,N) # 7. Calculate perplexity (similar to VQ layer) - # Reshape out_P_proj to simplify calculations flat_P_proj = tf.reshape(out_P_proj, [-1, self.num_embed]) # (B*N, num_embed) - - # Calculate average probability per codebook vector across batch avg_probs = tf.reduce_mean(flat_P_proj, axis=0) # (num_embed,) - - # Calculate perplexity: 2^(entropy) - # Higher perplexity means more uniform codebook usage perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) - return Zq, out_P_proj, loss, perplexity, hard_indices # (B,N,embed_dim), #(B,N,num_embed), (1,), (1,) + return Zq, out_P_proj, loss, perplexity, hard_indices def project_columns_to_simplex(self, P_sol): - """Projects columns of a matrix to the probability simplex.""" - # Transpose to work with rows instead of columns P_t = tf.transpose(P_sol) # (B*N, num_embed) - # Sort rows in descending order sorted_P = tf.sort(P_t, axis=1, direction='DESCENDING') - # Compute cumulative sums and thresholds cumsum = tf.cumsum(sorted_P, axis=1) k = tf.range(1, tf.shape(sorted_P)[1] + 1, dtype=tf.float32) thresholds = (cumsum - 1.0) / k - # Find maximum valid index per row (cast to int32 explicitly) valid_mask = sorted_P > thresholds max_indices = tf.argmax( tf.cast(valid_mask, tf.int32) * tf.range(tf.shape(sorted_P)[1], dtype=tf.int32), axis=1 ) - max_indices = tf.cast(max_indices, tf.int32) # Explicit cast to int32 - # Gather required cumulative sums + max_indices = tf.cast(max_indices, tf.int32) batch_indices = tf.range(tf.shape(P_t)[0], dtype=tf.int32) gather_indices = tf.stack([batch_indices, max_indices], axis=1) - # Rest of the code remains the same... selected_cumsum = tf.gather_nd(cumsum, gather_indices) theta = (selected_cumsum - 1.0) / tf.cast(max_indices + 1, tf.float32) - # Apply projection and transpose back P_projected = tf.nn.relu(P_t - theta[:, tf.newaxis]) return tf.transpose(P_projected) def layernorm(self, inputs): - """ - Custom layer normalization over the last dimension. - """ mean = tf.reduce_mean(inputs, axis=-1, keepdims=True) variance = tf.math.reduce_variance(inputs, axis=-1, keepdims=True) normed = (inputs - mean) / tf.sqrt(variance + self.epsilon) return self.gamma * normed + self.beta def _reset_dead_codes(self, encoder_outputs): - """ - Reset dead (unused) codebook vectors with improved strategy. - - Args: - encoder_outputs: Tensor of encoder outputs (B*N, dim_embed) - """ - # Find dead codes (those with usage below threshold) dead_codes = tf.where(self.code_usage < self.usage_threshold) num_dead = tf.shape(dead_codes)[0] - if num_dead > 0: tf.print(f"Resetting {num_dead} dead codebook vectors") - - # Identify most used codes most_used_idx = tf.argsort(self.code_usage, direction='DESCENDING')[:tf.maximum(3, num_dead)] most_used = tf.gather(tf.transpose(self.embed_w), most_used_idx) - - # Strategy: Use a mix of random encoder outputs and perturbations of most used vectors batch_size = tf.shape(encoder_outputs)[0] - for i in range(num_dead): dead_idx = tf.cast(dead_codes[i][0], tf.int32) - - if i % 2 == 0 and batch_size > 0: # Even indices: use encoder outputs + if i % 2 == 0 and batch_size > 0: random_idx = tf.random.uniform(shape=[], minval=0, maxval=batch_size, dtype=tf.int32) new_vector = encoder_outputs[random_idx] - else: # Odd indices: perturb most used vectors + else: source_idx = i % tf.shape(most_used)[0] source_vector = most_used[source_idx] - # Add significant noise to create meaningful variation noise = tf.random.normal(shape=tf.shape(source_vector), stddev=0.5) new_vector = source_vector + noise - # Normalize to maintain scale new_vector = new_vector / (tf.norm(new_vector) + 1e-8) * tf.norm(source_vector) - - # Update the embeddings at the dead code position self.embed_w[:, dead_idx].assign(tf.reshape(new_vector, [self.dim_embed])) - # Reset usage counter for the revived code - self.code_usage[dead_idx].assign( - tf.ones_like(self.code_usage[dead_idx]) * 0.2) # Start with higher usage - - -# class VQ_Layer(tf.keras.layers.Layer): -# def __init__(self, embedding_dim, num_embeddings, beta, **kwargs): -# super().__init__(**kwargs) -# self.embedding_dim = embedding_dim -# self.num_embeddings = num_embeddings -# self.beta = beta -# -# w_init = tf.random_uniform_initializer() -# self.embeddings = tf.Variable( -# initial_value=w_init(shape=(self.num_embeddings, self.embedding_dim), dtype="float32"), -# trainable=True, -# name="embeddings_vq" -# ) -# -# def call(self, inputs): -# input_shape = tf.shape(inputs) -# flat_inputs = tf.reshape(inputs, [-1, self.embedding_dim]) # (B*T, emb_dim) -# -# # Compute squared L2 distances -# a_sq = tf.reduce_sum(flat_inputs ** 2, axis=1, keepdims=True) # (B*T, 1) -# ab = 2 * tf.matmul(flat_inputs, tf.transpose(self.embeddings)) # (B*T, num_embeddings) -# b_sq = tf.reduce_sum(self.embeddings ** 2, axis=1) # (num_embeddings,) -# b_sq = tf.reshape(b_sq, [1, -1]) # (1, num_embeddings) -# -# distances = a_sq - ab + b_sq # (B*T, num_embeddings) -# -# # Find closest embeddings -# encoding_indices = tf.argmin(distances, axis=1) -# encodings = tf.one_hot(encoding_indices, self.num_embeddings) -# quantized = tf.matmul(encodings, self.embeddings) -# -# # Reshape quantized values to match input shape -# quantized = tf.reshape(quantized, input_shape) -# -# # Calculate VQ losses - straight-through estimator -# commitment_loss = tf.reduce_mean(tf.square(tf.stop_gradient(quantized) - inputs)) -# codebook_loss = tf.reduce_mean(tf.square(quantized - tf.stop_gradient(inputs))) -# vq_loss = commitment_loss + self.beta * codebook_loss -# -# # Add loss to layer's loss collection -# self.add_loss(vq_loss) -# -# # Straight-through estimator (copy gradients from quantized to inputs) -# quantized = inputs + tf.stop_gradient(quantized - inputs) -# -# # Optionally compute perplexity -# avg_probs = tf.reduce_mean(encodings, axis=0) -# perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) -# -# indices_reshaped = tf.reshape(encoding_indices, input_shape[:-1]) -# return quantized, indices_reshaped, perplexity -# -# def get_config(self): -# config = super().get_config() -# config.update({ -# "embedding_dim": self.embedding_dim, -# "num_embeddings": self.num_embeddings, -# "beta": self.beta -# }) -# return config - - -# Helper function for convolutional blocks -def conv_block(filters, kernel_size=3, activation='relu', padding='same', batch_norm=True, input_shape=None, name=None): - layers_list = [] - conv_kwargs = dict( - filters=filters, - kernel_size=kernel_size, - padding=padding, - kernel_initializer='he_normal' - ) - if input_shape: - conv_kwargs['input_shape'] = input_shape - layers_list.append(layers.Conv1D(**conv_kwargs)) - - if batch_norm: - layers_list.append(layers.BatchNormalization()) - layers_list.append(layers.Activation(activation)) - - # 2nd Conv Layer - layers_list.append(layers.Conv1D( - filters=filters, - kernel_size=kernel_size, - padding=padding, - kernel_initializer='he_normal' - )) - if batch_norm: - layers_list.append(layers.BatchNormalization()) - layers_list.append(layers.Activation(activation)) - - return keras.Sequential(layers_list, name=name) - - -def upconv_block(filters, kernel_size=3, activation='relu', padding='same', batch_norm=True, name_prefix=None): - transpose_conv_name = f"{name_prefix}_transpose" if name_prefix else None - conv_block_name = f"{name_prefix}_conv" if name_prefix else None - - upconv = layers.Conv1DTranspose( - filters=filters, - kernel_size=2, - strides=2, - padding=padding, - name=transpose_conv_name - ) - conv = conv_block( - filters=filters, - kernel_size=kernel_size, - activation=activation, - padding=padding, - batch_norm=batch_norm, - name=conv_block_name - ) - return upconv, conv - + self.code_usage[dead_idx].assign(0.2) class SCQ1DAutoEncoder(keras.Model): - def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, **kwargs): + def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, + scq_params, initial_codebook, **kwargs): super().__init__(**kwargs) - self.input_channels = input_dim[-1] - self.seq_length = input_dim[0] + self.input_dim = input_dim # e.g., (1024,) self.embedding_dim = embedding_dim self.num_embeddings = num_embeddings self.commitment_beta = commitment_beta - # Encoder - self.enc1 = conv_block(64, name='enc1') - self.pool1 = layers.MaxPooling1D(2, name='pool1') - self.enc2 = conv_block(128, name='enc2') - self.pool2 = layers.MaxPooling1D(2, name='pool2') - self.enc3 = conv_block(256, name='enc3') - self.pool3 = layers.MaxPooling1D(2, name='pool3') - self.enc4 = conv_block(512, name='enc4') - self.pool4 = layers.MaxPooling1D(2, name='pool4') - - self.bottleneck = conv_block(self.embedding_dim, kernel_size=1, activation='linear', name='bottleneck') - - # VQ Layer - # self.vq_layer = VQ_Layer(self.embedding_dim, self.num_embeddings, self.commitment_beta, name="vq_layer") - self.vq_layer = SCQ_layer(num_embed=self.num_embeddings, dim_embed=self.embedding_dim, - beta_loss=self.commitment_beta, discrete_loss=False) - - # Decoder - self.up4_trans, self.dec4_conv = upconv_block(512, name_prefix='dec4') - self.up3_trans, self.dec3_conv = upconv_block(256, name_prefix='dec3') - self.up2_trans, self.dec2_conv = upconv_block(128, name_prefix='dec2') - self.up1_trans, self.dec1_conv = upconv_block(64, name_prefix='dec1') - - self.output_layer = layers.Conv1D(self.input_channels, 1, activation='linear', padding='same', name='output') + # Encoder: Dense layers to compress 1024 features to embedding_dim + self.encoder = keras.Sequential([ + layers.Dense(512, activation='relu', input_shape=self.input_dim), + layers.Dense(256, activation='relu'), + layers.Dense(128, activation='relu'), + layers.Dense(self.embedding_dim, activation='linear') + ]) + + # SCQ Layer for quantization + # self.scq_layer = SCQ_layer(num_embed=self.num_embeddings, dim_embed=self.embedding_dim, + # beta_loss=self.commitment_beta, discrete_loss=False) + self.scq_layer = SCQ_layer(num_embed=self.num_embeddings, dim_embed=self.embedding_dim, + beta_loss=self.commitment_beta, **scq_params) + + # Initialize codebook if provided + if initial_codebook is not None: + # Ensure the shape matches + expected_shape = (self.embedding_dim, self.num_embeddings) + if initial_codebook.shape == expected_shape: + self.scq_layer.embed_w.assign(initial_codebook) + else: + tf.print( + f"Warning: Initial codebook shape {initial_codebook.shape} doesn't match expected shape {expected_shape}. Using default initialization.") + + # Decoder: Dense layers to reconstruct from embedding_dim to 1024 features + self.decoder = keras.Sequential([ + layers.Dense(128, activation='relu', input_shape=(self.embedding_dim,)), + layers.Dense(256, activation='relu'), + layers.Dense(512, activation='relu'), + layers.Dense(self.input_dim[0], activation='linear') # output shape (B, 1024) + ]) # Loss trackers self.total_loss_tracker = keras.metrics.Mean(name="total_loss") @@ -1117,31 +1002,16 @@ def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, ** self.perplexity_tracker = keras.metrics.Mean(name="perplexity") def call(self, inputs, training=False): - # --- Encoding --- - x1 = self.enc1(inputs) - x2 = self.enc2(self.pool1(x1)) - x3 = self.enc3(self.pool2(x2)) - x4 = self.enc4(self.pool3(x3)) - x_bottleneck = self.bottleneck(self.pool4(x4)) - - # --- Vector Quantization --- - quantized, indices, vq_loss, perplexity, hard_indices = self.vq_layer(x_bottleneck) - - # --- Decoding --- - y = self.up4_trans(quantized) - y = self.dec4_conv(y) + # Encoder: Compress input to embedding space + x = self.encoder(inputs) # (batch_size, embedding_dim) + x = tf.expand_dims(x, axis=1) # (batch_size, 1, embedding_dim) - y = self.up3_trans(y) - y = self.dec3_conv(y) + # SCQ: Quantize the embedding + quantized, indices, vq_loss, perplexity, hard_indices = self.scq_layer(x) - y = self.up2_trans(y) - y = self.dec2_conv(y) - - y = self.up1_trans(y) - y = self.dec1_conv(y) - - output = self.output_layer(y) - vq_loss = tf.add_n(self.vq_layer.losses) if self.vq_layer.losses else tf.constant(0.0) + # Decoder: Reconstruct from quantized embedding + y = tf.squeeze(quantized, axis=1) # (batch_size, embedding_dim) + output = self.decoder(y) # (batch_size, 1024) return output, quantized, indices, vq_loss, perplexity, hard_indices @@ -1164,21 +1034,19 @@ def train_step(self, data): with tf.GradientTape() as tape: reconstruction, quantized, indices, vq_loss, perplexity, hard_indices = self(x, training=True) - # Basic reconstruction loss + # Reconstruction loss recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) - # Add feature matching loss by comparing intermediate features + # Feature matching loss with tape.stop_recording(): _, mid_features, _, _, _, _ = self(reconstruction, training=False) orig_mid_features = quantized - - # Feature matching loss to maintain semantic information feature_loss = tf.reduce_mean(tf.math.squared_difference(orig_mid_features, mid_features)) - # Combine losses with adjusted weights + # Total loss total_loss = recon_loss + vq_loss + 0.1 * feature_loss - # Add codebook usage penalty if perplexity is too low + # Usage penalty usage_penalty = tf.cond( perplexity < self.num_embeddings * 0.5, lambda: 0.5 * (self.num_embeddings * 0.5 - perplexity), @@ -1187,19 +1055,16 @@ def train_step(self, data): total_loss += usage_penalty grads = tape.gradient(total_loss, self.trainable_variables) - - # Clip gradients to prevent instability grads, _ = tf.clip_by_global_norm(grads, 5.0) - self.optimizer.apply_gradients(zip(grads, self.trainable_variables)) - # Update all the trackers + # Update metrics self.total_loss_tracker.update_state(total_loss) self.recon_loss_tracker.update_state(recon_loss) self.vq_loss_tracker.update_state(vq_loss) self.perplexity_tracker.update_state(perplexity) - # Print the perplexity every 100 steps + # Log perplexity every 100 steps step = self.optimizer.iterations tf.cond( tf.equal(tf.math.floormod(step, 100), 0), @@ -1224,93 +1089,91 @@ def test_step(self, data): self.total_loss_tracker.update_state(total_loss) self.recon_loss_tracker.update_state(recon_loss) self.vq_loss_tracker.update_state(vq_loss) - self.perplexity_tracker.update_state(perplexity) # Now actually updating the perplexity tracker - - # tf.print("Perplexity:", perplexity) # Print the actual perplexity value # Print the actual perplexity value + self.perplexity_tracker.update_state(perplexity) return {m.name: m.result() for m in self.metrics} -class CodebookUsageCallback(tf.keras.callbacks.Callback): - """ - Callback to monitor and adjust codebook usage during training. - """ - - def __init__(self, test_input, plot_freq=5, min_perplexity_ratio=0.5): - """ - Args: - test_input: A small batch of test data to monitor codebook usage - plot_freq: How often to check usage (in epochs) - min_perplexity_ratio: Minimum ratio of perplexity to num_embeddings - """ - super().__init__() - self.test_input = test_input - self.plot_freq = plot_freq - self.min_perplexity_ratio = min_perplexity_ratio - self.usage_history = [] - self.perplexity_history = [] - - def on_epoch_end(self, epoch, logs=None): - # Get the current model outputs for test data - outputs = self.model(self.test_input, training=False) - _, _, indices, _, perplexity = outputs - - # Convert indices to flat array if using VQ - if isinstance(indices, tf.Tensor) and len(indices.shape) > 1: - indices = tf.reshape(indices, [-1]) - - # Compute usage statistics - if hasattr(self.model, 'vq_layer') and hasattr(self.model.vq_layer, 'code_usage'): - # If using SCQ with explicit usage tracking - usage = self.model.vq_layer.code_usage.numpy() - elif isinstance(indices, tf.Tensor): - # For VQ, compute usage from indices - unique_indices, counts = tf.unique_with_counts(indices) - usage = np.zeros(self.model.num_embeddings) - for idx, count in zip(unique_indices.numpy(), counts.numpy()): - usage[idx] = count / tf.size(indices).numpy() - - # Record history - self.usage_history.append(usage) - self.perplexity_history.append(perplexity.numpy()) - - # Print status - if epoch % self.plot_freq == 0: - perplexity_ratio = perplexity.numpy() / self.model.num_embeddings - num_used = np.sum(usage > 0.001) # Codes with >0.1% usage - - print(f"\nEpoch {epoch} - Codebook stats:") - print(f" Perplexity: {perplexity.numpy():.2f} / {self.model.num_embeddings} = {perplexity_ratio:.2%}") - print( - f" Active codes: {num_used} / {self.model.num_embeddings} = {num_used / self.model.num_embeddings:.2%}") - - # Take corrective action if usage is too low - if perplexity_ratio < self.min_perplexity_ratio: - print(" WARNING: Low codebook usage detected!") - - # If we have SCQ layer, modify parameters - if hasattr(self.model, 'vq_layer') and hasattr(self.model.vq_layer, 'lambda_reg'): - # Decrease regularization to allow more code usage - old_lambda = self.model.vq_layer.lambda_reg - new_lambda = max(old_lambda * 0.8, 0.05) # Decrease by 20% with a minimum - print(f" Adjusting lambda_reg: {old_lambda:.4f} -> {new_lambda:.4f}") - self.model.vq_layer.lambda_reg = new_lambda - - # Force code reset - if hasattr(self.model.vq_layer, '_reset_dead_codes'): - # Get encoder outputs from test data - # This assumes encoder output is the input to vq_layer - # You may need to adjust based on your actual architecture - encoder_output = self.test_input - for layer in self.model.layers: - if layer == self.model.vq_layer: - break - encoder_output = layer(encoder_output) - - # Force reset of dead codes - flat_encoder_output = tf.reshape(encoder_output, [-1, self.model.embedding_dim]) - self.model.vq_layer._reset_dead_codes(flat_encoder_output) - print(" Forced reset of dead codebook vectors") +# class CodebookUsageCallback(tf.keras.callbacks.Callback): +# """ +# Callback to monitor and adjust codebook usage during training. +# """ +# +# def __init__(self, test_input, plot_freq=5, min_perplexity_ratio=0.5): +# """ +# Args: +# test_input: A small batch of test data to monitor codebook usage +# plot_freq: How often to check usage (in epochs) +# min_perplexity_ratio: Minimum ratio of perplexity to num_embeddings +# """ +# super().__init__() +# self.test_input = test_input +# self.plot_freq = plot_freq +# self.min_perplexity_ratio = min_perplexity_ratio +# self.usage_history = [] +# self.perplexity_history = [] +# +# def on_epoch_end(self, epoch, logs=None): +# # Get the current model outputs for test data +# outputs = self.model(self.test_input, training=False) +# _, _, indices, _, perplexity = outputs +# +# # Convert indices to flat array if using VQ +# if isinstance(indices, tf.Tensor) and len(indices.shape) > 1: +# indices = tf.reshape(indices, [-1]) +# +# # Compute usage statistics +# if hasattr(self.model, 'vq_layer') and hasattr(self.model.vq_layer, 'code_usage'): +# # If using SCQ with explicit usage tracking +# usage = self.model.vq_layer.code_usage.numpy() +# elif isinstance(indices, tf.Tensor): +# # For VQ, compute usage from indices +# unique_indices, counts = tf.unique_with_counts(indices) +# usage = np.zeros(self.model.num_embeddings) +# for idx, count in zip(unique_indices.numpy(), counts.numpy()): +# usage[idx] = count / tf.size(indices).numpy() +# +# # Record history +# self.usage_history.append(usage) +# self.perplexity_history.append(perplexity.numpy()) +# +# # Print status +# if epoch % self.plot_freq == 0: +# perplexity_ratio = perplexity.numpy() / self.model.num_embeddings +# num_used = np.sum(usage > 0.001) # Codes with >0.1% usage +# +# print(f"\nEpoch {epoch} - Codebook stats:") +# print(f" Perplexity: {perplexity.numpy():.2f} / {self.model.num_embeddings} = {perplexity_ratio:.2%}") +# print( +# f" Active codes: {num_used} / {self.model.num_embeddings} = {num_used / self.model.num_embeddings:.2%}") +# +# # Take corrective action if usage is too low +# if perplexity_ratio < self.min_perplexity_ratio: +# print(" WARNING: Low codebook usage detected!") +# +# # If we have SCQ layer, modify parameters +# if hasattr(self.model, 'vq_layer') and hasattr(self.model.vq_layer, 'lambda_reg'): +# # Decrease regularization to allow more code usage +# old_lambda = self.model.vq_layer.lambda_reg +# new_lambda = max(old_lambda * 0.8, 0.05) # Decrease by 20% with a minimum +# print(f" Adjusting lambda_reg: {old_lambda:.4f} -> {new_lambda:.4f}") +# self.model.vq_layer.lambda_reg = new_lambda +# +# # Force code reset +# if hasattr(self.model.vq_layer, '_reset_dead_codes'): +# # Get encoder outputs from test data +# # This assumes encoder output is the input to vq_layer +# # You may need to adjust based on your actual architecture +# encoder_output = self.test_input +# for layer in self.model.layers: +# if layer == self.model.vq_layer: +# break +# encoder_output = layer(encoder_output) +# +# # Force reset of dead codes +# flat_encoder_output = tf.reshape(encoder_output, [-1, self.model.embedding_dim]) +# self.model.vq_layer._reset_dead_codes(flat_encoder_output) +# print(" Forced reset of dead codebook vectors") # Example Usage: From 2a7e03015ef49ba8042ff7ab62a4022c5303c8f1 Mon Sep 17 00:00:00 2001 From: amirreza Date: Fri, 25 Apr 2025 12:53:40 +0200 Subject: [PATCH 21/83] add binding label functionality --- run_pep2vec.py | 131 ++++++++++++++++++++++++++++++++++++++++++++++--- 1 file changed, 124 insertions(+), 7 deletions(-) diff --git a/run_pep2vec.py b/run_pep2vec.py index 5aa349cbe..2e0216bd5 100644 --- a/run_pep2vec.py +++ b/run_pep2vec.py @@ -125,7 +125,112 @@ def select_columns(df, columns): # return f"{locus}*{num[:2]}:{num[2:]}" # return chain -def main(dataset_name="Conbotnet", mhc_type="mhc2"): +def add_binding_label(df_path, train_path, test_path, output_dir=None): + """ + Add binding labels to the DataFrame based on allotype and peptide pairs. + + Parameters: + ----------- + df_path : DataFrame, str, or directory path + DataFrame, path to a file, or directory containing multiple files to add binding labels to + train_path : str + Path to training data CSV file with binding labels + test_path : str + Path to test data CSV file with binding labels + output_dir : str, optional + Directory to save labeled files, if None will overwrite original files + + Returns: + -------- + DataFrame or dict of DataFrames with binding labels added + """ + # Load train and test binding label mappings + train_df = pd.read_csv(train_path) + test_df = pd.read_csv(test_path) + + # Create binding label mappings + train_binding_labels = { + (row["allele"], row["long_mer"]): row["binding_label"] + for _, row in train_df.iterrows() + } + + test_binding_labels = { + (row["allele"], row["long_mer"]): row["binding_label"] + for _, row in test_df.iterrows() + } + + # Check if df_path is a directory + if isinstance(df_path, str) and os.path.isdir(df_path): + # Process all files in the directory + results = {} + for filename in os.listdir(df_path): + file_path = os.path.join(df_path, filename) + if os.path.isfile(file_path) and (file_path.endswith('.csv') or file_path.endswith('.parquet')): + print(f"Processing file: {filename}") + results[filename] = process_single_file( + file_path, train_binding_labels, test_binding_labels, output_dir + ) + return results + else: + # Process a single file or DataFrame + return process_single_file(df_path, train_binding_labels, test_binding_labels, output_dir) + + +def process_single_file(df_or_path, train_binding_labels, test_binding_labels, output_dir=None): + """Helper function to process a single file or DataFrame""" + # Process the provided dataframe or file + if isinstance(df_or_path, str): + if df_or_path.endswith('.parquet'): + df = pd.read_parquet(df_or_path) + else: + df = pd.read_csv(df_or_path) + file_path = df_or_path + else: + df = df_or_path + file_path = None + + # Determine if this is a test file based on filename + is_test = file_path and "test" in os.path.basename(file_path).lower() + binding_labels = test_binding_labels if is_test else train_binding_labels + + # Check if columns use 'allotype'/'peptide' naming convention (parquet files) + # or 'allele'/'long_mer' naming convention (CSV files) + has_allotype_col = "allotype" in df.columns + has_peptide_col = "peptide" in df.columns + + # Assign labels based on mapping with appropriate column names + if has_allotype_col and has_peptide_col: + # Parquet file naming convention + df["binding_label"] = df.apply( + lambda row: binding_labels.get((row["allotype"], row["peptide"])), + axis=1 + ) + else: + # CSV file naming convention + df["binding_label"] = df.apply( + lambda row: binding_labels.get((row["allele"], row["long_mer"])), + axis=1 + ) + + # Map string labels to integers + label_mapping = { + label: i for i, label in enumerate(sorted(df["binding_label"].dropna().unique())) + } + df["binding_label"] = df["binding_label"].map(label_mapping) + + # Save the file if a path was provided and output_dir is specified + if file_path and output_dir: + os.makedirs(output_dir, exist_ok=True) + output_path = os.path.join(output_dir, os.path.basename(file_path)) + if file_path.endswith('.parquet'): + df.to_parquet(output_path) + else: + df.to_csv(output_path, index=False) + + return df + + +def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0): # Conbotnet dataset paths # ConBotNet only contains mhc class II @@ -181,7 +286,7 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2"): k = 5 folds = create_k_fold_leave_one_out_stratified_cross_validation( datasets['train'], k=k, target_col="binding_label", - id_col="allotype", train_size=0.8, subset_prop=0.1 + id_col="allotype", train_size=0.8, subset_prop=subset_prop ) # Clear previous held_out_ids file if it exists @@ -244,17 +349,29 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2"): for i in range(k): train_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"train_set_fold_{i}.csv") output_file = os.path.join(output_dir, f"pep2vec_output_fold_{i}.parquet") - os.system(f"./Pep2Vec/pep2vec.bin --num_processes 20 --num_threads 10 --dataset {train_file} --output_location {output_file} --mhctype {mhc_type}") + os.system(f"./Pep2Vec/pep2vec.bin --num_processes 40 --num_threads 15 --dataset {train_file} --output_location {output_file} --mhctype {mhc_type}") validation_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"val_set_fold_{i}.csv") output_file = os.path.join(output_dir, f"pep2vec_output_val_fold_{i}.parquet") - os.system(f"./Pep2Vec/pep2vec.bin --num_processes 20 --num_threads 10 --dataset {validation_file} --output_location {output_file} --mhctype {mhc_type}") + os.system(f"./Pep2Vec/pep2vec.bin --num_processes 40 --num_threads 15 --dataset {validation_file} --output_location {output_file} --mhctype {mhc_type}") # test set test_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", "test_set.csv") output_file = os.path.join(output_dir, f"pep2vec_output_test_fold_{i}.parquet") - os.system(f"./Pep2Vec/pep2vec.bin --num_processes 20 --num_threads 10 --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") + os.system(f"./Pep2Vec/pep2vec.bin --num_processes 40 --num_threads 15 --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") ############################################### if __name__ == "__main__": - main("Conbotnet", "mhc2") - main("ConvNeXT-MHC", "mhc1") + # main("Conbotnet", "mhc2") + # add_binding_label( + # df_path=os.path.join("data", "Pep2Vec", "Conbotnet"), + # train_path=os.path.join("data", "Conbotnet", "train.csv"), + # test_path=os.path.join("data", "Conbotnet", "test_all.csv"), + # output_dir=os.path.join("data", "Pep2Vec", "Conbotnet_new") + # ) + main("ConvNeXT-MHC", "mhc1", 0.01) + add_binding_label( + df_path=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC"), + train_path=os.path.join("data", "ConvNeXT-MHC", "train.csv"), + test_path=os.path.join("data", "ConvNeXT-MHC", "test_all.csv"), + output_dir=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC_subset_new") + ) From 0065866210ce6c4acb80c17da743242b44f95e88 Mon Sep 17 00:00:00 2001 From: amirreza Date: Mon, 28 Apr 2025 14:10:13 +0200 Subject: [PATCH 22/83] Refactor and enhance SCQ layer functionality and training logic Improved the SCQ layer with added support for resetting unused codebook vectors, better error handling, and parameter clarity. Updated training script with changes to batch size handling, latent space extraction, and added detailed visualization methods for cluster and codebook distributions. The changes improve model functionality, usability, and performance monitoring. --- run_pMHC_DL.py | 352 ++++++++++++++--- run_pep2vec.py | 6 +- utils/model.py | 1030 +++++++----------------------------------------- 3 files changed, 445 insertions(+), 943 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index d28330fb5..9cda9f59c 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -919,16 +919,16 @@ def train_and_evaluate_scqvae( data_path, num_embeddings=32, embedding_dim=64, # Increased from 32 - batch_num=32, # Increased from 1 + batch_size=32, # Increased from 1 epochs=20, # Increased from 10 - learning_rate=1e-3, # Adjusted from 1e-4 + learning_rate=1e-5, # Adjusted from 1e-4 commitment_beta=0.25, output_dir='data/SCQvae', visualize=True, save_model=True, random_state=42, test_size=0.2, - return_quantize_whole_dataset=False, + output_data="all", # Options: "val", "train", "all" **kwargs ): """ @@ -938,7 +938,7 @@ def train_and_evaluate_scqvae( data_path: Path to the parquet file containing peptide embeddings num_embeddings: Number of clusters/codes in the codebook embedding_dim: Dimension of each codebook vector - batch_num: Batch size for training + batch_size: Batch size for training epochs: Number of training epochs learning_rate: Learning rate for the optimizer commitment_beta: Beta parameter for commitment loss @@ -959,11 +959,12 @@ def train_and_evaluate_scqvae( # --- Helper Functions --- def create_dataset(X, batch_size=32, is_training=True): """Create a TensorFlow dataset from input array X.""" + # X shape: (num_samples, seq_length) dataset = tf.data.Dataset.from_tensor_slices(X) if is_training: - dataset = dataset.shuffle(buffer_size=len(X)) - dataset = dataset.batch(batch_size) - dataset = dataset.prefetch(tf.data.AUTOTUNE) + dataset = dataset.shuffle(buffer_size=len(X)) # Shuffle all samples + dataset = dataset.batch(batch_size) # Result shape: (batch_size, seq_length) + dataset = dataset.prefetch(tf.data.AUTOTUNE) # Prefetch for better performance return dataset def load_data(data_path, test_size=0.2, random_state=42): @@ -1050,30 +1051,63 @@ def plot_reconstructions(original, reconstructed, n_samples=5, save_path=None): plt.close() def plot_codebook_usage(indices, num_embeddings, save_path=None): - """Visualize the usage distribution of codebook vectors.""" + """Visualize the usage distribution of codebook vectors. + + Args: + indices: Hard indices from model output (integer indices of assigned codes) + num_embeddings: Total number of vectors in the codebook + save_path: Path to save the visualization + + Returns: + used_vectors: Number of vectors used + usage_percentage: Percentage of codebook utilized + """ + # Convert from tensor to numpy if needed if isinstance(indices, tf.Tensor): indices = indices.numpy() - flat_indices = indices.flatten() - if np.issubdtype(flat_indices.dtype, np.floating): - print(f"Detected floating point indices, quantizing to {num_embeddings} discrete values") - min_val, max_val = np.min(flat_indices), np.max(flat_indices) - print(f"Index range: {min_val} to {max_val}") - bins = np.linspace(min_val, max_val, num_embeddings + 1) - discrete_indices = np.digitize(flat_indices, bins) - 1 - flat_indices = np.clip(discrete_indices, 0, num_embeddings - 1) - - unique, counts = np.unique(flat_indices, return_counts=True) + + # Ensure indices is a NumPy array before proceeding + if not isinstance(indices, np.ndarray): + try: + # Attempt conversion if it's list-like + indices = np.array(indices) + except Exception as e: + print( + f"Error in plot_codebook_usage: Input 'indices' is not a NumPy array or convertible. Type: {type(indices)}. Error: {e}") + # Return default values or raise an error + return 0, 0.0 + + # Flatten indices to 1D array for counting + try: + flat_indices = indices.flatten() + except AttributeError: + print(f"Error in plot_codebook_usage: Cannot flatten 'indices'. Type: {type(indices)}") + return 0, 0.0 # Return default values + + # Count occurrences of each codebook vector + try: + unique, counts = np.unique(flat_indices, return_counts=True) + except TypeError as e: + print( + f"Error in plot_codebook_usage: Cannot compute unique values for 'flat_indices'. Type: {type(flat_indices)}. Error: {e}") + return 0, 0.0 # Return default values + + # Create full distribution including zeros for unused vectors full_distribution = np.zeros(num_embeddings) for idx, count in zip(unique, counts): - if 0 <= idx < num_embeddings: + if 0 <= idx < num_embeddings: # Ensure index is valid full_distribution[int(idx)] = count + # Calculate usage statistics used_vectors = np.sum(full_distribution > 0) usage_percentage = (used_vectors / num_embeddings) * 100 + # Create the plot plt.figure(figsize=(12, 6)) bar_positions = np.arange(num_embeddings) bars = plt.bar(bar_positions, full_distribution) + + # Color bars by frequency max_count = np.max(full_distribution) if max_count > 0: for i, bar in enumerate(bars): @@ -1082,8 +1116,11 @@ def plot_codebook_usage(indices, num_embeddings, save_path=None): plt.xlabel('Codebook Vector Index') plt.ylabel('Usage Count') - plt.title(f'Codebook Vector Usage Distribution\n{used_vectors}/{num_embeddings} vectors used ({usage_percentage:.1f}%)') + plt.title( + f'Codebook Vector Usage Distribution\n{used_vectors}/{num_embeddings} vectors used ({usage_percentage:.1f}%)') plt.grid(axis='y', linestyle='--', alpha=0.7) + + # Add colorbar sm = plt.cm.ScalarMappable(cmap=plt.cm.viridis, norm=plt.Normalize(0, max_count)) sm.set_array([]) cbar = plt.colorbar(sm) @@ -1099,6 +1136,191 @@ def plot_codebook_usage(indices, num_embeddings, save_path=None): plt.close() return used_vectors, usage_percentage + def plot_soft_cluster_distribution(soft_cluster_probs, num_samples=None, save_path=None): + """ + Visualize the distribution of soft clustering probabilities across samples. + + Args: + soft_cluster_probs: List of arrays or single array containing probability + distributions across clusters for each sample + num_samples: Number of samples to visualize (default: 10) + save_path: Path to save the visualization (default: None) + + Returns: + None + """ + if num_samples is None: + num_samples = len(soft_cluster_probs) + # Process input to get a clean 2D array (samples x clusters) + if isinstance(soft_cluster_probs, list): + if not soft_cluster_probs: + print("Warning: Empty list provided to plot_soft_cluster_distribution") + return + sample_batch = soft_cluster_probs[0] + if isinstance(sample_batch, tf.Tensor): + sample_batch = sample_batch.numpy() + soft_cluster_probs = sample_batch + elif isinstance(soft_cluster_probs, tf.Tensor): + soft_cluster_probs = soft_cluster_probs.numpy() + + # Reshape if needed + if soft_cluster_probs.ndim > 2: + print(f"Reshaping array from shape {soft_cluster_probs.shape} to 2D format") + if soft_cluster_probs.shape[1] == 1: + soft_cluster_probs = soft_cluster_probs.reshape(soft_cluster_probs.shape[0], + soft_cluster_probs.shape[2]) + else: + soft_cluster_probs = soft_cluster_probs.reshape(soft_cluster_probs.shape[0], -1) + + # Verify valid data + if soft_cluster_probs.size == 0: + print("Warning: Empty array provided to plot_soft_cluster_distribution") + return + + n_samples = min(len(soft_cluster_probs), 1000) # Limit to prevent memory issues + n_clusters = soft_cluster_probs.shape[1] + + # Create a figure with 2 subplots + fig, (ax1, ax2) = plt.subplots(2, 1, figsize=(14, 12), gridspec_kw={'height_ratios': [2, 1]}) + + # 1. Heatmap visualization (top) + display_samples = min(num_samples, n_samples) + im = ax1.imshow(soft_cluster_probs[:display_samples], aspect='auto', cmap='viridis') + ax1.set_xlabel('Cluster Index') + ax1.set_ylabel('Sample Index') + ax1.set_title(f'Soft Cluster Probability Heatmap (First {display_samples} Samples)') + plt.colorbar(im, ax=ax1, label='Probability') + + # 2. Aggregated statistics (bottom) + # Calculate statistics across all samples for each cluster + cluster_means = np.mean(soft_cluster_probs, axis=0) + cluster_max_counts = np.sum(np.argmax(soft_cluster_probs, axis=1)[:, np.newaxis] == np.arange(n_clusters), axis=0) + + # Create a twin axis for the bar plot + ax2_twin = ax2.twinx() + + # Plot mean probability for each cluster (line) + x = np.arange(n_clusters) + ax2.plot(x, cluster_means, 'r-', linewidth=2, label='Mean Probability') + ax2.set_ylabel('Mean Probability', color='r') + ax2.tick_params(axis='y', labelcolor='r') + ax2.set_ylim(0, max(cluster_means) * 1.2) + + # Plot histogram of cluster assignments (bars) + ax2_twin.bar(x, cluster_max_counts, alpha=0.3, label='Assignment Count') + ax2_twin.set_ylabel('Number of Samples\nwith Highest Probability', color='b') + ax2_twin.tick_params(axis='y', labelcolor='b') + + # Add labels and grid + ax2.set_xlabel('Cluster Index') + ax2.set_title('Cluster Usage Statistics Across All Samples') + ax2.set_xticks(np.arange(0, n_clusters, max(1, n_clusters // 20))) + ax2.grid(True, linestyle='--', alpha=0.5, axis='y') + + # Create custom legend + lines, labels = ax2.get_legend_handles_labels() + lines2, labels2 = ax2_twin.get_legend_handles_labels() + ax2.legend(lines + lines2, labels + labels2, loc='upper right') + + # Add overall statistics as text + active_clusters = np.sum(np.max(soft_cluster_probs, axis=0) > 0.01) + most_used_cluster = np.argmax(cluster_max_counts) + ax2.text(0.02, 0.95, + f"Active clusters: {active_clusters}/{n_clusters} ({active_clusters/n_clusters:.1%})\n" + f"Most used cluster: {most_used_cluster} ({cluster_max_counts[most_used_cluster]} samples)", + transform=ax2.transAxes, verticalalignment='top', + bbox=dict(boxstyle='round', facecolor='white', alpha=0.8)) + + plt.tight_layout() + + # Save if path is provided + if save_path: + plt.savefig(save_path, dpi=150, bbox_inches='tight') + + # Show or close based on global visualize flag + if visualize: + plt.show() + else: + plt.close() + + + def plot_cluster_distribution(soft_cluster_probs, save_path=None): + """ + Plot distribution of samples across clusters based on one-hot encodings. + + Args: + soft_cluster_probs: Soft cluster probabilities + save_path: Path to save the plot + + Returns: + used_clusters: Number of clusters used + usage_percentage: Percentage of clusters used + """ + # Convert soft cluster probabilities to one-hot encodings + one_hot_encodings = tf.one_hot(tf.argmax(soft_cluster_probs, axis=-1), depth=soft_cluster_probs.shape[-1]) + one_hot_encodings = tf.cast(one_hot_encodings, tf.float32) + + # print(f"one_hot_encodings shape: {one_hot_encodings.shape}") + # print first 5 values + # print(f"one_hot_encodings values: {one_hot_encodings[:5]}") + + # Convert one-hot to cluster indices if needed + if isinstance(one_hot_encodings, tf.Tensor): + one_hot_encodings = one_hot_encodings.numpy() + + # Handle different shapes of one_hot_encodings + if len(one_hot_encodings.shape) == 3: # (batch, seq_len, num_embeddings) + cluster_assignments = np.argmax(one_hot_encodings, axis=-1).flatten() + else: # (batch, num_embeddings) + cluster_assignments = np.argmax(one_hot_encodings, axis=-1).flatten() + + # Count occurrences of each cluster + unique_clusters, counts = np.unique(cluster_assignments, return_counts=True) + + # Create a full distribution including zeros for unused clusters + num_clusters = one_hot_encodings.shape[-1] + full_distribution = np.zeros(num_clusters) + for cluster, count in zip(unique_clusters, counts): + full_distribution[cluster] = count + + # Calculate usage statistics + used_clusters = np.sum(full_distribution > 0) + usage_percentage = (used_clusters / num_clusters) * 100 + + # Create the plot + plt.figure(figsize=(12, 6)) + bars = plt.bar(np.arange(num_clusters), full_distribution) + + # Color bars by frequency + max_count = np.max(full_distribution) + if max_count > 0: + for i, bar in enumerate(bars): + intensity = full_distribution[i] / max_count + bar.set_color(plt.cm.plasma(intensity)) + + plt.xlabel('Cluster Index') + plt.ylabel('Number of Samples') + plt.title( + f'Sample Distribution Across Clusters\n{used_clusters}/{num_clusters} clusters used ({usage_percentage:.1f}%)') + plt.grid(axis='y', linestyle='--', alpha=0.7) + + # Add a colorbar + sm = plt.cm.ScalarMappable(cmap=plt.cm.plasma, norm=plt.Normalize(0, max_count)) + sm.set_array([]) + cbar = plt.colorbar(sm) + cbar.set_label('Sample Count') + + plt.tight_layout() + + if save_path: + plt.savefig(save_path) + print(f"Cluster usage: {used_clusters}/{num_clusters} clusters contain samples ({usage_percentage:.1f}%)") + if visualize: + plt.show() + else: + plt.close() + return used_clusters, usage_percentage + # --- Main Pipeline --- print("Loading/Generating Training Data...") train_data, test_data, seq_length = load_data(data_path, test_size=test_size, random_state=random_state) @@ -1109,8 +1331,8 @@ def plot_codebook_usage(indices, num_embeddings, save_path=None): # Create datasets print("Creating TensorFlow Datasets...") - train_dataset = create_dataset(train_data, batch_size=batch_num, is_training=True) - val_dataset = create_dataset(test_data, batch_size=batch_num, is_training=False) + train_dataset = create_dataset(train_data, batch_size=batch_size, is_training=True) + val_dataset = create_dataset(test_data, batch_size=batch_size, is_training=False) print("Datasets created.") # --- Model Instantiation --- @@ -1154,11 +1376,20 @@ def plot_codebook_usage(indices, num_embeddings, save_path=None): print("\nPerforming example inference...") example_batch = next(iter(val_dataset)) output = model(example_batch, training=False) - reconstruction, quantized_latent, cluster_indices, vq_loss, perplexity, hard_indices = output + reconstruction, quantized_latent, cluster_indices, vq_loss, perplexity = output print("\nVisualizing reconstructions...") - plot_reconstructions(example_batch.numpy(), reconstruction.numpy(), save_path=os.path.join(output_dir, 'vqvae_reconstructions.png')) + plot_reconstructions(example_batch.numpy(), reconstruction.numpy(), + save_path=os.path.join(output_dir, 'vqvae_reconstructions.png')) + plot_reconstructions(example_batch.numpy(), reconstruction.numpy(), + save_path=os.path.join(output_dir, 'vqvae_reconstructions.png')) print("\nAnalyzing codebook usage...") - plot_codebook_usage(hard_indices, num_embeddings, save_path=os.path.join(output_dir, 'codebook_usage.png')) + # # Use hard indices for codebook usage analysis (index 5 in model output) + # plot_codebook_usage(cluster_indices, num_embeddings, save_path=os.path.join(output_dir, 'codebook_usage.png')) + # print("\nAnalyzing cluster distribution from one-hot encodings...") + # # Use one-hot encodings for cluster distribution (index 2 in model output) + # # print number of samples + # print(f"Shape of cluster_indices: {cluster_indices.shape}") + # plot_cluster_distribution(cluster_indices, save_path=os.path.join(output_dir, 'cluster_distribution.png')) # --- Save Model --- if save_model: @@ -1169,39 +1400,58 @@ def plot_codebook_usage(indices, num_embeddings, save_path=None): # --- Extract Latent Space --- print("\nExtracting quantized latent space...") - if return_quantize_whole_dataset: - whole_dataset = tf.data.Dataset.concatenate(train_dataset, val_dataset) + if output_data == "all": + out_dataset = tf.data.Dataset.concatenate(train_dataset, val_dataset) + elif output_data == "train": + out_dataset = train_dataset # using only training dataset for quantization else: - whole_dataset = val_dataset - quantized_latents, cluster_indices_all, hard_indices_all = [], [], [] - for batch in whole_dataset: - output, q_latent, indices, _, _, hard_indices = model(batch, training=False) - quantized_latents.append(q_latent.numpy()) - cluster_indices_all.append(indices.numpy()) - hard_indices_all.append(hard_indices.numpy()) + out_dataset = val_dataset # using only validation dataset for quantization + quantized_latents, cluster_indices_hard_assign, cluster_indices_soft_assign = [], [], [] + for batch in out_dataset: + output, Zq, out_P_proj, _, _ = model(batch, training=False) + print(f"\nBatch shape: {batch.shape}") + print(f"\nOutput shape: {output.shape}") + print(f"\nZq shape: {Zq.shape}") + print(f"\nout_P_proj shape: {out_P_proj.shape}") + + quantized_latents.append(Zq.numpy()) + # Append soft assignments + cluster_indices_soft_assign.append(out_P_proj.numpy()) # shows the probability of each index + cluster_indices_hard_assign.append(tf.argmax(out_P_proj, axis=-1).numpy()) # shows which index has the highest probability quantized_latent = np.concatenate(quantized_latents, axis=0) - cluster_indices = np.concatenate(cluster_indices_all, axis=0) - hard_indices = np.concatenate(hard_indices_all, axis=0) + cluster_indices_soft = np.concatenate(cluster_indices_soft_assign, axis=0) + cluster_indices_hard = np.concatenate(cluster_indices_hard_assign, axis=0) np.save(os.path.join(output_dir, 'quantized_latent.npy'), quantized_latent) - np.save(os.path.join(output_dir, 'cluster_indices.npy'), cluster_indices) - np.save(os.path.join(output_dir, 'hard_indices.npy'), hard_indices) + # np.save(os.path.join(output_dir, 'cluster_indices_hard.npy'), cluster_indices_hard) + + print(f"\n head of Cluster indices hard: {cluster_indices_hard[:5]}") + print(f"\n head of Cluster indices soft: {cluster_indices_soft[:5]}") + # print shape of soft cluster indices + print(f"\n softs shape: {np.array(cluster_indices_soft).shape}") + print(f"\n head of Quantized latents: {quantized_latent[:5]}") + + # Create distribution plots for all data + print("\nCreating distribution plots for all processed data...") + plot_cluster_distribution(cluster_indices_soft, save_path=os.path.join(output_dir, 'cluster_distribution_soft.png')) + plot_codebook_usage(cluster_indices_hard, num_embeddings, + save_path=os.path.join(output_dir, 'full_codebook_usage.png')) + plot_soft_cluster_distribution(np.array(cluster_indices_soft), 20, 'soft_cluster_distribution.png') print(f"Latent representations saved to {output_dir}") - latent_data = { - 'quantized_latent': quantized_latent, - 'cluster_indices': cluster_indices, - 'hard_indices': hard_indices - } - return model, history, latent_data - if __name__ == "__main__": - model, history, latent_data = train_and_evaluate_scqvae( - data_path="data/Pep2Vec/Conbotnet/pep2vec_output_fold_0.parquet", - num_embeddings=8, - embedding_dim=32, - batch_num=8, - epochs=10, + # Call train_and_evaluate_scqvae without trying to unpack return values + train_and_evaluate_scqvae( + data_path="data/Pep2Vec/ConvNeXT-MHC/pep2vec_output_fold_1.parquet", + num_embeddings=32, + embedding_dim=64, + batch_size=32, + epochs=20, output_dir="data/SCQvae/Conbotnet", + visualize=True, + save_model=True, + random_state=42, + test_size=0.2, + output_data="all", # Options: "val", "train", "all" ) # # Create a 1D UMAP projection colored by cluster indices diff --git a/run_pep2vec.py b/run_pep2vec.py index 2e0216bd5..97daa199d 100644 --- a/run_pep2vec.py +++ b/run_pep2vec.py @@ -349,14 +349,14 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0): for i in range(k): train_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"train_set_fold_{i}.csv") output_file = os.path.join(output_dir, f"pep2vec_output_fold_{i}.parquet") - os.system(f"./Pep2Vec/pep2vec.bin --num_processes 40 --num_threads 15 --dataset {train_file} --output_location {output_file} --mhctype {mhc_type}") + os.system(f"./Pep2Vec/pep2vec.bin --num_processes 300 --num_threads 14 --dataset {train_file} --output_location {output_file} --mhctype {mhc_type}") validation_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"val_set_fold_{i}.csv") output_file = os.path.join(output_dir, f"pep2vec_output_val_fold_{i}.parquet") - os.system(f"./Pep2Vec/pep2vec.bin --num_processes 40 --num_threads 15 --dataset {validation_file} --output_location {output_file} --mhctype {mhc_type}") + os.system(f"./Pep2Vec/pep2vec.bin --num_processes 300 --num_threads 14 --dataset {validation_file} --output_location {output_file} --mhctype {mhc_type}") # test set test_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", "test_set.csv") output_file = os.path.join(output_dir, f"pep2vec_output_test_fold_{i}.parquet") - os.system(f"./Pep2Vec/pep2vec.bin --num_processes 40 --num_threads 15 --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") + os.system(f"./Pep2Vec/pep2vec.bin --num_processes 300 --num_threads 14 --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") ############################################### diff --git a/utils/model.py b/utils/model.py index 6c8e9bdf9..068412a10 100644 --- a/utils/model.py +++ b/utils/model.py @@ -4,760 +4,28 @@ from tensorflow.keras import layers -# ------------------------------ -# SCQ Layer as defined before -# ------------------------------ -class SCQ(layers.Layer): - def __init__(self, num_embed=64, dim_embed=32, dim_input=128, lambda_reg=0.1, proj_iter=10, - discrete_loss=False, beta_loss=0.25, **kwargs): + +class SCQ_layer(layers.Layer): + def __init__(self, num_embed, dim_embed, lambda_reg=1.0, proj_iter=10, + discrete_loss=False, beta_loss=0.25, reset_dead_codes=False, + usage_threshold=1e-3, reset_interval=2, **kwargs): """ Soft Convex Quantization (SCQ) layer. Args: num_embed: Number of codebook vectors. dim_embed: Embedding dimension (for both encoder and codebook). - dim_input: Dimension of input features (projected to dim_embed). lambda_reg: Regularization parameter in the SCQ objective. proj_iter: Number of iterations for the iterative simplex projection. - discrete_loss: if True, commitment and codebook loss are calculated similar - to VQ-VAE loss, with stop-gradient operation. If False, only quantization error - is calculated as loss |Z_q - Z_e|**2 - beta_loss: A float to be used in VQ loss. Only used if discrete_loss==True. - multiplied to (1-b)*commitment_loss + b*codebook_loss - """ - super().__init__(**kwargs) - self.num_embed = num_embed - self.dim_embed = dim_embed - self.dim_input = dim_input - self.lambda_reg = lambda_reg - self.proj_iter = proj_iter - self.discrete_loss = discrete_loss - self.beta_loss = beta_loss - self.epsilon = 1e-5 - - def build(self, input_shape): - # Learnable scale and bias for layer normalization. - self.gamma = self.add_weight( - shape=(self.dim_embed,), - initializer="ones", - trainable=True, - name="ln_gamma") - self.beta = self.add_weight( - shape=(self.dim_embed,), - initializer="zeros", - trainable=True, - name="ln_beta") - # Codebook: each column is one codebook vector. - self.embed_w = self.add_weight( - shape=(self.dim_embed, self.num_embed), - initializer='glorot_normal', - trainable=True, - name='scq_embedding' - ) - # Projection weights to map input features into the embedding space. - self.d_w = self.add_weight( - shape=(self.dim_input, self.dim_embed), - initializer='random_normal', - trainable=True, - name='scq_w') - self.d_b = self.add_weight( - shape=(self.dim_embed,), - initializer='zeros', - trainable=True, - name='scq_b') - - def call(self, inputs): - """ - Forward pass for SCQ. - Args: - inputs: Tensor of shape (B, N, dim_input) - Returns: - Quantized output: Tensor of shape (B, N, dim_embed) - """ - # 1. Project inputs to the embedding space and apply layer normalization. - x = tf.matmul(inputs, self.d_w) + self.d_b # (B, N, dim_embed) - x = self.layernorm(x) - - input_shape = tf.shape(x) # (B, N, dim_embed) - flat_inputs = tf.reshape(x, [-1, self.dim_embed]) # (B*N, dim_embed) - - # 2. Compute hard VQ assignments as initialization. - flat_detached = tf.stop_gradient(flat_inputs) - x_norm_sq = tf.reduce_sum(flat_detached ** 2, axis=1, keepdims=True) # (B*N, 1) - codebook_norm_sq = tf.reduce_sum(self.embed_w ** 2, axis=0, keepdims=True) # (1, num_embed) - dot_product = tf.matmul(flat_detached, self.embed_w) # (B*N, num_embed) - distances = x_norm_sq + codebook_norm_sq - 2 * dot_product # (B*N, num_embed) - - assign_indices = tf.argmin(distances, axis=1) # (B*N,) - P_tilde = tf.one_hot(assign_indices, depth=self.num_embed, dtype=tf.float32) # (B*N, num_embed) - P_tilde = tf.transpose(P_tilde) # (num_embed, B*N) - - # 3. Solve the SCQ optimization via a linear system. - C = self.embed_w # (dim_embed, num_embed) - Z = tf.transpose(flat_inputs) # (dim_embed, B*N) - CtC = tf.matmul(C, C, transpose_a=True) # (num_embed, num_embed) - I = tf.eye(self.num_embed, dtype=tf.float32) - A = CtC + self.lambda_reg * I # (num_embed, num_embed) - CtZ = tf.matmul(C, Z, transpose_a=True) # (num_embed, B*N) - b = CtZ + self.lambda_reg * P_tilde # (num_embed, B*N) - P_sol = tf.linalg.solve(A, b) # Unconstrained solution: (num_embed, B*N) - - # 4. Project each column of P_sol onto the probability simplex. - P_proj = self.project_columns_to_simplex(P_sol) # (num_embed, B*N) - # P_proj = tf.nn.softmax(P_sol, axis=0) - out_P_proj = tf.transpose(P_proj) # (B*N, num_embed) - out_P_proj = tf.reshape(out_P_proj, (input_shape[0], input_shape[1], -1)) # (B,N,num_embed) - # out_P_proj = tf.reduce_mean(out_P_proj, axis=-1, keepdims=True) #(B,N,1) - - # 5. Reconstruct quantized output: Z_q = C * P_proj. - Zq_flat = tf.matmul(C, P_proj) # (dim_embed, B*N) - Zq = tf.transpose(Zq_flat) # (B*N, dim_embed) - - # 6. calculate quantization loss, combined commitment and codebook losses - if not self.discrete_loss: - loss = tf.reduce_mean((Zq - flat_inputs) ** 2) # (B*N, dim_embed) - else: - commitment_loss = tf.reduce_mean((tf.stop_gradient(Zq) - flat_inputs) ** 2) - codebook_loss = tf.reduce_mean((Zq - flat_detached) ** 2) - loss = ( - (tf.cast(1 - self.beta_loss, tf.float32) * commitment_loss) + - (tf.cast(self.beta, tf.float32) * codebook_loss) - ) - - Zq = tf.reshape(Zq, input_shape) # (B, N, dim_embed) - return Zq, out_P_proj, loss # (B,N,embed_dim), #(B,N,num_embed), (1,) - - def project_columns_to_simplex(self, P_sol): - """Projects columns of a matrix to the probability simplex.""" - # Transpose to work with rows instead of columns - P_t = tf.transpose(P_sol) # (B*N, num_embed) - # Sort rows in descending order - sorted_P = tf.sort(P_t, axis=1, direction='DESCENDING') - # Compute cumulative sums and thresholds - cumsum = tf.cumsum(sorted_P, axis=1) - k = tf.range(1, tf.shape(sorted_P)[1] + 1, dtype=tf.float32) - thresholds = (cumsum - 1.0) / k - # Find maximum valid index per row (cast to int32 explicitly) - valid_mask = sorted_P > thresholds - max_indices = tf.argmax( - tf.cast(valid_mask, tf.int32) * - tf.range(tf.shape(sorted_P)[1], dtype=tf.int32), - axis=1 - ) - max_indices = tf.cast(max_indices, tf.int32) # Explicit cast to int32 - # Gather required cumulative sums - batch_indices = tf.range(tf.shape(P_t)[0], dtype=tf.int32) - gather_indices = tf.stack([batch_indices, max_indices], axis=1) - # Rest of the code remains the same... - selected_cumsum = tf.gather_nd(cumsum, gather_indices) - theta = (selected_cumsum - 1.0) / tf.cast(max_indices + 1, tf.float32) - # Apply projection and transpose back - P_projected = tf.nn.relu(P_t - theta[:, tf.newaxis]) - return tf.transpose(P_projected) - - def layernorm(self, inputs): - """ - Custom layer normalization over the last dimension. - """ - mean = tf.reduce_mean(inputs, axis=-1, keepdims=True) - variance = tf.math.reduce_variance(inputs, axis=-1, keepdims=True) - normed = (inputs - mean) / tf.sqrt(variance + self.epsilon) - return self.gamma * normed + self.beta - - -class Encoder(layers.Layer): - def __init__(self, dim_input, dim_embed, heads=4, names='encoder', **kwargs): - super().__init__() - self.dim_input = dim_input - self.dim_embed = dim_embed - self.heads = heads - self.names = names - self.epsilon = 1e-5 - self.scale = 1 / tf.sqrt(tf.cast(dim_embed, dtype=tf.float32)) - - def build(self, input_shape): - # Learnable scale and bias for layer normalization. - self.gamma = self.add_weight( - shape=(self.dim_embed,), - initializer="ones", - trainable=True, - name=f"ln_gamma_{self.names}") - self.beta = self.add_weight( - shape=(self.dim_embed,), - initializer="zeros", - trainable=True, - name=f"ln_beta_{self.names}") - # Projection weights to map input features into the embedding space. - self.d_w = self.add_weight( - shape=(self.dim_input, self.dim_embed), - initializer='random_normal', - trainable=True, - name=f'd_w_{self.names}') - self.d_b = self.add_weight( - shape=(self.dim_embed,), - initializer='zeros', - trainable=True, - name=f'd_b_{self.names}') - # gating - self.d_g = self.add_weight( - shape=(self.heads, 1, self.dim_embed, self.dim_embed), - initializer='uniform', - trainable=True, - name=f'g_w_{self.names}') - # attention - self.q = self.add_weight( - shape=(self.heads, 1, self.dim_embed, self.dim_embed), - initializer='random_normal', - trainable=True, - name=f'query_{self.names}') - self.k = self.add_weight( - shape=(self.heads, 1, self.dim_embed, self.dim_embed), - initializer='random_normal', - trainable=True, - name=f'key_{self.names}') - self.v = self.add_weight( - shape=(self.heads, 1, self.dim_embed, self.dim_embed), - initializer='random_normal', - trainable=True, - name=f'value_{self.names}') - # final projection - self.d_o = self.add_weight(shape=(int(self.heads * self.dim_embed), self.dim_embed), - initializer='random_normal', - trainable=True, name=f'dout_{self.names}') - - - def call(self, inputs): - x = tf.matmul(inputs, self.d_w) + self.d_b # (B,N,I)->(B,N,E) - x = self.layernorm(x) - # attention - query = tf.matmul(x, self.q) # (B,N,E)@(H,1,E,E)->(H,B,N,E) - key = tf.matmul(x, self.k) - value = tf.matmul(x, self.v) - gate = tf.nn.sigmoid(tf.matmul(x, self.d_g)) - - qk = tf.einsum('hbni,hbki->hbnk', query, key) # (H,B,N,N) - qk *= self.scale - att = tf.nn.softmax(qk) - out = tf.matmul(att, value) # (H,B,N,N)@(H,B,N,E)->(H,B,N,E) - out = tf.multiply(out, gate) # gate - - out = tf.transpose(out, perm=[1, 2, 3, 0]) - b, h, n, o = tf.shape(out)[0], tf.shape(out)[-1], tf.shape(out)[1], tf.shape(out)[2] - out = tf.reshape(out, [b, n, h * o]) # (B, N, H * E) - out = tf.matmul(out, self.d_o) # (B,N,H*E)@(H*E,E)->(B,N,E) - - return out - - def layernorm(self, inputs): + discrete_loss: If True, commitment and codebook loss are calculated similar + to VQ-VAE loss, with stop-gradient operation. If False, only the quantization error + is calculated as the loss |Z_q - Z_e|**2. + beta_loss: A float used in VQ loss. Only applicable if discrete_loss is True. + Multiplied to (1-beta_loss)*commitment_loss + beta_loss*codebook_loss. + reset_dead_codes: Whether to reset unused codebook vectors periodically. + usage_threshold: Minimum usage threshold for codebook vectors to avoid being reset. + reset_interval: Number of calls before checking and resetting dead codebooks. """ - Custom layer normalization over the last dimension. - """ - mean = tf.reduce_mean(inputs, axis=-1, keepdims=True) - variance = tf.math.reduce_variance(inputs, axis=-1, keepdims=True) - normed = (inputs - mean) / tf.sqrt(variance + self.epsilon) - return self.gamma * normed + self.beta - - -class Decoder(layers.Layer): - def __init__(self, dim_input, dim_embed, dim_output, heads=4, names='decoder', **kwargs): - super().__init__() - self.dim_input = dim_input - self.dim_embed = dim_embed - self.dim_output = dim_output - self.heads = heads - self.names = names - self.epsilon = 1e-5 - self.scale = 1 / tf.sqrt(tf.cast(dim_embed, dtype=tf.float32)) - - def build(self, input_shape): - self.w_in = self.add_weight(shape=(self.dim_input, self.dim_embed), trainable=True, initializer='random_normal', - name=f'w_in_{self.names}') - self.b_in = self.add_weight(shape=(self.dim_embed,), trainable=True, initializer='zeros', - name=f'b_in_{self.names}') - # Learnable scale and bias for layer normalization. - self.gamma = self.add_weight(shape=(self.dim_embed,), initializer="ones", trainable=True, - name=f"ln_gamma_{self.names}") - self.beta = self.add_weight(shape=(self.dim_embed,), initializer="zeros", trainable=True, - name=f"ln_beta_{self.names}") - # attetnion - self.q = self.add_weight(shape=(self.heads, 1, self.dim_embed, self.dim_embed), trainable=True, - initializer='random_normal', name=f'query_{self.names}') - self.k = self.add_weight(shape=(self.heads, 1, self.dim_embed, self.dim_embed), trainable=True, - initializer='random_normal', name=f'key_{self.names}') - self.v = self.add_weight(shape=(self.heads, 1, self.dim_embed, self.dim_embed), trainable=True, - initializer='random_normal', name=f'value_{self.names}') - # project out - self.w_out = self.add_weight(shape=(int(self.heads * self.dim_embed), self.dim_output), trainable=True, - initializer='random_normal', name=f'w_out_{self.names}') - self.b_out = self.add_weight(shape=(self.dim_output,), trainable=True, initializer='zeros', - name=f'b_out_{self.names}') - - # mlp head - self.mlp_head1 = layers.Dense(self.dim_output, activation='tanh', name=f'mlp_head_{self.names}') - - def call(self, inputs): - Zq = inputs # (B,N,embed_dim), #(B,N,1), (1,) - x = tf.matmul(Zq, self.w_in) + self.b_in - x = self.layernorm(x) # (B,N,dim_embed) - # attention - query = tf.matmul(x, self.q) # (B,N,dim_emned)@(H,1,dim_embed,dim_embed)->(H,B,N,dim_embed) - key = tf.matmul(x, self.k) - value = tf.matmul(x, self.v) - qk = tf.einsum('hbni,hbji->hbnj', query, key) # (H,B,N,N) - qk *= self.scale - att = tf.nn.softmax(qk) - out = tf.matmul(att, value) # (H,B,N,N)@(H,B,N,dim_embed) - # out projection - out = tf.transpose(out, perm=[1, 2, 3, 0]) - b, h, n, o = tf.shape(out)[0], tf.shape(out)[-1], tf.shape(out)[1], tf.shape(out)[2] - out = tf.reshape(out, [b, n, h * o]) # (B, N, H * E) - out = tf.matmul(out, self.w_out) + self.b_out # (B,N,H*E)@(H*E,O)->(B,N,O) - # out = tf.nn.softmax(out) # Disable softmax for regression tasks - # out = tf.nn.sigmoid(out) - # mlp head - # out = self.mlp_head1(out) - return out - - def layernorm(self, inputs): - """ - Custom layer normalization over the last dimension. - """ - mean = tf.reduce_mean(inputs, axis=-1, keepdims=True) - variance = tf.math.reduce_variance(inputs, axis=-1, keepdims=True) - normed = (inputs - mean) / tf.sqrt(variance + self.epsilon) - return self.gamma * normed + self.beta - - -class SCQ_model(tf.keras.models.Model): - def __init__(self, input_dim=1024, general_embed_dim=128, codebook_dim=16, codebook_num=64, - discrete_loss=False, heads=4, names='SCQ_model', - weight_recon=1, weight_vq=0.2, **kwargs): - super().__init__() - self.input_dim = input_dim - self.general_embed_dim = general_embed_dim - self.codebook_dim = codebook_dim - self.codebook_num = codebook_num - self.discrete_loss = discrete_loss - self.heads = heads - self.names = names - self.weight_recon = tf.cast(weight_recon, tf.float32) - self.weight_vq = tf.cast(weight_vq, tf.float32) - # define model - # self.mlp_input = layers.Dense(self.input_dim, activation='swish', name=f'mlp_input_{self.names}') - self.encoder = Encoder(dim_input=self.input_dim, dim_embed=self.general_embed_dim, heads=self.heads) - - self.scq = SCQ(dim_input=self.general_embed_dim, dim_embed=self.codebook_dim, - num_embed=self.codebook_num, discrete_loss=self.discrete_loss) - - self.decoder = Decoder(dim_input=self.codebook_dim, dim_embed=self.general_embed_dim, - dim_output=self.input_dim, heads=self.heads) - # self.mlp_output = layers.Dense(self.input_dim, activation='swish', name=f'mlp_output_{self.names}') - - # Loss trackers - self.total_loss_tracker = tf.keras.metrics.Mean(name='total_loss') - self.recon_loss_tracker = tf.keras.metrics.Mean(name='recon_loss') - self.vq_loss_tracker = tf.keras.metrics.Mean(name='vq_loss') - self.perplexity_tracker = tf.keras.metrics.Mean(name='perplexity') - - @property - def metrics(self): - return [ - self.total_loss_tracker, - self.recon_loss_tracker, - self.vq_loss_tracker, - self.perplexity_tracker - ] - - def train_step(self, x): - with tf.GradientTape() as tape: - # Forward pass - # x = self.mlp_input(x) - encoded = self.encoder(x) - Zq, out_P_proj, vq_loss = self.scq(encoded) # (B,N,E),(B,N,K),(1,) - decoded = self.decoder(Zq) - # out_P_proj = self.mlp_output(out_P_proj) # (B,N,K) - - # Calculate losses using the new method - losses = self.compute_losses(x, decoded, vq_loss, out_P_proj) - - # Update weights - vars = self.trainable_weights - grads = tape.gradient(losses['total_loss'], vars) - self.optimizer.apply_gradients(zip(grads, vars)) - - # Update metrics - self.total_loss_tracker.update_state(losses['total_loss']) - self.recon_loss_tracker.update_state(losses['recon_loss']) - self.vq_loss_tracker.update_state(losses['vq_loss']) - self.perplexity_tracker.update_state(losses['perplexity']) - - return { - 'loss': self.total_loss_tracker.result(), - 'recon': self.recon_loss_tracker.result(), - 'vq': self.vq_loss_tracker.result(), - 'perplexity': self.perplexity_tracker.result() - } - - def test_step(self, data): - # Get inputs from data - x = data - - # Forward pass - encoded = self.encoder(x) - Zq, out_P_proj, vq_loss = self.scq(encoded) - decoded = self.decoder(Zq) - - # Calculate losses using the new method - losses = self.compute_losses(x, decoded, vq_loss, out_P_proj) - - # Update metrics - self.total_loss_tracker.update_state(losses['total_loss']) - self.recon_loss_tracker.update_state(losses['recon_loss']) - self.vq_loss_tracker.update_state(losses['vq_loss']) - self.perplexity_tracker.update_state(losses['perplexity']) - - return { - 'loss': self.total_loss_tracker.result(), - 'recon': self.recon_loss_tracker.result(), - 'vq': self.vq_loss_tracker.result(), - 'perplexity': self.perplexity_tracker.result() - } - - - - def call(self, inputs, training=False): - encoded = self.encoder(inputs) - Zq, out_P_proj, vq_loss = self.scq(encoded) # Ignore the loss output - decoded = self.decoder(Zq) - return decoded, Zq, out_P_proj # Return final output - - def compute_perplexity(slef, out_P_proj): - p_j = tf.reduce_mean(out_P_proj, axis=[0, 1]) # (B, N, K) -> (K,) - p_j = tf.clip_by_value(p_j, 1e-10, 1 - (1e-9)) - p_j = p_j / tf.reduce_sum(p_j) # Normalize to ensure sum to 1 - entropy = -tf.reduce_sum(p_j * tf.math.log(p_j) / tf.math.log(2.0)) # Entropy: -sum(p_j * log2(p_j)) - perplexity = tf.pow(2.0, entropy) # Perplexity: 2^entropy - return perplexity - - def compute_losses(self, x, decoded, vq_loss, out_P_proj): - """Compute all losses with improved numerical stability.""" - # Clip to avoid numerical issues - decoded_clipped = tf.clip_by_value(decoded, 1e-10, 1.0 - 1e-10) - - # Ensure tensors have compatible shapes - # Get input shapes for debugging - x_shape = tf.shape(x) - decoded_shape = tf.shape(decoded_clipped) - - # Reshape if necessary to ensure compatibility - if len(x.shape) != len(decoded_clipped.shape): - # Make sure both tensors are 3D (batch, seq_len, features) - if len(x.shape) == 2: - x = tf.expand_dims(x, axis=1) - if len(decoded_clipped.shape) == 2: - decoded_clipped = tf.expand_dims(decoded_clipped, axis=1) - - # Calculate reconstruction loss - element-wise cross-entropy - # We'll use the manual formula for more control over dimensions - epsilon = 1e-10 - # recon_loss = -tf.reduce_sum(x * tf.math.log(decoded_clipped + epsilon), axis=-1) - # recon_loss = tf.reduce_mean(tf.square(x - decoded)) - # for sigmoid - # recon_loss = tf.reduce_mean(tf.keras.losses.binary_crossentropy(x, tf.nn.sigmoid(decoded))) - # normal loss - recon_loss = tf.reduce_mean(tf.keras.losses.binary_crossentropy(x, decoded_clipped)) - - - # Compute perplexity (codebook usage metric) - perplexity = self.compute_perplexity(out_P_proj) - - # Add KL regularization to encourage more uniform codebook usage - p_j = tf.reduce_mean(out_P_proj, axis=[0, 1]) - print("p_j:", p_j) - p_uniform = tf.ones_like(p_j) / tf.cast(tf.shape(p_j)[0], tf.float32) - # Use tf.clip_by_value to prevent log(0) issues - p_j_safe = tf.clip_by_value(p_j, epsilon, 1.0) - p_uniform_safe = tf.clip_by_value(p_uniform, epsilon, 1.0) - kl_loss = tf.reduce_sum(p_j_safe * tf.math.log(p_j_safe / p_uniform_safe)) - # Combine losses with weights - total_loss = (self.weight_recon * recon_loss + - self.weight_vq * vq_loss + - 0.1 * kl_loss) - - return { - 'total_loss': total_loss, - 'recon_loss': recon_loss, - 'vq_loss': vq_loss, - 'kl_loss': kl_loss, - 'perplexity': perplexity - } - - -class UNet(tf.keras.models.Model): - def __init__(self, input_dim=1024, base_filters=64): - super().__init__() - self.input_dim = input_dim - - # Encoder layers - self.enc1 = layers.Dense(base_filters, activation='relu') - self.enc2 = layers.Dense(base_filters * 2, activation='relu') - self.enc3 = layers.Dense(base_filters * 4, activation='relu') - self.enc4 = layers.Dense(base_filters * 8, activation='relu') - - # Bottleneck - self.bottleneck = layers.Dense(base_filters * 16, activation='relu') - - # Decoder layers - self.dec4 = layers.Dense(base_filters * 8, activation='relu') - self.dec3 = layers.Dense(base_filters * 4, activation='relu') - self.dec2 = layers.Dense(base_filters * 2, activation='relu') - self.dec1 = layers.Dense(base_filters, activation='relu') - - # Output layer - self.output_layer = layers.Dense(input_dim, activation='sigmoid') - - def call(self, x): - # Encoder path - e1 = self.enc1(x) - e2 = self.enc2(e1) - e3 = self.enc3(e2) - e4 = self.enc4(e3) - - # Bottleneck - b = self.bottleneck(e4) - - # Decoder path with skip connections - d4 = self.dec4(b) + e4 - d3 = self.dec3(d4) + e3 - d2 = self.dec2(d3) + e2 - d1 = self.dec1(d2) + e1 - - # Output - return self.output_layer(d1) - - -'''import tensorflow as tf - -import tensorflow as tf - - -def random_one_hot_sequence(batch, seq_len, num_classes=21, class_probs=None): - """ - Generates a random one-hot encoded tensor of shape (batch, seq_len, num_classes) - using a multinomial distribution for more varied sampling. - - Args: - batch: Number of sequences (batch size). - seq_len: Length of each sequence. - num_classes: Number of classes for one-hot encoding (default is 21). - class_probs: Optional tensor of shape (num_classes,) defining the probability - distribution over classes. If None, assumes uniform distribution. - - Returns: - A tensor of shape (batch, seq_len, num_classes) with one-hot encoded values. - """ - # Define class probabilities (uniform if not provided) - if class_probs is None: - class_probs = tf.ones([num_classes], dtype=tf.float32) / num_classes - else: - class_probs = tf.convert_to_tensor([class_probs], dtype=tf.float32) - class_probs = class_probs / tf.reduce_sum(class_probs) # Normalize to sum to 1 - - # Expand class probabilities to match the number of samples - logits = tf.math.log(class_probs)[tf.newaxis, :] # Shape: (1, num_classes) - logits = tf.tile(logits, [batch * seq_len, 1]) # Shape: (batch * seq_len, num_classes) - - # Sample indices from the multinomial distribution - random_indices = tf.random.categorical(logits=logits, num_samples=1) # Shape: (batch * seq_len, 1) - random_indices = tf.reshape(random_indices, [batch, seq_len]) # Reshape to (batch, seq_len) - - # Apply one-hot encoding - one_hot_encoded = tf.one_hot(random_indices, depth=num_classes) - - return one_hot_encoded - - -def create_dataset(X, batch_size=1, is_training=True): - """ - simple function to create a TensorFlow dataset. - Args: - X: - batch_size: - is_training: - - Returns: - - """ - X = tf.convert_to_tensor(X, dtype=tf.float32) - - # Create dataset from tensor slices - dataset = tf.data.Dataset.from_tensor_slices(X) - - # Apply shuffling only for training data - if is_training: - dataset = dataset.shuffle(buffer_size=min(1000, len(X))) - - # Apply batching (drop_remainder=False to handle all data) - dataset = dataset.batch(batch_size) - - # Prefetch for better performance - dataset = dataset.prefetch(tf.data.AUTOTUNE) - - return dataset - - -import tensorflow as tf -import numpy as np -import pandas as pd -import os - -# # Set parameters -# os.makedirs('test_tmp', exist_ok=True) -# batch_size = 600 -# seq_length = 20 # Example sequence length -# feature_dim = 21 # Must match encoder input dim -# # Generate random input data (batch_size, seq_length, feature_dim) -# x_train = random_one_hot_sequence(batch_size, seq_length, feature_dim) -# # Initialize SCQ model -# model = SCQ_model(input_dim=feature_dim, general_embed_dim=128, codebook_dim=32, codebook_num=5, discrete_loss=False, heads=8) -# # Compile model -# model.compile(optimizer=keras.optimizers.Adam(learning_rate=0.001)) -# # Train model and capture history -# history = model.fit(x_train, epochs=1000, batch_size=batch_size) -# # Convert history to DataFrame and save as CSV -# history_df = pd.DataFrame(history.history) -# history_df.to_csv("test_tmp/model_history.csv", index=False) -# # Test model on new data -# x_test = random_one_hot_sequence(batch_size, seq_length, feature_dim) -# output = model(x_test) -# # Save input and output arrays as .npy files -# -# os.makedirs -# np.save("test_tmp/input_data.npy", x_test) -# np.savez("test_tmp/output_data.npz", decoded=output[0].numpy(), zq=output[1].numpy(), pj=output[2].numpy()) -# print("Training complete. Model history saved as 'model_history.csv'.") -# print("Input and output arrays saved as 'input_data.npy' and 'output_data.npy'.") -# print((output[2])) -# print(x_train[0]) - -# # Set parameters -# os.makedirs('test_tmp', exist_ok=True) -# batch_size = 4 -# seq_length = 1024 # this is the length of the latent from pep2vec -# feature_dim = 1 # we have the latent representation -# mhc1_pep2vec_embeddings = pd.read_parquet("../data/Pep2Vec/wrapper_mhc1.parquet") -# # Select the latent columns (the columns that has latent in their name) -# mhc1_latent_columns = [col for col in mhc1_pep2vec_embeddings.columns if 'latent' in col] -# print(f"Found {len(mhc1_latent_columns)} latent columns for MHC1") -# X_mhc1 = mhc1_pep2vec_embeddings[mhc1_latent_columns].values -# X = X_mhc1.reshape(-1, seq_length, feature_dim) -# from sklearn.model_selection import train_test_split -# X_train, X_test = train_test_split(X, test_size=0.2, random_state=42) -# -# # Create datasets -# train_dataset = create_dataset(X_train, batch_size=batch_size, is_training=True) -# test_dataset = create_dataset(X_test, batch_size=batch_size, is_training=False) -# -# # Initialize SCQ model -# model = SCQ_model(input_dim=feature_dim, general_embed_dim=128, codebook_dim=32, codebook_num=5, discrete_loss=False, heads=8) -# # Compile model -# model.compile(optimizer=keras.optimizers.Adam(learning_rate=0.001)) -# # Train model and capture history -# history = model.fit(train_dataset, epochs=20, batch_size=batch_size) -# # Convert history to DataFrame and save as CSV -# history_df = pd.DataFrame(history.history) -# history_df.to_csv("test_tmp/model_history.csv", index=False) -# -# # Test model on new data correctly by iterating through batches -# decoded_outputs = [] -# zq_outputs = [] -# pj_outputs = [] -# -# for batch in test_dataset: -# output = model(batch) -# decoded_outputs.append(output[0].numpy()) -# zq_outputs.append(output[1].numpy()) -# pj_outputs.append(output[2].numpy()) -# -# # Save input and output arrays as .npy files -# os.makedirs('test_tmp', exist_ok=True) -# np.save("test_tmp/input_data.npy", X_test) # Save the actual test data -# np.savez("test_tmp/output_data.npz", -# decoded=np.vstack(decoded_outputs), -# zq=np.vstack(zq_outputs), -# pj=np.vstack(pj_outputs)) -# -# print("Training complete. Model history saved as 'model_history.csv'.") -# print("Input and output arrays saved as 'input_data.npy' and 'output_data.npz'.") -# print("Shape of model outputs:", np.vstack(pj_outputs).shape) -''' -# class VQ_Layer(tf.keras.layers.Layer): -# def __init__(self, embedding_dim, num_embeddings, beta, **kwargs): -# super().__init__(**kwargs) -# self.embedding_dim = embedding_dim -# self.num_embeddings = num_embeddings -# self.beta = beta -# -# w_init = tf.random_uniform_initializer() -# self.embeddings = tf.Variable( -# initial_value=w_init(shape=(self.num_embeddings, self.embedding_dim), dtype="float32"), -# trainable=True, -# name="embeddings_vq" -# ) -# -# def call(self, inputs): -# input_shape = tf.shape(inputs) -# flat_inputs = tf.reshape(inputs, [-1, self.embedding_dim]) # (B*T, emb_dim) -# -# # Compute squared L2 distances -# a_sq = tf.reduce_sum(flat_inputs ** 2, axis=1, keepdims=True) # (B*T, 1) -# ab = 2 * tf.matmul(flat_inputs, tf.transpose(self.embeddings)) # (B*T, num_embeddings) -# b_sq = tf.reduce_sum(self.embeddings ** 2, axis=1) # (num_embeddings,) -# b_sq = tf.reshape(b_sq, [1, -1]) # (1, num_embeddings) -# -# distances = a_sq - ab + b_sq # (B*T, num_embeddings) -# -# # Find closest embeddings -# encoding_indices = tf.argmin(distances, axis=1) -# encodings = tf.one_hot(encoding_indices, self.num_embeddings) -# quantized = tf.matmul(encodings, self.embeddings) -# -# # Reshape quantized values to match input shape -# quantized = tf.reshape(quantized, input_shape) -# -# # Calculate VQ losses - straight-through estimator -# commitment_loss = tf.reduce_mean(tf.square(tf.stop_gradient(quantized) - inputs)) -# codebook_loss = tf.reduce_mean(tf.square(quantized - tf.stop_gradient(inputs))) -# vq_loss = commitment_loss + self.beta * codebook_loss -# -# # Add loss to layer's loss collection -# self.add_loss(vq_loss) -# -# # Straight-through estimator (copy gradients from quantized to inputs) -# quantized = inputs + tf.stop_gradient(quantized - inputs) -# -# # Optionally compute perplexity -# avg_probs = tf.reduce_mean(encodings, axis=0) -# perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) -# -# indices_reshaped = tf.reshape(encoding_indices, input_shape[:-1]) -# return quantized, indices_reshaped, perplexity -# -# def get_config(self): -# config = super().get_config() -# config.update({ -# "embedding_dim": self.embedding_dim, -# "num_embeddings": self.num_embeddings, -# "beta": self.beta -# }) -# return config - - -# original SCQ -class SCQ_layer(layers.Layer): - def __init__(self, num_embed, dim_embed, lambda_reg=0.5, proj_iter=10, - discrete_loss=True, beta_loss=0.25, reset_dead_codes=True, - usage_threshold=1e-3, reset_interval=2, **kwargs): super().__init__(**kwargs) self.num_embed = num_embed self.dim_embed = dim_embed @@ -794,7 +62,7 @@ def build(self, input_shape): # Projection weights to map input features into the embedding space. self.d_w = self.add_weight( shape=(self.dim_embed, self.dim_embed), - initializer='glorot_uniform', + initializer='random_normal', trainable=True, name='scq_w') self.d_b = self.add_weight( @@ -802,7 +70,6 @@ def build(self, input_shape): initializer='zeros', trainable=True, name='scq_b') - # Usage tracking for codebook vectors self.code_usage = self.add_weight( shape=(self.num_embed,), @@ -813,6 +80,18 @@ def build(self, input_shape): ) def call(self, inputs): + """ + Forward pass of the SCQ layer. + Args: + inputs: Input tensor of shape (B, N, dim_embed), where B is the batch size, + N is the number of input features, and dim_embed is the embedding dimension. + Returns: + Zq: Quantized output tensor of shape (B, N, dim_embed). + out_P_proj: + loss: The total loss calculated during the forward pass. + perplexity: The perplexity of the quantized output. + + """ # 1. Project inputs to the embedding space and apply layer normalization. x = tf.matmul(inputs, self.d_w) + self.d_b # (B, N, dim_embed) x = self.layernorm(x) @@ -820,8 +99,8 @@ def call(self, inputs): input_shape = tf.shape(x) # (B, N, dim_embed) flat_inputs = tf.reshape(x, [-1, self.dim_embed]) # (B*N, dim_embed) - # add a small epsilon to avoid numerical issues - flat_inputs = flat_inputs + tf.random.normal(tf.shape(flat_inputs), stddev=0.01) + # add a small epsilon to avoid numerical issues # TODO added + # flat_inputs = flat_inputs + tf.random.normal(tf.shape(flat_inputs), stddev=0.001) # 2. Compute hard VQ assignments as initialization. flat_detached = tf.stop_gradient(flat_inputs) @@ -834,7 +113,7 @@ def call(self, inputs): P_tilde = tf.one_hot(assign_indices, depth=self.num_embed, dtype=tf.float32) # (B*N, num_embed) P_tilde = tf.transpose(P_tilde) # (num_embed, B*N) - # Track codebook usage + # Track codebook usage # TODO added if self.reset_dead_codes: # Update usage counts (moving average) batch_usage = tf.reduce_mean(tf.transpose(P_tilde), axis=0) # (num_embed,) @@ -859,74 +138,137 @@ def call(self, inputs): # 4. Project each column of P_sol onto the probability simplex. P_proj = self.project_columns_to_simplex(P_sol) # (num_embed, B*N) out_P_proj = tf.transpose(P_proj) # (B*N, num_embed) + # save in a file for debugging + # print out for debugging + # tf.print("P_proj:", P_proj) + # tf.print("P_proj min:", tf.reduce_min(P_proj)) + # tf.print("P_proj max:", tf.reduce_max(P_proj)) + # tf.print("P_proj shape:", tf.shape(P_proj)) + # tf.print("out_P_proj1:", out_P_proj) + # tf.print("out_P_proj1 min:", tf.reduce_min(out_P_proj)) + # tf.print("out_P_proj1 max:", tf.reduce_max(out_P_proj)) + # tf.print("out_P_proj1 shape:", tf.shape(out_P_proj)) + out_P_proj = tf.reshape(out_P_proj, (input_shape[0], input_shape[1], -1)) # (B,N,num_embed) + # tf.print("out_P_proj2:", out_P_proj) + # tf.print("out_P_proj2 min:", tf.reduce_min(out_P_proj)) + # tf.print("out_P_proj2 max:", tf.reduce_max(out_P_proj)) + # tf.print("out_P_proj2 shape:", tf.shape(out_P_proj)) + + # compute perplexity + perplexity = self.compute_perplexity(out_P_proj) # (B,N,num_embed) + # tf.print("perplexity out_proj2:", perplexity) + + # average over the last dimension + # out_P_proj = tf.reduce_mean(out_P_proj, axis=-1, keepdims=True) # (B,N,1) + # tf.print("out_P_proj3:", out_P_proj) + # tf.print("out_P_proj3 min:", tf.reduce_min(out_P_proj)) + # tf.print("out_P_proj3 max:", tf.reduce_max(out_P_proj)) + # tf.print("out_P_proj3 shape:", tf.shape(out_P_proj)) + + # # check if the shape of out_P_proj is (B,N,1) + # if out_P_proj.shape[-1] != 1: + # raise ValueError(f"Expected out_P_proj shape to be (B,N,1), but got {out_P_proj.shape}") # 5. Reconstruct quantized output: Z_q = C * P_proj. Zq_flat = tf.matmul(C, P_proj) # (dim_embed, B*N) Zq = tf.transpose(Zq_flat) # (B*N, dim_embed) - # 6. calculate quantization loss, combined commitment and codebook losses + # 6. Calculate quantization loss and add regularization penalties + # Calculate common regularization terms first + p_mean = tf.reduce_mean(out_P_proj, axis=[0, 1]) # Average usage across batch (num_embed,) + # Ensure probabilities sum to 1 for stable entropy calculation + p_mean_normalized = p_mean / (tf.reduce_sum(p_mean) + self.epsilon) + # Maximize entropy: encourages uniform cluster usage. Negative sign makes it a penalty. + # Adding epsilon inside log avoids log(0). + entropy_reg = -tf.reduce_sum(p_mean_normalized * tf.math.log(p_mean_normalized + self.epsilon)) + + # Calculate cosine similarities between codebook vectors + norm_codebook = tf.nn.l2_normalize(self.embed_w, axis=0) # (dim_embed, num_embed) + similarities = tf.matmul(tf.transpose(norm_codebook), norm_codebook) # (num_embed, num_embed) + # Create a mask to ignore self-similarities (diagonal) + mask = tf.ones_like(similarities) - tf.eye(self.num_embed) + masked_similarities = similarities * mask + # Penalize positive cosine similarities between different codebook vectors + # Encourages codebook vectors to be dissimilar (orthogonal ideally) + diversity_loss = tf.reduce_mean(tf.nn.relu(masked_similarities)) + + # Define weights for regularization terms (these can be tuned) + alpha_entropy = 0.5 # Weight for entropy regularization penalty + alpha_diversity = 0.5 # Weight for diversity penalty + + # Calculate the primary loss based on discrete_loss flag if not self.discrete_loss: - # Add regularization to encourage more uniform codebook usage - p_uniform = tf.ones([self.num_embed], dtype=tf.float32) / tf.cast(self.num_embed, tf.float32) - p_mean = tf.reduce_mean(out_P_proj, axis=[0, 1]) # Average usage across batch - entropy_reg = -tf.reduce_sum(p_mean * tf.math.log(p_mean + 1e-10)) # Maximize entropy - - # Calculate cosine similarities between codebook vectors - norm_codebook = tf.nn.l2_normalize(self.embed_w, axis=0) # (dim_embed, num_embed) - similarities = tf.matmul(tf.transpose(norm_codebook), norm_codebook) # (num_embed, num_embed) - - # Create a mask to ignore self-similarities - mask = tf.ones_like(similarities) - tf.eye(self.num_embed) - masked_similarities = similarities * mask - - # Penalize high similarities between different codebook vectors - diversity_loss = tf.reduce_mean(tf.nn.relu(masked_similarities - 0.05)) # Penalize similarities > 0.05 - - # Combine with existing loss - loss = tf.reduce_mean((Zq - flat_inputs) ** 2) + 1.0 * entropy_reg + 0.5 * diversity_loss - + # Original SCQ loss (quantization error) + primary_loss = tf.reduce_mean((Zq - flat_inputs) ** 2) else: + # VQ-VAE style loss commitment_loss = tf.reduce_mean((tf.stop_gradient(Zq) - flat_inputs) ** 2) - codebook_loss = tf.reduce_mean((Zq - flat_detached) ** 2) - loss = ( + codebook_loss = tf.reduce_mean((Zq - tf.stop_gradient(flat_inputs)) ** 2) # Corrected VQ codebook loss + primary_loss = ( (tf.cast(1 - self.beta_loss, tf.float32) * commitment_loss) + (tf.cast(self.beta_loss, tf.float32) * codebook_loss) ) + # Combine primary loss with regularization penalties + loss = primary_loss + alpha_entropy * entropy_reg + alpha_diversity * diversity_loss + Zq = tf.reshape(Zq, input_shape) # (B, N, dim_embed) self.add_loss(loss) # Register the loss with the layer - hard_indices = tf.argmax(out_P_proj, axis=-1) # (B,N) + # Get hard indices and create one-hot representation # TODO added + # hard_indices = tf.argmax(out_P_proj, axis=-1) # (B,N) + # cast to int32 for one-hot encoding + # out_P_proj_cast = tf.cast(out_P_proj*10, tf.int32) # (B,N,num_embed) + # one_hot_indices = tf.one_hot(hard_indices, depth=self.num_embed) # (B,N,num_embed) # 7. Calculate perplexity (similar to VQ layer) - flat_P_proj = tf.reshape(out_P_proj, [-1, self.num_embed]) # (B*N, num_embed) - avg_probs = tf.reduce_mean(flat_P_proj, axis=0) # (num_embed,) - perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) + # flat_P_proj = tf.reshape(out_P_proj, [-1, self.num_embed]) # (B*N, num_embed) + # avg_probs = tf.reduce_mean(flat_P_proj, axis=0) # (num_embed,) + # perplexity = tf.exp(-tf.reduce_sum(avg_probs * tf.math.log(avg_probs + 1e-10))) - return Zq, out_P_proj, loss, perplexity, hard_indices + return Zq, out_P_proj, loss, perplexity def project_columns_to_simplex(self, P_sol): + """Projects columns of a matrix to the probability simplex.""" + # Transpose to work with rows instead of columns P_t = tf.transpose(P_sol) # (B*N, num_embed) + # Sort rows in descending order sorted_P = tf.sort(P_t, axis=1, direction='DESCENDING') + # Compute cumulative sums and thresholds cumsum = tf.cumsum(sorted_P, axis=1) k = tf.range(1, tf.shape(sorted_P)[1] + 1, dtype=tf.float32) thresholds = (cumsum - 1.0) / k + # Find maximum valid index per row (cast to int32 explicitly) valid_mask = sorted_P > thresholds max_indices = tf.argmax( tf.cast(valid_mask, tf.int32) * tf.range(tf.shape(sorted_P)[1], dtype=tf.int32), axis=1 ) - max_indices = tf.cast(max_indices, tf.int32) + max_indices = tf.cast(max_indices, tf.int32) # Explicit cast to int32 + # Gather required cumulative sums batch_indices = tf.range(tf.shape(P_t)[0], dtype=tf.int32) gather_indices = tf.stack([batch_indices, max_indices], axis=1) + # Rest of the code remains the same... selected_cumsum = tf.gather_nd(cumsum, gather_indices) theta = (selected_cumsum - 1.0) / tf.cast(max_indices + 1, tf.float32) + # Apply projection and transpose back P_projected = tf.nn.relu(P_t - theta[:, tf.newaxis]) return tf.transpose(P_projected) + def compute_perplexity(slef, out_P_proj): + p_j = tf.reduce_mean(out_P_proj, axis=[0, 1]) # (B, N, K) -> (K,) + p_j = tf.clip_by_value(p_j, 1e-10, 1 - (1e-9)) + p_j = p_j / tf.reduce_sum(p_j) # Normalize to ensure sum to 1 + entropy = -tf.reduce_sum(p_j * tf.math.log(p_j) / tf.math.log(2.0)) # Entropy: -sum(p_j * log2(p_j)) + perplexity = tf.pow(2.0, entropy) # Perplexity: 2^entropy + return perplexity + def layernorm(self, inputs): + """ + Custom layer normalization over the last dimension. + """ mean = tf.reduce_mean(inputs, axis=-1, keepdims=True) variance = tf.math.reduce_variance(inputs, axis=-1, keepdims=True) normed = (inputs - mean) / tf.sqrt(variance + self.epsilon) @@ -954,6 +296,7 @@ def _reset_dead_codes(self, encoder_outputs): self.embed_w[:, dead_idx].assign(tf.reshape(new_vector, [self.dim_embed])) self.code_usage[dead_idx].assign(0.2) + class SCQ1DAutoEncoder(keras.Model): def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, scq_params, initial_codebook, **kwargs): @@ -972,8 +315,6 @@ def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, ]) # SCQ Layer for quantization - # self.scq_layer = SCQ_layer(num_embed=self.num_embeddings, dim_embed=self.embedding_dim, - # beta_loss=self.commitment_beta, discrete_loss=False) self.scq_layer = SCQ_layer(num_embed=self.num_embeddings, dim_embed=self.embedding_dim, beta_loss=self.commitment_beta, **scq_params) @@ -1007,13 +348,26 @@ def call(self, inputs, training=False): x = tf.expand_dims(x, axis=1) # (batch_size, 1, embedding_dim) # SCQ: Quantize the embedding - quantized, indices, vq_loss, perplexity, hard_indices = self.scq_layer(x) + # This now returns one-hot encodings instead of soft probabilities + Zq, out_P_proj, vq_loss, perplexity = self.scq_layer(x) # Decoder: Reconstruct from quantized embedding - y = tf.squeeze(quantized, axis=1) # (batch_size, embedding_dim) + y = tf.squeeze(Zq, axis=1) # (batch_size, embedding_dim) output = self.decoder(y) # (batch_size, 1024) - return output, quantized, indices, vq_loss, perplexity, hard_indices + return output, Zq, out_P_proj, vq_loss, perplexity + + # # Method to get just the latent sequence and one-hot encodings for inference + # def encode(self, inputs): + # """Encode inputs to latent sequence and one-hot cluster assignments.""" + # x = self.encoder(inputs) # (batch_size, embedding_dim) + # x = tf.expand_dims(x, axis=1) # (batch_size, 1, embedding_dim) + # + # # Get quantized embedding and one-hot encodings + # quantized, one_hot_encodings, _, _ = self.scq_layer(x) + # + # # Return quantized latent sequence and one-hot encodings + # return tf.squeeze(quantized, axis=1), tf.squeeze(one_hot_encodings, axis=1) @property def metrics(self): @@ -1032,15 +386,15 @@ def train_step(self, data): x = y = data with tf.GradientTape() as tape: - reconstruction, quantized, indices, vq_loss, perplexity, hard_indices = self(x, training=True) + reconstruction, Zq, _, vq_loss, perplexity = self(x, training=True) # Reconstruction loss recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) # Feature matching loss with tape.stop_recording(): - _, mid_features, _, _, _, _ = self(reconstruction, training=False) - orig_mid_features = quantized + _, mid_features, _, _, _ = self(reconstruction, training=False) + orig_mid_features = Zq feature_loss = tf.reduce_mean(tf.math.squared_difference(orig_mid_features, mid_features)) # Total loss @@ -1081,7 +435,7 @@ def test_step(self, data): else: x = y = data - reconstruction, _, _, vq_loss, perplexity, hard_indices = self(x, training=False) + reconstruction, quantized, _, vq_loss, perplexity = self(x, training=False) recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) total_loss = recon_loss + vq_loss + self.commitment_beta * tf.reduce_mean( tf.math.squared_difference(x, reconstruction)) @@ -1093,105 +447,3 @@ def test_step(self, data): return {m.name: m.result() for m in self.metrics} - -# class CodebookUsageCallback(tf.keras.callbacks.Callback): -# """ -# Callback to monitor and adjust codebook usage during training. -# """ -# -# def __init__(self, test_input, plot_freq=5, min_perplexity_ratio=0.5): -# """ -# Args: -# test_input: A small batch of test data to monitor codebook usage -# plot_freq: How often to check usage (in epochs) -# min_perplexity_ratio: Minimum ratio of perplexity to num_embeddings -# """ -# super().__init__() -# self.test_input = test_input -# self.plot_freq = plot_freq -# self.min_perplexity_ratio = min_perplexity_ratio -# self.usage_history = [] -# self.perplexity_history = [] -# -# def on_epoch_end(self, epoch, logs=None): -# # Get the current model outputs for test data -# outputs = self.model(self.test_input, training=False) -# _, _, indices, _, perplexity = outputs -# -# # Convert indices to flat array if using VQ -# if isinstance(indices, tf.Tensor) and len(indices.shape) > 1: -# indices = tf.reshape(indices, [-1]) -# -# # Compute usage statistics -# if hasattr(self.model, 'vq_layer') and hasattr(self.model.vq_layer, 'code_usage'): -# # If using SCQ with explicit usage tracking -# usage = self.model.vq_layer.code_usage.numpy() -# elif isinstance(indices, tf.Tensor): -# # For VQ, compute usage from indices -# unique_indices, counts = tf.unique_with_counts(indices) -# usage = np.zeros(self.model.num_embeddings) -# for idx, count in zip(unique_indices.numpy(), counts.numpy()): -# usage[idx] = count / tf.size(indices).numpy() -# -# # Record history -# self.usage_history.append(usage) -# self.perplexity_history.append(perplexity.numpy()) -# -# # Print status -# if epoch % self.plot_freq == 0: -# perplexity_ratio = perplexity.numpy() / self.model.num_embeddings -# num_used = np.sum(usage > 0.001) # Codes with >0.1% usage -# -# print(f"\nEpoch {epoch} - Codebook stats:") -# print(f" Perplexity: {perplexity.numpy():.2f} / {self.model.num_embeddings} = {perplexity_ratio:.2%}") -# print( -# f" Active codes: {num_used} / {self.model.num_embeddings} = {num_used / self.model.num_embeddings:.2%}") -# -# # Take corrective action if usage is too low -# if perplexity_ratio < self.min_perplexity_ratio: -# print(" WARNING: Low codebook usage detected!") -# -# # If we have SCQ layer, modify parameters -# if hasattr(self.model, 'vq_layer') and hasattr(self.model.vq_layer, 'lambda_reg'): -# # Decrease regularization to allow more code usage -# old_lambda = self.model.vq_layer.lambda_reg -# new_lambda = max(old_lambda * 0.8, 0.05) # Decrease by 20% with a minimum -# print(f" Adjusting lambda_reg: {old_lambda:.4f} -> {new_lambda:.4f}") -# self.model.vq_layer.lambda_reg = new_lambda -# -# # Force code reset -# if hasattr(self.model.vq_layer, '_reset_dead_codes'): -# # Get encoder outputs from test data -# # This assumes encoder output is the input to vq_layer -# # You may need to adjust based on your actual architecture -# encoder_output = self.test_input -# for layer in self.model.layers: -# if layer == self.model.vq_layer: -# break -# encoder_output = layer(encoder_output) -# -# # Force reset of dead codes -# flat_encoder_output = tf.reshape(encoder_output, [-1, self.model.embedding_dim]) -# self.model.vq_layer._reset_dead_codes(flat_encoder_output) -# print(" Forced reset of dead codebook vectors") - - -# Example Usage: -# Assuming input images are 128x128 pixels with 3 channels -# input_shape = (128, 128, 3) -# num_clusters = 512 # Number of desired clusters (codebook size) -# latent_dim = 64 # Dimension of each vector in the codebook and bottleneck - -# model = VQUnet(input_shape=input_shape, num_embeddings=num_clusters, embedding_dim=latent_dim) -# model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=1e-4)) - -# # Prepare your dataset (e.g., tf.data.Dataset) -# # train_dataset = ... -# # test_dataset = ... - -# # Train the model -# # model.fit(train_dataset, epochs=10, validation_data=test_dataset) - -# # After training, you can get outputs: -# # test_images, _ = next(iter(test_dataset.batch(4))) -# # reconstruction, quantized_latent, cluster_map = model.predict(test_images) \ No newline at end of file From 7f5f4e9ad80788561f9de75b1a1571023cb98536 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 29 Apr 2025 19:00:35 +0200 Subject: [PATCH 23/83] MoE init --- utils/model.py | 160 +++++++++++++++++++++++++++++++++++++++++++++++++ 1 file changed, 160 insertions(+) diff --git a/utils/model.py b/utils/model.py index 068412a10..6947d0d36 100644 --- a/utils/model.py +++ b/utils/model.py @@ -447,3 +447,163 @@ def test_step(self, data): return {m.name: m.result() for m in self.metrics} + +class SparseDispatcher: + """Helper for dispatching inputs to experts and combining expert outputs.""" + def __init__(self, num_experts, gates): + # gates: [batch, num_experts] float tensor + self.num_experts = num_experts + self.gates = gates # shape [B, E] + # Find nonzero gate entries + indices = tf.where(gates > 0) + # Sort by expert_idx then batch_idx for consistency + sort_order = tf.argsort(indices[:,1] * tf.cast(tf.shape(gates)[0], indices.dtype) + indices[:,0]) + sorted_indices = tf.gather(indices, sort_order) + self.batch_index = sorted_indices[:,0] + self.expert_index = sorted_indices[:,1] + # Count number of samples per expert + self.part_sizes = tf.reduce_sum(tf.cast(gates > 0, tf.int32), axis=0) + # Extract the nonzero gate values + self.nonzero_gates = tf.gather_nd(gates, sorted_indices) + + def dispatch(self, inputs): + """inputs: [batch, ...] -> Returns list of [num_samples_i, ...]""" + inputs_expanded = tf.gather(inputs, self.batch_index) + parts = tf.split(inputs_expanded, self.part_sizes, axis=0) + return parts + + def combine(self, expert_outputs, multiply_by_gates=True): + """expert_outputs: list of [num_samples_i, output_dim] -> Returns [batch, output_dim]""" + stitched = tf.concat(expert_outputs, axis=0) + if multiply_by_gates: + stitched = stitched * tf.expand_dims(self.nonzero_gates, axis=1) + batch_size = tf.shape(self.gates)[0] + combined = tf.math.unsorted_segment_sum(stitched, self.batch_index, batch_size) + return combined + +class Expert(layers.Layer): + """A binary prediction expert.""" + def __init__(self, input_dim, hidden_dim, output_dim=1): + super().__init__() + self.fc1 = layers.Dense(hidden_dim, activation='relu') + self.fc2 = layers.Dense(output_dim) + + def call(self, x): + x = self.fc1(x) + x = self.fc2(x) + return tf.nn.sigmoid(x) + +class MixtureOfExperts(layers.Layer): + """Mixture of Experts layer using provided cluster probabilities.""" + def __init__(self, input_dim, hidden_dim, num_experts, use_provided_gates=True): + super().__init__() + self.num_experts = num_experts + self.use_provided_gates = use_provided_gates + self.experts = [Expert(input_dim, hidden_dim) for _ in range(num_experts)] + + def call(self, inputs, training=False): + if self.use_provided_gates: + if isinstance(inputs, tuple) and len(inputs) == 2: + x, cluster_probs = inputs + gates = tf.nn.softmax(cluster_probs, axis=-1) + else: + raise ValueError("Inputs must be a tuple of (features, cluster_probs) when use_provided_gates=True") + + experts_used = tf.reduce_sum(tf.cast(gates > 0.01, tf.float32), axis=1) + expert_influence = tf.reduce_sum(gates, axis=0) + expert_activation_count = tf.reduce_sum(tf.cast(gates > 0.01, tf.float32), axis=0) + + dispatcher = SparseDispatcher(self.num_experts, gates) + expert_inputs = dispatcher.dispatch(x) + + expert_outputs = [] + for i in range(self.num_experts): + expert_output = tf.cond( + tf.greater(tf.shape(expert_inputs[i])[0], 0), + lambda: self.experts[i](expert_inputs[i]), + lambda: tf.zeros((0, 1), dtype=tf.float32) + ) + expert_outputs.append(expert_output) + + y = dispatcher.combine(expert_outputs, multiply_by_gates=True) + + return { + 'prediction': y, + 'gates': gates, + 'experts_used': experts_used, + 'expert_influence': expert_influence, + 'expert_activation_count': expert_activation_count + } + +class MoEModel(tf.keras.Model): + """Model wrapping the MoE layer.""" + def __init__(self, input_dim, hidden_dim, num_experts): + super().__init__() + self.moe_layer = MixtureOfExperts(input_dim, hidden_dim, num_experts) + + def call(self, inputs, training=False): + moe_outputs = self.moe_layer(inputs, training=training) + if training: + return moe_outputs['prediction'] + return moe_outputs + + def train_step(self, data): + x, y = data + with tf.GradientTape() as tape: + moe_outputs = self.moe_layer(x, training=True) + y_pred = moe_outputs['prediction'] + loss = self.compiled_loss(y, y_pred, regularization_losses=self.losses) + trainable_vars = self.trainable_variables + gradients = tape.gradient(loss, trainable_vars) + self.optimizer.apply_gradients(zip(gradients, trainable_vars)) + y = tf.squeeze(y) if len(y.shape) > 1 else y + y_pred = tf.squeeze(y_pred) if len(y_pred.shape) > 1 else y_pred + self.compiled_metrics.update_state(y, y_pred) + return {m.name: m.result() for m in self.metrics} + +# Example usage +if __name__ == "__main__": + # Generate dummy dataset + num_samples = 10000 + feature_dim = 128 + num_clusters = 32 + + features = tf.random.normal([num_samples, feature_dim]) + labels = tf.random.uniform([num_samples, 1], minval=0, maxval=2, dtype=tf.int32) + random_logits = tf.random.normal([num_samples, num_clusters]) + cluster_probs = tf.nn.softmax(random_logits, axis=-1) + + # Create dataset + dataset = tf.data.Dataset.from_tensor_slices(((features, cluster_probs), labels)) + dataset = dataset.batch(32) + + # Split into train and test + train_size = int(0.8 * num_samples) + train_dataset = dataset.take(train_size // 32) + test_dataset = dataset.skip(train_size // 32) + + # Create and compile model + model = MoEModel(input_dim=feature_dim, hidden_dim=256, num_experts=num_clusters) + model.compile(optimizer='adam', loss='binary_crossentropy', metrics=[tf.keras.metrics.BinaryAccuracy()]) + + # Train + print("Training model...") + model.fit(train_dataset, epochs=5, validation_data=test_dataset, verbose=1) + + # Evaluate + print("\nEvaluating model...") + results = model.evaluate(test_dataset, return_dict=True) + print(f"Test loss: {results['loss']:.4f}, Test accuracy: {results['binary_accuracy']:.4f}") + + # Predict and analyze + sample_features, sample_labels = next(iter(test_dataset)) + predictions = model(sample_features, training=False) + + print(f"\nSample predictions shape: {predictions['prediction'].shape}") + print(f"First 5 predictions:\n{predictions['prediction'][:5].numpy()}") + print(f"First 5 actual labels:\n{sample_labels[:5].numpy()}") + print(f"Average experts used per sample: {tf.reduce_mean(predictions['experts_used']):.2f}") + print(f"Expert influence distribution: {predictions['expert_influence'].numpy()}") + + top_experts = tf.argsort(predictions['expert_influence'], direction='DESCENDING')[:5] + print(f"Top 5 most influential experts: {top_experts.numpy()}") \ No newline at end of file From 50d9559c8260c33e58546f1d20318ae6bf0a65cd Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 30 Apr 2025 14:48:16 +0200 Subject: [PATCH 24/83] Working MoE with simulated data --- utils/model.py | 491 +++++++++++++++++++++++++++++++++++++++++-------- 1 file changed, 412 insertions(+), 79 deletions(-) diff --git a/utils/model.py b/utils/model.py index 6947d0d36..a2bf1663f 100644 --- a/utils/model.py +++ b/utils/model.py @@ -448,6 +448,7 @@ def test_step(self, data): return {m.name: m.result() for m in self.metrics} +########### Mixture of Experts (MoE) model ########### class SparseDispatcher: """Helper for dispatching inputs to experts and combining expert outputs.""" def __init__(self, num_experts, gates): @@ -481,11 +482,13 @@ def combine(self, expert_outputs, multiply_by_gates=True): combined = tf.math.unsorted_segment_sum(stitched, self.batch_index, batch_size) return combined + class Expert(layers.Layer): - """A binary prediction expert.""" + """A binary prediction expert with added complexity using GLU.""" + def __init__(self, input_dim, hidden_dim, output_dim=1): super().__init__() - self.fc1 = layers.Dense(hidden_dim, activation='relu') + self.fc1 = layers.Dense(hidden_dim, activation='relu', input_shape=(input_dim,)) self.fc2 = layers.Dense(output_dim) def call(self, x): @@ -493,117 +496,447 @@ def call(self, x): x = self.fc2(x) return tf.nn.sigmoid(x) + class MixtureOfExperts(layers.Layer): - """Mixture of Experts layer using provided cluster probabilities.""" - def __init__(self, input_dim, hidden_dim, num_experts, use_provided_gates=True): + """Mixture of Experts layer with optional learned gating network.""" + + def __init__(self, input_dim, hidden_dim, num_experts, use_provided_gates=True, + gating_hidden_dim=64, top_k=None): super().__init__() self.num_experts = num_experts self.use_provided_gates = use_provided_gates + self.top_k = top_k # If set, only route to top_k experts self.experts = [Expert(input_dim, hidden_dim) for _ in range(num_experts)] + # Add a learned gating network if we might use it + if not use_provided_gates: + self.gating_network = tf.keras.Sequential([ + layers.Dense(gating_hidden_dim, activation='relu', input_shape=(input_dim,)), + layers.Dense(num_experts, activation='softmax') + ]) + def call(self, inputs, training=False): - if self.use_provided_gates: - if isinstance(inputs, tuple) and len(inputs) == 2: - x, cluster_probs = inputs - gates = tf.nn.softmax(cluster_probs, axis=-1) + if isinstance(inputs, tuple) and len(inputs) == 2: + x, gates = inputs + else: + x = inputs + gates = None + + # Determine the gates to use + if gates is None or not self.use_provided_gates: + if hasattr(self, 'gating_network'): + # Use learned gating if available + gates = self.gating_network(x) else: - raise ValueError("Inputs must be a tuple of (features, cluster_probs) when use_provided_gates=True") - - experts_used = tf.reduce_sum(tf.cast(gates > 0.01, tf.float32), axis=1) - expert_influence = tf.reduce_sum(gates, axis=0) - expert_activation_count = tf.reduce_sum(tf.cast(gates > 0.01, tf.float32), axis=0) + # Fall back to uniform distribution + batch_size = tf.shape(x)[0] + gates = tf.ones([batch_size, self.num_experts]) / self.num_experts + + # Apply top-k gating if configured + if self.top_k is not None and self.top_k < self.num_experts: + # Get values and indices of top-k gate values + _, top_k_indices = tf.math.top_k(gates, k=self.top_k) + # Create a mask for the top_k gates (1 for top-k, 0 for others) + mask = tf.reduce_sum( + tf.one_hot(top_k_indices, depth=self.num_experts), + axis=1 + ) + # Zero out non-top-k gates and renormalize + gates = gates * mask + gates = gates / (tf.reduce_sum(gates, axis=-1, keepdims=True) + 1e-10) + # Create dispatcher with these gates dispatcher = SparseDispatcher(self.num_experts, gates) + + # Dispatch inputs to experts expert_inputs = dispatcher.dispatch(x) - expert_outputs = [] - for i in range(self.num_experts): - expert_output = tf.cond( - tf.greater(tf.shape(expert_inputs[i])[0], 0), - lambda: self.experts[i](expert_inputs[i]), - lambda: tf.zeros((0, 1), dtype=tf.float32) - ) - expert_outputs.append(expert_output) + expert_outputs = [ + expert(inp) + for expert, inp in zip(self.experts, expert_inputs) + ] - y = dispatcher.combine(expert_outputs, multiply_by_gates=True) + # Combine expert outputs + combined_outputs = dispatcher.combine(expert_outputs) return { - 'prediction': y, + 'prediction': combined_outputs, 'gates': gates, - 'experts_used': experts_used, - 'expert_influence': expert_influence, - 'expert_activation_count': expert_activation_count + 'expert_outputs': expert_outputs if training else None } class MoEModel(tf.keras.Model): - """Model wrapping the MoE layer.""" - def __init__(self, input_dim, hidden_dim, num_experts): + """Model wrapping the MoE layer with optional learned gating.""" + def __init__(self, input_dim, hidden_dim, num_experts, use_provided_gates=True, + gating_hidden_dim=64, top_k=None): super().__init__() - self.moe_layer = MixtureOfExperts(input_dim, hidden_dim, num_experts) + self.use_provided_gates = use_provided_gates + self.moe_layer = MixtureOfExperts( + input_dim, + hidden_dim, + num_experts, + use_provided_gates=use_provided_gates, + gating_hidden_dim=gating_hidden_dim, + top_k=top_k + ) def call(self, inputs, training=False): + # Handle both cases: with and without provided gates moe_outputs = self.moe_layer(inputs, training=training) - if training: - return moe_outputs['prediction'] - return moe_outputs + return moe_outputs if not training else moe_outputs['prediction'] def train_step(self, data): - x, y = data + if isinstance(data, tuple): + x, y = data + else: + raise ValueError("Training data must include both inputs and labels") + with tf.GradientTape() as tape: - moe_outputs = self.moe_layer(x, training=True) - y_pred = moe_outputs['prediction'] - loss = self.compiled_loss(y, y_pred, regularization_losses=self.losses) - trainable_vars = self.trainable_variables - gradients = tape.gradient(loss, trainable_vars) - self.optimizer.apply_gradients(zip(gradients, trainable_vars)) - y = tf.squeeze(y) if len(y.shape) > 1 else y - y_pred = tf.squeeze(y_pred) if len(y_pred.shape) > 1 else y_pred - self.compiled_metrics.update_state(y, y_pred) - return {m.name: m.result() for m in self.metrics} + # Forward pass - handle both input types + if isinstance(x, tuple) and len(x) == 2: + # Input includes features and gates + inputs, gates = x + outputs = self.moe_layer((inputs, gates), training=True) + else: + # Input is just features, gates will be computed by gating network + outputs = self.moe_layer(x, training=True) + + predictions = outputs['prediction'] + + # Compute loss + loss = self.compiled_loss(y, predictions, regularization_losses=self.losses) + + # Add expert load balancing loss + gates = outputs['gates'] + expert_usage = tf.reduce_mean(gates, axis=0) + load_balancing_loss = tf.reduce_sum(expert_usage * tf.math.log(expert_usage + 1e-10)) * 0.01 + total_loss = loss + load_balancing_loss + + # Compute gradients and update weights + gradients = tape.gradient(total_loss, self.trainable_variables) + self.optimizer.apply_gradients(zip(gradients, self.trainable_variables)) + + # Update metrics + self.compiled_metrics.update_state(y, predictions) + + # Return metrics + results = {m.name: m.result() for m in self.metrics} + results.update({'loss': loss, 'load_balancing_loss': load_balancing_loss}) + return results + + def test_step(self, data): + if isinstance(data, tuple): + x, y = data + else: + raise ValueError("Test data must include both inputs and labels") + + # Forward pass - handle both input types + if isinstance(x, tuple) and len(x) == 2: + # Input includes features and gates + inputs, gates = x + outputs = self.moe_layer((inputs, gates), training=False) + else: + # Input is just features, gates will be computed by gating network + outputs = self.moe_layer(x, training=False) + + predictions = outputs['prediction'] + + # Compute loss + loss = self.compiled_loss(y, predictions, regularization_losses=self.losses) + + # Update metrics + self.compiled_metrics.update_state(y, predictions) + + # Return metrics + results = {m.name: m.result() for m in self.metrics} + results.update({'loss': loss}) + return results + + +def visualize_dataset_analysis(features, labels, cluster_probs, method='pca', raw_dot_plot=False, feature_indices=None): + """ + Visualize the relationship between features, labels, and cluster probabilities. + + Args: + features: TensorFlow tensor containing feature vectors + labels: TensorFlow tensor containing labels + cluster_probs: TensorFlow tensor containing cluster probabilities + method: Dimensionality reduction method ('umap', 'tsne', or 'pca') + raw_dot_plot: If True, plot raw feature values directly + feature_indices: Indices of features to plot (tuple of 2 indices) + """ + import matplotlib.pyplot as plt + import numpy as np + + # Convert tensors to numpy arrays + features_np = features.numpy() + labels_np = labels.numpy().flatten() + cluster_probs_np = cluster_probs.numpy() + + # Compute dominant cluster for each sample + dominant_clusters = np.argmax(cluster_probs_np, axis=1) + + if raw_dot_plot: + # Plot raw feature values directly without dimensionality reduction + feature_indices = feature_indices or (0, 1) # Default to first two features + + # Create figure with two subplots + fig, (ax1, ax2) = plt.subplots(1, 2, figsize=(15, 6)) + + # Scatter by true label + scatter1 = ax1.scatter( + features_np[:, feature_indices[0]], + features_np[:, feature_indices[1]], + c=labels_np, + cmap='viridis', + s=10, + alpha=0.6 + ) + ax1.set_title(f'Raw Features: Colored by Label') + ax1.set_xlabel(f'Feature {feature_indices[0]}') + ax1.set_ylabel(f'Feature {feature_indices[1]}') + cbar1 = plt.colorbar(scatter1, ax=ax1) + cbar1.set_label('Label') + + # Scatter by dominant cluster + n_clusters = cluster_probs_np.shape[1] + cmap_clusters = plt.cm.get_cmap('tab20b', n_clusters) if n_clusters <= 20 else plt.cm.get_cmap('gist_ncar', n_clusters) + + scatter2 = ax2.scatter( + features_np[:, feature_indices[0]], + features_np[:, feature_indices[1]], + c=dominant_clusters, + cmap=cmap_clusters, + s=10, + alpha=0.6 + ) + ax2.set_title(f'Raw Features: Colored by Cluster') + ax2.set_xlabel(f'Feature {feature_indices[0]}') + ax2.set_ylabel(f'Feature {feature_indices[1]}') + cbar2 = plt.colorbar(scatter2, ax=ax2, ticks=range(n_clusters)) + cbar2.set_label('Cluster ID') + + plt.tight_layout() + plt.savefig(f'raw_feature_analysis.png', dpi=300, bbox_inches='tight') + plt.show() + return + + # Original dimensionality reduction visualization + try: + if method == 'umap': + import umap + reducer = umap.UMAP(n_neighbors=30, min_dist=0.1, n_components=2, random_state=42) + features_2d = reducer.fit_transform(features_np) + method_name = "UMAP" + elif method == 'tsne': + from sklearn.manifold import TSNE + reducer = TSNE(n_components=2, perplexity=30, n_iter=1000, random_state=42) + features_2d = reducer.fit_transform(features_np) + method_name = "t-SNE" + else: # default to PCA + from sklearn.decomposition import PCA + reducer = PCA(n_components=2) + features_2d = reducer.fit_transform(features_np) + method_name = "PCA" + except ImportError: + # Fall back to PCA if the requested method is not available + from sklearn.decomposition import PCA + reducer = PCA(n_components=2) + features_2d = reducer.fit_transform(features_np) + method_name = "PCA" + print(f"Warning: {method} not available, falling back to PCA") + + # Prepare subplots + fig, (ax1, ax2) = plt.subplots(1, 2, figsize=(15, 6)) + + # Scatter by true label + scatter1 = ax1.scatter( + features_2d[:, 0], + features_2d[:, 1], + c=labels_np, + cmap='viridis', + s=10, + alpha=0.6 + ) + ax1.set_title(f'Samples by Label ({method_name})') + ax1.set_xlabel(f'{method_name} Component 1') + ax1.set_ylabel(f'{method_name} Component 2') + cbar1 = plt.colorbar(scatter1, ax=ax1) + cbar1.set_label('Label') + + # Scatter by dominant cluster with improved discrete colormap + n_clusters = cluster_probs_np.shape[1] + # Use a better colormap for distinguishing clusters + cmap_clusters = plt.cm.get_cmap('tab20b', n_clusters) if n_clusters <= 20 else plt.cm.get_cmap('gist_ncar', n_clusters) + + # Add confidence information - marker size based on max probability + max_probs = np.max(cluster_probs_np, axis=1) + marker_sizes = 10 + 40 * max_probs # Scale confidence to marker size + + scatter2 = ax2.scatter( + features_2d[:, 0], + features_2d[:, 1], + c=dominant_clusters, + cmap=cmap_clusters, + s=marker_sizes, + alpha=0.6, + edgecolors='none' + ) + ax2.set_title(f'Samples by Dominant Cluster ({method_name})') + ax2.set_xlabel(f'{method_name} Component 1') + ax2.set_ylabel(f'{method_name} Component 2') + cbar2 = plt.colorbar(scatter2, ax=ax2, ticks=range(n_clusters)) + cbar2.set_label('Cluster ID') + + plt.tight_layout() + plt.savefig(f'cluster_analysis_{method}.png', dpi=300, bbox_inches='tight') + plt.show() # Example usage if __name__ == "__main__": - # Generate dummy dataset - num_samples = 10000 + # Generate dummy dataset with clustered data and labels for training + num_train_samples = 8000 + num_test_samples = 2000 feature_dim = 128 num_clusters = 32 - features = tf.random.normal([num_samples, feature_dim]) - labels = tf.random.uniform([num_samples, 1], minval=0, maxval=2, dtype=tf.int32) - random_logits = tf.random.normal([num_samples, num_clusters]) - cluster_probs = tf.nn.softmax(random_logits, axis=-1) - - # Create dataset - dataset = tf.data.Dataset.from_tensor_slices(((features, cluster_probs), labels)) - dataset = dataset.batch(32) - - # Split into train and test - train_size = int(0.8 * num_samples) - train_dataset = dataset.take(train_size // 32) - test_dataset = dataset.skip(train_size // 32) + # Function to generate dataset with specified parameters + def generate_dataset(num_samples, feature_dim, num_clusters, epsilon=0.1): + # Compute samples per cluster + base_count = num_samples // num_clusters + counts = [base_count + (1 if i < num_samples % num_clusters else 0) for i in range(num_clusters)] + + features_list = [] + labels_list = [] + cluster_probs_list = [] + distributions = ['normal', 'uniform', 'gamma', 'poisson'] + + for c in range(num_clusters): + cluster_count = counts[c] + n0 = cluster_count // 2 + n1 = cluster_count - n0 + dist = distributions[(2 * c) % len(distributions)] + print(f"Cluster {c}: {dist} distribution, {n0} samples 0, {n1} samples 1") + + if dist == 'normal': + features_0 = tf.random.normal([n0, feature_dim], mean=c, stddev=1.0) + elif dist == 'uniform': + features_0 = tf.random.uniform([n0, feature_dim], minval=0, maxval=1) + elif dist == 'gamma': + features_0 = tf.random.gamma([n0, feature_dim], alpha=2.0, beta=1.0) + elif dist == 'poisson': + features_0 = tf.cast(tf.random.poisson([n0, feature_dim], lam=3), tf.float32) + else: + features_0 = tf.random.normal([n0, feature_dim], mean=c, stddev=1.0) + + if dist == 'normal': + features_1 = tf.random.normal([n1, feature_dim], mean=c+0.5, stddev=1.5) + elif dist == 'uniform': + features_1 = tf.random.uniform([n1, feature_dim], minval=1, maxval=2) + elif dist == 'gamma': + features_1 = tf.random.gamma([n1, feature_dim], alpha=5.0, beta=2.0) + elif dist == 'poisson': + features_1 = tf.cast(tf.random.poisson([n1, feature_dim], lam=6), tf.float32) + else: + features_1 = tf.random.normal([n1, feature_dim], mean=c+0.5, stddev=1.5) + + features_i = tf.concat([features_0, features_1], axis=0) + labels_i = tf.concat([tf.zeros([n0, 1], tf.int32), tf.ones([n1, 1], tf.int32)], axis=0) + features_list.append(features_i) + labels_list.append(labels_i) + + # Generate random cluster probabilities per sample + cluster_indices = tf.fill([cluster_count], c) + lam_value = tf.maximum(tf.cast(c, tf.float32) + 1.0, 1.0) + noise = tf.cast(tf.random.poisson([cluster_count, num_clusters], lam=lam_value), tf.float32) + noise = noise + epsilon + probs = noise / (tf.reduce_sum(noise, axis=1, keepdims=True)) + alpha = tf.random.uniform([cluster_count, 1], minval=0.5, maxval=0.8) + probs = (1 - alpha) * probs + alpha * tf.one_hot(cluster_indices, num_clusters) + probs = probs / tf.reduce_sum(probs, axis=1, keepdims=True) + cluster_probs_list.append(probs) + + features = tf.concat(features_list, axis=0) + labels = tf.concat(labels_list, axis=0) + cluster_probs = tf.concat(cluster_probs_list, axis=0) + + # Shuffle dataset + indices = tf.random.shuffle(tf.range(tf.shape(features)[0])) + features = tf.gather(features, indices) + labels = tf.gather(labels, indices) + cluster_probs = tf.gather(cluster_probs, indices) + + return features, labels, cluster_probs + + # Generate training dataset + print("\nGenerating training dataset...") + train_features, train_labels, train_cluster_probs = generate_dataset( + num_train_samples, feature_dim, num_clusters) + + # Generate separate test dataset + print("\nGenerating test dataset...") + test_features, test_labels, test_cluster_probs = generate_dataset( + num_test_samples, feature_dim, num_clusters, epsilon=1) + + print(f"\nTraining labels min: {tf.reduce_min(train_labels)}, max: {tf.reduce_max(train_labels)}") + print(f"Training labels head: {train_labels[:5]}") + print(f"Test labels min: {tf.reduce_min(test_labels)}, max: {tf.reduce_max(test_labels)}") + print(f"Test labels head: {test_labels[:5]}") + + # Visualize training dataset + print("\nVisualizing training dataset...") + visualize_dataset_analysis(train_features, train_labels, train_cluster_probs, + raw_dot_plot=False, method='pca', feature_indices=(0, 1)) + + # Create training dataset + train_dataset = tf.data.Dataset.from_tensor_slices( + ((train_features, train_cluster_probs), train_labels) + ).shuffle(1000).batch(64) + + # Create test dataset (no need to shuffle extensively) + test_dataset = tf.data.Dataset.from_tensor_slices( + ((test_features, test_cluster_probs), test_labels) + ).batch(64) + + # Print info about test dataset + for features, labels in test_dataset.take(1): + print(f"\nTest features shape: {features[0].shape}, Test labels shape: {labels.shape}") + print(f"Test features head: {features[0][:3]}") + print(f"Test labels head: {labels[:3]}") # Create and compile model - model = MoEModel(input_dim=feature_dim, hidden_dim=256, num_experts=num_clusters) - model.compile(optimizer='adam', loss='binary_crossentropy', metrics=[tf.keras.metrics.BinaryAccuracy()]) - - # Train - print("Training model...") - model.fit(train_dataset, epochs=5, validation_data=test_dataset, verbose=1) - - # Evaluate - print("\nEvaluating model...") - results = model.evaluate(test_dataset, return_dict=True) - print(f"Test loss: {results['loss']:.4f}, Test accuracy: {results['binary_accuracy']:.4f}") + model = MoEModel(feature_dim, hidden_dim=8, num_experts=num_clusters, use_provided_gates=True) + model.compile( + optimizer=tf.keras.optimizers.Adam(learning_rate=0.001), + loss=tf.keras.losses.BinaryCrossentropy(), + metrics=['accuracy'], + ) + + # Train model + print("\nTraining model...") + model.fit(train_dataset, epochs=20) + + # Evaluate on independent test set + print("\nEvaluating on independent test set...") + eval_results = model.evaluate(test_dataset) + print(f"Evaluation results: {eval_results}") # Predict and analyze - sample_features, sample_labels = next(iter(test_dataset)) - predictions = model(sample_features, training=False) - - print(f"\nSample predictions shape: {predictions['prediction'].shape}") - print(f"First 5 predictions:\n{predictions['prediction'][:5].numpy()}") - print(f"First 5 actual labels:\n{sample_labels[:5].numpy()}") - print(f"Average experts used per sample: {tf.reduce_mean(predictions['experts_used']):.2f}") - print(f"Expert influence distribution: {predictions['expert_influence'].numpy()}") + # test_batch = next(iter(test_dataset.take(1))) + # predictions = model(test_batch[0], training=False) + # print(f"Sample predictions shape: {predictions['prediction'].shape}") + # print(f"Gate activations: {tf.reduce_mean(predictions['gates'], axis=0)}") + + # Test on a single sample + for (feat, cluster_prob), label in test_dataset.unbatch().take(1): + feat = tf.expand_dims(feat, 0) + cluster_prob = tf.expand_dims(cluster_prob, 0) + output = model((feat, cluster_prob), training=False) + print("Single sample prediction:", output['prediction'].numpy()[0], "True label:", label.numpy()) + print("Gate activations:", tf.reduce_mean(output['gates'], axis=0).numpy()) + + # Optional: Visualize test dataset + print("\nVisualizing test dataset...") + visualize_dataset_analysis(test_features, test_labels, test_cluster_probs, + raw_dot_plot=False, method='pca', feature_indices=(0, 1)) - top_experts = tf.argsort(predictions['expert_influence'], direction='DESCENDING')[:5] - print(f"Top 5 most influential experts: {top_experts.numpy()}") \ No newline at end of file From c12549821bf10bff208f786cef3f7d36d301e2a9 Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 30 Apr 2025 15:21:26 +0200 Subject: [PATCH 25/83] automatic cpu cores assignment --- run_pep2vec.py | 152 ++++++++++++++++++++++++++++--------------------- 1 file changed, 86 insertions(+), 66 deletions(-) diff --git a/run_pep2vec.py b/run_pep2vec.py index 97daa199d..8dc6f4c02 100644 --- a/run_pep2vec.py +++ b/run_pep2vec.py @@ -126,57 +126,71 @@ def select_columns(df, columns): # return chain def add_binding_label(df_path, train_path, test_path, output_dir=None): - """ - Add binding labels to the DataFrame based on allotype and peptide pairs. - - Parameters: - ----------- - df_path : DataFrame, str, or directory path - DataFrame, path to a file, or directory containing multiple files to add binding labels to - train_path : str - Path to training data CSV file with binding labels - test_path : str - Path to test data CSV file with binding labels - output_dir : str, optional - Directory to save labeled files, if None will overwrite original files - - Returns: - -------- - DataFrame or dict of DataFrames with binding labels added - """ - # Load train and test binding label mappings - train_df = pd.read_csv(train_path) - test_df = pd.read_csv(test_path) - - # Create binding label mappings - train_binding_labels = { - (row["allele"], row["long_mer"]): row["binding_label"] - for _, row in train_df.iterrows() - } - - test_binding_labels = { - (row["allele"], row["long_mer"]): row["binding_label"] - for _, row in test_df.iterrows() - } - - # Check if df_path is a directory - if isinstance(df_path, str) and os.path.isdir(df_path): - # Process all files in the directory - results = {} - for filename in os.listdir(df_path): - file_path = os.path.join(df_path, filename) - if os.path.isfile(file_path) and (file_path.endswith('.csv') or file_path.endswith('.parquet')): - print(f"Processing file: {filename}") - results[filename] = process_single_file( - file_path, train_binding_labels, test_binding_labels, output_dir - ) - return results - else: - # Process a single file or DataFrame - return process_single_file(df_path, train_binding_labels, test_binding_labels, output_dir) + """ + Add binding labels and MHC sequences to the DataFrame based on allotype and peptide pairs. + + Parameters: + ----------- + df_path : DataFrame, str, or directory path + DataFrame, path to a file, or directory containing multiple files to add binding labels to + train_path : str + Path to training data CSV file with binding labels + test_path : str + Path to test data CSV file with binding labels + output_dir : str, optional + Directory to save labeled files, if None will overwrite original files + + Returns: + -------- + DataFrame or dict of DataFrames with binding labels and MHC sequences added + """ + # Load train and test binding label mappings + train_df = pd.read_csv(train_path) + test_df = pd.read_csv(test_path) + + # Create binding label mappings + train_binding_labels = { + (row["allele"], row["long_mer"]): row["binding_label"] + for _, row in train_df.iterrows() + } + + test_binding_labels = { + (row["allele"], row["long_mer"]): row["binding_label"] + for _, row in test_df.iterrows() + } + + # Create MHC sequence mappings + train_mhc_sequences = { + row["allele"]: row["mhc_sequence"] + for _, row in train_df.iterrows() + } + + test_mhc_sequences = { + row["allele"]: row["mhc_sequence"] + for _, row in test_df.iterrows() + } + + # Combine MHC sequence mappings (test data takes precedence if duplicates) + mhc_sequences = {**train_mhc_sequences, **test_mhc_sequences} + + # Check if df_path is a directory + if isinstance(df_path, str) and os.path.isdir(df_path): + # Process all files in the directory + results = {} + for filename in os.listdir(df_path): + file_path = os.path.join(df_path, filename) + if os.path.isfile(file_path) and (file_path.endswith('.csv') or file_path.endswith('.parquet')): + print(f"Processing file: {filename}") + results[filename] = process_single_file( + file_path, train_binding_labels, test_binding_labels, mhc_sequences, output_dir + ) + return results + else: + # Process a single file or DataFrame + return process_single_file(df_path, train_binding_labels, test_binding_labels, mhc_sequences, output_dir) -def process_single_file(df_or_path, train_binding_labels, test_binding_labels, output_dir=None): +def process_single_file(df_or_path, train_binding_labels, test_binding_labels, mhc_sequences, output_dir=None): """Helper function to process a single file or DataFrame""" # Process the provided dataframe or file if isinstance(df_or_path, str): @@ -205,12 +219,16 @@ def process_single_file(df_or_path, train_binding_labels, test_binding_labels, o lambda row: binding_labels.get((row["allotype"], row["peptide"])), axis=1 ) + # Add MHC sequence + df["mhc_sequence"] = df["allotype"].map(mhc_sequences) else: # CSV file naming convention df["binding_label"] = df.apply( lambda row: binding_labels.get((row["allele"], row["long_mer"])), axis=1 ) + # Add MHC sequence + df["mhc_sequence"] = df["allele"].map(mhc_sequences) # Map string labels to integers label_mapping = { @@ -252,8 +270,8 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0): } # Column configuration - columns = ["allele", "long_mer", "binding_label"] - rename_map = {"allele": "allotype", "long_mer": "peptide"} + columns = ["allele", "long_mer", "binding_label", "mhc_sequence"] + rename_map = {"allele": "allotype", "long_mer": "peptide"} # required for pep2vec # Load and process datasets datasets = {} @@ -346,32 +364,34 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0): # f.write(f"{allele} (Error: {str(e)})\n") # print(f"Error processing allele {allele}: {str(e)}") + # automatically get the number of cores + num_cores = os.cpu_count()-2 for i in range(k): train_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"train_set_fold_{i}.csv") output_file = os.path.join(output_dir, f"pep2vec_output_fold_{i}.parquet") - os.system(f"./Pep2Vec/pep2vec.bin --num_processes 300 --num_threads 14 --dataset {train_file} --output_location {output_file} --mhctype {mhc_type}") + os.system(f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {train_file} --output_location {output_file} --mhctype {mhc_type}") validation_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"val_set_fold_{i}.csv") output_file = os.path.join(output_dir, f"pep2vec_output_val_fold_{i}.parquet") - os.system(f"./Pep2Vec/pep2vec.bin --num_processes 300 --num_threads 14 --dataset {validation_file} --output_location {output_file} --mhctype {mhc_type}") + os.system(f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {validation_file} --output_location {output_file} --mhctype {mhc_type}") # test set test_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", "test_set.csv") output_file = os.path.join(output_dir, f"pep2vec_output_test_fold_{i}.parquet") - os.system(f"./Pep2Vec/pep2vec.bin --num_processes 300 --num_threads 14 --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") + os.system(f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") ############################################### if __name__ == "__main__": - # main("Conbotnet", "mhc2") - # add_binding_label( - # df_path=os.path.join("data", "Pep2Vec", "Conbotnet"), - # train_path=os.path.join("data", "Conbotnet", "train.csv"), - # test_path=os.path.join("data", "Conbotnet", "test_all.csv"), - # output_dir=os.path.join("data", "Pep2Vec", "Conbotnet_new") - # ) - main("ConvNeXT-MHC", "mhc1", 0.01) + main("Conbotnet", "mhc2", 0.01) add_binding_label( - df_path=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC"), - train_path=os.path.join("data", "ConvNeXT-MHC", "train.csv"), - test_path=os.path.join("data", "ConvNeXT-MHC", "test_all.csv"), - output_dir=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC_subset_new") + df_path=os.path.join("data", "Pep2Vec", "Conbotnet"), + train_path=os.path.join("data", "Conbotnet", "train.csv"), + test_path=os.path.join("data", "Conbotnet", "test_all.csv"), + output_dir=os.path.join("data", "Pep2Vec", "Conbotnet_new") ) + # main("ConvNeXT-MHC", "mhc1", 0.01) + # add_binding_label( + # df_path=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC"), + # train_path=os.path.join("data", "ConvNeXT-MHC", "train.csv"), + # test_path=os.path.join("data", "ConvNeXT-MHC", "test_all.csv"), + # output_dir=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC_subset_new") + # ) From 42cffdfffbaf6ba078ef417adec8057e79384014 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 6 May 2025 15:45:03 +0200 Subject: [PATCH 26/83] Add visualization and training pipeline for Mixture-of-Experts (MoE) model --- run_pMHC_DL.py | 649 +++++++++++++++++++++++++++++++++++++++++++++++-- utils/model.py | 37 ++- 2 files changed, 659 insertions(+), 27 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index 9cda9f59c..fd7db2fb0 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -1,4 +1,4 @@ - +import json import os import tensorflow as tf import numpy as np @@ -7,7 +7,11 @@ import matplotlib.pyplot as plt from sklearn.model_selection import train_test_split from sklearn.cluster import KMeans -from utils.model import SCQ1DAutoEncoder +import seaborn as sns +from sklearn.decomposition import PCA + +from utils.model import SCQ1DAutoEncoder, MoEModel + ''' # Set TensorFlow logging level for more information tf.get_logger().setLevel('INFO') @@ -543,7 +547,7 @@ def simple_run(batch_size=1): # traceback.print_exc() # simple run simple_run()''' -from sklearn.model_selection import train_test_split + '''import os import numpy as np @@ -917,6 +921,8 @@ def run_scq_pipeline(data_path, output_dir="test_tmp", run_param_search=True, # TODO implement a simple training pipeline for VQUnet def train_and_evaluate_scqvae( data_path, + val_data_path=None, + input_type='latent1024', # Options: 'latent1024', 'pMHC-sequence' num_embeddings=32, embedding_dim=64, # Increased from 32 batch_size=32, # Increased from 1 @@ -936,6 +942,7 @@ def train_and_evaluate_scqvae( Args: data_path: Path to the parquet file containing peptide embeddings + input_type: Type of input data ('latent1024' or 'pMHC-sequence') num_embeddings: Number of clusters/codes in the codebook embedding_dim: Dimension of each codebook vector batch_size: Batch size for training @@ -957,26 +964,280 @@ def train_and_evaluate_scqvae( os.makedirs(output_dir, exist_ok=True) # --- Helper Functions --- - def create_dataset(X, batch_size=32, is_training=True): - """Create a TensorFlow dataset from input array X.""" + def create_dataset(X, y=None, batch_size=32, is_training=True): + """Create a TensorFlow dataset from input array X and optional labels y.""" # X shape: (num_samples, seq_length) - dataset = tf.data.Dataset.from_tensor_slices(X) + # y shape: (num_samples, ...) or None + if y is not None: + # Create dataset with both features and labels, ensuring features are float32 + dataset = tf.data.Dataset.from_tensor_slices((tf.cast(X, tf.float32), y)) + else: + # Create dataset with just features, ensuring features are float32 + dataset = tf.data.Dataset.from_tensor_slices(tf.cast(X, tf.float32)) + if is_training: - dataset = dataset.shuffle(buffer_size=len(X)) # Shuffle all samples - dataset = dataset.batch(batch_size) # Result shape: (batch_size, seq_length) + # dataset = dataset.shuffle(buffer_size=len(X)) # Shuffle all samples + pass + dataset = dataset.batch(batch_size) dataset = dataset.prefetch(tf.data.AUTOTUNE) # Prefetch for better performance return dataset - def load_data(data_path, test_size=0.2, random_state=42): - """Load and prepare data for training.""" - embeddings = pd.read_parquet(data_path) - latent_columns = [col for col in embeddings.columns if 'latent' in col] - print(f"Found {len(latent_columns)} latent columns") - X = embeddings[latent_columns].values - seq_length = len(latent_columns) - X = X.reshape(-1, seq_length) - X_train, X_test = train_test_split(X, test_size=test_size, random_state=random_state) - return X_train, X_test, seq_length + def load_data(data_path, val_data_path=None, test_size=0.2, random_state=42, input_type='latent1024'): + """ + Load and prepare data for training with simplified validation. + + Args: + data_path: Path to training data parquet file + val_data_path: Optional path to validation data + test_size: Fraction of data to use for validation if val_data_path is None + random_state: Random seed for reproducibility + input_type: Type of input data ('latent1024' or 'pMHC-sequence') + + Returns: + X_train: Training data features with unique indices + X_test: Test/validation data features with unique indices + X_val: Validation data features with unique indices + y_train: Training data labels + y_test: Test/validation data labels + y_val: Validation data labels + seq_length: Length of each sequence including the index feature + """ + print(f"Loading training data from {data_path}") + df = pd.read_parquet(data_path) + + # Add original indices to track samples + df['original_idx'] = np.arange(len(df)) + + # Handle different input types + if input_type == 'latent1024': + columns = [col for col in df.columns if 'latent' in col] + if not columns: + raise ValueError("No latent columns found in the dataset") + seq_length = len(columns) + print(f"Found {seq_length} latent columns") + elif input_type == 'pMHC-sequence': + # Only check for peptide column as mhc_sequence is now optional + if 'peptide' not in df.columns: + raise ValueError("Required column 'peptide' not found in the dataset") + columns = ['peptide'] + if 'mhc_sequence' in df.columns: + columns.append('mhc_sequence') + print(f"Using sequence columns: {columns}") + # Note: pMHC-sequence processing would be implemented here + raise NotImplementedError("pMHC-sequence input not yet implemented") + else: + raise ValueError(f"Unknown input_type: {input_type}. Expected 'latent1024' or 'pMHC-sequence'") + + label_col = 'binding_label' + y = df[label_col].values + + # Extract original indices to ensure uniqueness across splits + original_indices = df['original_idx'].values + + # Extract features and clean data + X = df[columns].values + if np.isnan(X).any() or np.isinf(X).any(): + print("Warning: Dataset contains NaN or Inf values. Replacing with zeros.") + X = np.nan_to_num(X) + + # Add index as an additional feature + X_with_idx = np.column_stack((original_indices.reshape(-1, 1), X)) + + # Reshape with the added index column + seq_length_with_idx = seq_length + 1 + X_with_idx = X_with_idx.reshape(-1, seq_length_with_idx) + + print(f"Data shape with indices: {X_with_idx.shape}, Data range: [{np.min(X):.4f}, {np.max(X):.4f}]") + print(f"Label distribution: {np.bincount(y.astype(int) if y.dtype != object else [0])}") + + # Initialize test variables + X_test = None + y_test = None + + # Handle validation data if provided + if val_data_path: + try: + print(f"Loading validation data from {val_data_path}") + val_df = pd.read_parquet(val_data_path) + + # Create unique indices for validation data by offsetting from training data + val_df['original_idx'] = np.arange(len(val_df)) + len(df) + 1000 # Add 1000 as buffer + + val_X = val_df[columns].values + val_indices = val_df['original_idx'].values + + if np.isnan(val_X).any() or np.isinf(val_X).any(): + print("Warning: Validation set contains NaN or Inf values. Replacing with zeros.") + val_X = np.nan_to_num(val_X) + + # Extract validation labels + if label_col is not None and label_col in val_df.columns: + val_y = val_df[label_col].values + else: + print("Warning: No binding label column found in validation data. Using dummy labels.") + val_y = np.zeros(len(val_df)) + + # Add indices to validation features + X_test = np.column_stack((val_indices.reshape(-1, 1), val_X)) + X_test = X_test.reshape(-1, seq_length_with_idx) + y_test = val_y + + print(f"Validation data shape with indices: {X_test.shape}") + print(f"Validation label distribution: {np.bincount(y_test.astype(int) if y_test.dtype != object else [0])}") + except Exception as e: + print(f"Error loading validation data: {e}") + X_test = None + y_test = None + + # Split training data for validation set (the indices will automatically be split correctly) + X_train, X_val, y_train, y_val = train_test_split(X_with_idx, y, test_size=test_size, random_state=random_state) + print(f"Training data shape with indices: {X_train.shape}, Validation data shape: {X_val.shape}") + print(f"Training label distribution: {np.bincount(y_train.astype(int) if y_train.dtype != object else [0])}") + print(f"Validation label distribution: {np.bincount(y_val.astype(int) if y_val.dtype != object else [0])}") + + # Verify index uniqueness + all_indices = np.concatenate([ + X_train[:, 0], + X_val[:, 0], + X_test[:, 0] if X_test is not None else np.array([]) + ]) + unique_indices = np.unique(all_indices) + if len(unique_indices) != len(all_indices): + print("Warning: Some indices are not unique across data splits!") + else: + print(f"Successfully created {len(unique_indices)} unique indices across all data splits") + + return X_train, X_test, X_val, y_train, y_test, y_val, seq_length_with_idx + + # def load_data_hash(data_path, val_data_path=None, test_size=0.2, random_state=42, input_type='latent1024', cache=True): + # """ + # Load and prepare data for training with advanced features. + # + # Args: + # data_path: Path to training data parquet file + # val_data_path: Optional path to validation data + # test_size: Fraction of data to use for validation if val_data_path is None + # random_state: Random seed for reproducibility + # input_type: Type of input data ('latent1024' or 'pMHC-sequence') + # cache: Whether to cache results to avoid reprocessing + # + # Returns: + # X_train: Training data + # X_test: Test/validation data + # X_val: Validation data (None if val_data_path is None and data is loaded from cache) + # seq_length: Length of each sequence + # """ + # import hashlib + # import os + # from functools import lru_cache + # + # # Create a cache key based on the input parameters + # cache_key = f"{os.path.basename(data_path)}_{test_size}_{random_state}_{input_type}" + # if val_data_path: + # cache_key += f"_{os.path.basename(val_data_path)}" + # cache_file = f".cache_{hashlib.md5(cache_key.encode()).hexdigest()}.npz" + # + # # Check if cached results exist + # if cache and os.path.exists(cache_file): + # print(f"Loading cached data from {cache_file}") + # cached = np.load(cache_file, allow_pickle=True) + # X_val = cached['X_val'] if 'X_val' in cached else None + # return cached['X_train'], cached['X_test'], X_val, int(cached['seq_length']) + # + # # Efficient ID generation with caching + # @lru_cache(maxsize=10000) + # def generate_id(f1, f2): + # combined = f"{f1}-{f2}" + # return hashlib.sha256(combined.encode('utf-8')).hexdigest() + # + # # Load and validate training data + # try: + # print(f"Loading training data from {data_path}") + # df = pd.read_parquet(data_path) + # + # # Validate required columns exist + # required_cols = ['mhc_sequence', 'peptide'] + # missing_cols = [col for col in required_cols if col not in df.columns] + # if missing_cols: + # raise ValueError(f"Missing required columns: {missing_cols}") + # + # # Generate unique IDs + # df['unique_id'] = df.apply(lambda row: generate_id(row['mhc_sequence'], row['peptide']), axis=1) + # + # # Handle different input types + # if input_type == 'latent1024': + # columns = [col for col in df.columns if 'latent' in col] + # if not columns: + # raise ValueError("No latent columns found in the dataset") + # seq_length = len(columns) + # print(f"Found {seq_length} latent columns") + # elif input_type == 'pMHC-sequence': + # columns = ['mhc_sequence', 'peptide'] + # print(f"Using pMHC sequence columns: {columns}") + # # Note: pMHC-sequence processing would be implemented here + # raise NotImplementedError("pMHC-sequence input not yet implemented") + # else: + # raise ValueError(f"Unknown input_type: {input_type}. Expected 'latent1024' or 'pMHC-sequence'") + # + # # Extract features and check for invalid values + # X = df[columns].values + # if np.isnan(X).any() or np.isinf(X).any(): + # print("Warning: Dataset contains NaN or Inf values. Replacing with zeros.") + # X = np.nan_to_num(X) + # + # X = X.reshape(-1, seq_length) + # print(f"Data shape: {X.shape}, Data range: [{np.min(X):.4f}, {np.max(X):.4f}]") + # + # # Initialize X_val + # X_val = None + # + # # Handle validation data + # if val_data_path: + # try: + # print(f"Loading validation data from {val_data_path}") + # val_df = pd.read_parquet(val_data_path) + # val_df['unique_id'] = val_df.apply(lambda row: generate_id(row['mhc_sequence'], row['peptide']), axis=1) + # + # # Check for data leakage + # train_ids = set(df['unique_id']) + # val_ids = set(val_df['unique_id']) + # overlap = train_ids.intersection(val_ids) + # if overlap: + # print(f"Warning: {len(overlap)} overlapping samples between training and validation sets") + # + # val_X = val_df[columns].values + # if np.isnan(val_X).any() or np.isinf(val_X).any(): + # print("Warning: Validation set contains NaN or Inf values. Replacing with zeros.") + # val_X = np.nan_to_num(val_X) + # + # X_val = val_X.reshape(-1, seq_length) + # print(f"Validation data shape: {X_val.shape}") + # + # # Still split training data for test set + # X_train, X_test = train_test_split(X, test_size=test_size, random_state=random_state) + # except Exception as e: + # print(f"Error loading validation data: {e}") + # # Continue with default split if validation data loading fails + # X_train, X_test = train_test_split(X, test_size=test_size, random_state=random_state) + # else: + # print(f"Splitting data with test_size={test_size}") + # X_train, X_test = train_test_split(X, test_size=test_size, random_state=random_state) + # + # # Save to cache + # if cache: + # print(f"Caching results to {cache_file}") + # if X_val is not None: + # np.savez(cache_file, X_train=X_train, X_test=X_test, X_val=X_val, seq_length=seq_length) + # else: + # np.savez(cache_file, X_train=X_train, X_test=X_test, seq_length=seq_length) + # + # return X_train, X_test, X_val, seq_length + # + # except Exception as e: + # print(f"Error loading data: {str(e)}") + # import traceback + # traceback.print_exc() + # raise def initialize_codebook_with_kmeans(X_train, num_embeddings, embedding_dim): """Initialize codebook vectors using k-means clustering.""" @@ -1322,19 +1583,44 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None): return used_clusters, usage_percentage # --- Main Pipeline --- + print("--- Main Pipeline ---") + print("Loading/Generating Training Data...") - train_data, test_data, seq_length = load_data(data_path, test_size=test_size, random_state=random_state) + X_train, X_test, X_val, y_train, y_test, y_val, seq_length = load_data(data_path, val_data_path, test_size=test_size, random_state=random_state) + + # Preserve original labels before dropping + if output_data == "all": + original_data = np.concatenate([X_train, X_val], axis=0) + original_labels = np.concatenate([y_train, y_val], axis=0) + elif output_data == "train": + original_data = X_train + original_labels = y_train + else: + original_data = X_val + original_labels = y_val # Initialize codebook with k-means print("Initializing codebook with k-means...") - initial_codebook = initialize_codebook_with_kmeans(train_data, num_embeddings, seq_length) + initial_codebook = initialize_codebook_with_kmeans(X_train, num_embeddings, seq_length) # Create datasets print("Creating TensorFlow Datasets...") - train_dataset = create_dataset(train_data, batch_size=batch_size, is_training=True) - val_dataset = create_dataset(test_data, batch_size=batch_size, is_training=False) + train_dataset_y = create_dataset(X_train, y_train, batch_size=batch_size, is_training=True) + val_dataset_y = create_dataset(X_val, y_val, batch_size=batch_size, is_training=False) + test_dataset_y = create_dataset(X_test, y_test, batch_size=batch_size, is_training=False) print("Datasets created.") + # drop labels + train_dataset = train_dataset_y.map(lambda x, y: x) + val_dataset = val_dataset_y.map(lambda x, y: x) + test_dataset = test_dataset_y.map(lambda x, y: x) + + # drop IDs + train_dataset = train_dataset.map(lambda x: x[:, 1:]) + val_dataset = val_dataset.map(lambda x: x[:, 1:]) + test_dataset = test_dataset.map(lambda x: x[:, 1:]) + seq_length = seq_length - 1 # Remove the index feature + # --- Model Instantiation --- print("Building the SCQ1DAutoEncoder model...") input_shape = (seq_length,) @@ -1370,6 +1656,8 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None): print(f"\nTraining finished in {end_time - start_time:.2f} seconds.") # --- Evaluation and Visualization --- + print("\nEvaluating the model...") + if visualize: print("\nPlotting training history...") plot_training_metrics(history, save_path=os.path.join(output_dir, 'vqvae_training_metrics.png')) @@ -1421,8 +1709,67 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None): quantized_latent = np.concatenate(quantized_latents, axis=0) cluster_indices_soft = np.concatenate(cluster_indices_soft_assign, axis=0) cluster_indices_hard = np.concatenate(cluster_indices_hard_assign, axis=0) - np.save(os.path.join(output_dir, 'quantized_latent.npy'), quantized_latent) - # np.save(os.path.join(output_dir, 'cluster_indices_hard.npy'), cluster_indices_hard) + + # Compile quantized outputs into a DataFrame and include original binding labels + # TODO save + # Check dimensions of our data + print(f"Quantized latent shape: {quantized_latent.shape}") + print(f"Cluster indices soft shape: {cluster_indices_soft.shape}") + print(f"Cluster indices hard shape: {cluster_indices_hard.shape}") + print( + f"Original labels shape: {original_labels.shape if hasattr(original_labels, 'shape') else len(original_labels)}") + + # Create a list of records instead of column-wise dictionary + # This avoids dimension issues when creating the DataFrame + records = [] + + for i in range(len(quantized_latent)): + record = {} + + # Add latent features (flattened if needed) + if len(quantized_latent.shape) > 2: + flat_latent = quantized_latent[i].flatten() + for j in range(len(flat_latent)): + record[f'latent_{j}'] = float(flat_latent[j]) + else: + for j in range(quantized_latent.shape[1]): + record[f'latent_{j}'] = float(quantized_latent[i, j]) + + # Add soft cluster probabilities (flattened if needed) + if len(cluster_indices_soft.shape) > 2: + flat_soft = cluster_indices_soft[i].flatten() + for j in range(len(flat_soft)): + record[f'soft_cluster_{j}'] = float(flat_soft[j]) + else: + for j in range(cluster_indices_soft.shape[1]): + record[f'soft_cluster_{j}'] = float(cluster_indices_soft[i, j]) + + # Add hard cluster assignment + record['hard_cluster'] = int(cluster_indices_hard[i]) + + # Add binding label (if available) + if i < len(original_labels): + # Convert to scalar if it's an array + if hasattr(original_labels[i], 'shape') and original_labels[i].shape: + record['binding_label'] = float(original_labels[i][0]) + else: + record['binding_label'] = float(original_labels[i]) + else: + record['binding_label'] = np.nan + + records.append(record) + + # Create DataFrame from records + results_df = pd.DataFrame(records) + + # Print head of the output + print("\nHead of the output DataFrame:") + print(results_df.head()) + + # Save as parquet + parquet_path = os.path.join(output_dir, 'quantized_outputs.parquet') + results_df.to_parquet(parquet_path, index=False) + print(f"Quantized outputs saved to: {parquet_path}") print(f"\n head of Cluster indices hard: {cluster_indices_hard[:5]}") print(f"\n head of Cluster indices soft: {cluster_indices_soft[:5]}") @@ -1438,14 +1785,248 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None): plot_soft_cluster_distribution(np.array(cluster_indices_soft), 20, 'soft_cluster_distribution.png') print(f"Latent representations saved to {output_dir}") + +# write a pipeline that runs the MoE model on the data. +# +# first load the data and if exists the val_data. +# +# then if set latent, load the quantized_latent.npy and load cluster_indices.npy as the cluster_indices_probs, set the number of experts as the length of on of the cluster cluster_indices_probs vector. +# +# then if val_data_path not set, split the data to train and validation and train the model. +# +# then evaluate the model and draw accuracy plots. + +def train_and_evaluate_moe( + data_path, + val_data_path=None, + latent_path=None, + input_type='latent', # Options: 'latent', 'pMHC-sequence' + batch_size=32, + epochs=20, + learning_rate=1e-4, + hidden_dim=64, + output_dir='data/MoE', + visualize=True, + save_model=True, + random_state=42, + test_size=0.2, + **kwargs + ): + """ + Load data from a parquet file, train a Mixture-of-Experts (MoE) model, and evaluate performance. + + Parameters: + data_path (str): Path to the input parquet file containing latent representations and cluster probabilities. + val_data_path (str, optional): Path to a separate validation parquet file. If not provided, a train/val split is used. + latent_path (str, optional): Path to a pretrained encoder model for sequence input. + input_type (str): 'latent' to use precomputed features, 'pMHC-sequence' to encode sequences. + batch_size (int): Batch size for training. + epochs (int): Number of training epochs. + learning_rate (float): Learning rate for the optimizer. + hidden_dim (int): Size of the hidden layer in the MoE model. + output_dir (str): Directory to save models and figures. + visualize (bool): Whether to generate PCA visualizations. + save_model (bool): Whether to save the trained model. + random_state (int): Seed for reproducibility. + test_size (float): Fraction of data to use for validation if no val_data_path. + **kwargs: Additional keyword arguments forwarded to model.fit (e.g., callbacks). + + Returns: + model (tf.keras.Model): Trained MoE model. + history (tf.keras.callbacks.History): Training history object. + eval_results (list): Evaluation results on validation data. + """ + # Set random seeds for reproducibility + np.random.seed(random_state) + tf.random.set_seed(random_state) + + # Create output directory if it doesn't exist + os.makedirs(output_dir, exist_ok=True) + + # Load the main dataset + print(f"Loading training data from {data_path}") + df = pd.read_parquet(data_path) + + # Extract features from latent columns + if input_type == 'latent': + # Get all latent columns + latent_cols = [col for col in df.columns if col.startswith('latent_')] + if not latent_cols: + raise ValueError("No latent_* columns found in the dataset") + print(f"Found {len(latent_cols)} latent columns") + X = df[latent_cols].values + + elif input_type == 'pMHC-sequence': + if latent_path is None: + raise ValueError("latent_path must be provided when input_type='pMHC-sequence'") + # Load sequence encoder (pretrained model) + encoder = tf.keras.models.load_model(latent_path) + if 'peptide' not in df.columns or 'mhc_sequence' not in df.columns: + raise ValueError("Required columns 'peptide' and 'mhc_sequence' not found") + sequences = df[['peptide', 'mhc_sequence']].values + # Encode sequences into latent vectors + X = encoder.predict(sequences, batch_size=batch_size) + else: + raise ValueError(f"Unsupported input_type: {input_type}") + + # Extract soft cluster probabilities + soft_cluster_cols = [col for col in df.columns if col.startswith('soft_cluster_')] + if not soft_cluster_cols: + raise ValueError("No soft_cluster_* columns found in the dataset") + print(f"Found {len(soft_cluster_cols)} soft cluster probability columns") + soft_clusters = df[soft_cluster_cols].values + + # Extract binding labels + if 'binding_label' not in df.columns: + raise ValueError("Required column 'binding_label' not found in the dataset") + y = df['binding_label'].values + + print(f"Data loaded: X shape={X.shape}, soft_clusters shape={soft_clusters.shape}, y shape={y.shape}") + + # Prepare validation data if provided + if val_data_path: + print(f"Loading validation data from {val_data_path}") + df_val = pd.read_parquet(val_data_path) + if input_type == 'latent': + # Use same latent columns as training + X_val = df_val[latent_cols].values + else: + # Encode sequence data + sequences_val = df_val[['peptide', 'mhc_sequence']].values + X_val = encoder.predict(sequences_val, batch_size=batch_size) + + # Use same soft cluster columns + soft_clusters_val = df_val[soft_cluster_cols].values + y_val = df_val['binding_label'].values + + print(f"Validation data loaded: X_val shape={X_val.shape}, soft_clusters_val shape={soft_clusters_val.shape}") + else: + # Split training data for validation + print(f"Splitting data with test_size={test_size}") + X, X_val, soft_clusters, soft_clusters_val, y, y_val = train_test_split( + X, soft_clusters, y, + test_size=test_size, + random_state=random_state, + stratify=y if len(np.unique(y)) > 1 else None + ) + print(f"Data split: train={X.shape[0]} samples, validation={X_val.shape[0]} samples") + + # Build tf.data datasets + train_dataset = tf.data.Dataset.from_tensor_slices(((X, soft_clusters), y)) + train_dataset = train_dataset.shuffle(buffer_size=1000, seed=random_state).batch(batch_size) + + val_dataset = tf.data.Dataset.from_tensor_slices(((X_val, soft_clusters_val), y_val)) + val_dataset = val_dataset.batch(batch_size) + + # Instantiate and compile the MoE model + num_experts = soft_clusters.shape[1] + feature_dim = X.shape[1] + print(f"Building MoE model with {num_experts} experts and feature_dim={feature_dim}") + model = MoEModel( + feature_dim, + hidden_dim=hidden_dim, + num_experts=num_experts, + use_provided_gates=True + ) + model.compile( + optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate), + loss=tf.keras.losses.BinaryCrossentropy(), + metrics=['accuracy'] + ) + + # Train the model + print(f"Training model for {epochs} epochs...") + history = model.fit( + train_dataset, + validation_data=val_dataset, + epochs=epochs, + **kwargs + ) + + # Evaluate on validation set + print("Evaluating model on validation data...") + eval_results = model.evaluate(val_dataset) + print(f"Validation loss: {eval_results[0]:.4f}, accuracy: {eval_results[1]:.4f}") + + # Ensure the model is built before saving + print(model((X[:1], soft_clusters[:1]), training=False)) + + # TODO fix later + # Save the trained model + # if save_model: + # save_path = os.path.join(output_dir, 'moe_model') + # os.makedirs(save_path, exist_ok=True) # Ensure the directory exists + # model.save(save_path) + # print(f"Model saved to {save_path}") + + # Visualization using PCA + if visualize: + print("Creating PCA visualizations...") + pca = PCA(n_components=2, random_state=random_state) + X_all = np.vstack([X, X_val]) + y_all = np.concatenate([y, y_val]) + soft_clusters_all = np.vstack([soft_clusters, soft_clusters_val]) + pca_proj = pca.fit_transform(X_all) + + df_vis = pd.DataFrame({ + 'PC1': pca_proj[:, 0], + 'PC2': pca_proj[:, 1], + 'label': y_all, + 'cluster': np.argmax(soft_clusters_all, axis=1) + }) + + # Plot by binding label + plt.figure(figsize=(8, 6)) + sns.scatterplot(data=df_vis, x='PC1', y='PC2', hue='label', alpha=0.6) + plt.title('PCA of Dataset Colored by Binding Label') + plt.savefig(os.path.join(output_dir, 'pca_binding_label.png')) + print(f"Saved binding label PCA plot to {os.path.join(output_dir, 'pca_binding_label.png')}") + plt.close() + + # Plot by cluster assignment + plt.figure(figsize=(8, 6)) + sns.scatterplot(data=df_vis, x='PC1', y='PC2', hue='cluster', legend=False, alpha=0.6) + plt.title('PCA of Dataset Colored by Soft Cluster Assignment') + plt.savefig(os.path.join(output_dir, 'pca_cluster_assignment.png')) + print(f"Saved cluster assignment PCA plot to {os.path.join(output_dir, 'pca_cluster_assignment.png')}") + plt.close() + + # Plot training history + plt.figure(figsize=(12, 5)) + plt.subplot(1, 2, 1) + plt.plot(history.history['loss'], label='Training Loss') + plt.plot(history.history['val_loss'], label='Validation Loss') + plt.title('Model Loss') + plt.xlabel('Epoch') + plt.ylabel('Loss') + plt.legend() + + plt.subplot(1, 2, 2) + plt.plot(history.history['accuracy'], label='Training Accuracy') + plt.plot(history.history['val_accuracy'], label='Validation Accuracy') + plt.title('Model Accuracy') + plt.xlabel('Epoch') + plt.ylabel('Accuracy') + plt.legend() + + plt.tight_layout() + plt.savefig(os.path.join(output_dir, 'training_history.png')) + print(f"Saved training history plot to {os.path.join(output_dir, 'training_history.png')}") + plt.close() + + return model, history, eval_results + + if __name__ == "__main__": # Call train_and_evaluate_scqvae without trying to unpack return values train_and_evaluate_scqvae( - data_path="data/Pep2Vec/ConvNeXT-MHC/pep2vec_output_fold_1.parquet", + data_path="data/Pep2Vec/Conbotnet_new/pep2vec_output_fold_0.parquet", + val_data_path="data/Pep2Vec/Conbotnet_new/pep2vec_output_val_fold_0.parquet", + input_type="latent1024", num_embeddings=32, embedding_dim=64, batch_size=32, - epochs=20, + epochs=200, output_dir="data/SCQvae/Conbotnet", visualize=True, save_model=True, @@ -1453,6 +2034,22 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None): test_size=0.2, output_data="all", # Options: "val", "train", "all" ) + print("Running MoE") + train_and_evaluate_moe( + data_path="data/SCQvae/Conbotnet/quantized_outputs.parquet", + val_data_path=None, + input_type="latent", + batch_size=32, + epochs=200, + learning_rate=1e-4, + hidden_dim=16, + output_dir="data/MoE/Conbotnet", + visualize=True, + save_model=True, + random_state=42, + test_size=0.2, + ) + # # Create a 1D UMAP projection colored by cluster indices # print("Computing 1D UMAP colored by cluster indices...") diff --git a/utils/model.py b/utils/model.py index a2bf1663f..5de8c7a19 100644 --- a/utils/model.py +++ b/utils/model.py @@ -792,12 +792,47 @@ def visualize_dataset_analysis(features, labels, cluster_probs, method='pca', ra plt.savefig(f'cluster_analysis_{method}.png', dpi=300, bbox_inches='tight') plt.show() + # Plot overall label and cluster probability distributions + fig, ax = plt.subplots(1, 2, figsize=(12, 4)) + + # Label distribution + unique, counts = np.unique(labels_np, return_counts=True) + ax[0].bar(unique.astype(int), counts, color='skyblue') + ax[0].set_xlabel('Label') + ax[0].set_ylabel('Count') + ax[0].set_title('Label Distribution') + + # Cluster probability distribution + cluster_prob_sums = np.sum(cluster_probs_np, axis=0) + ax[1].bar(np.arange(len(cluster_prob_sums)), cluster_prob_sums, color='salmon') + ax[1].set_xlabel('Cluster') + ax[1].set_ylabel('Sum of Probabilities') + ax[1].set_title('Cluster Probability Distribution') + + plt.tight_layout() + plt.savefig('dataset_distributions.png', dpi=300, bbox_inches='tight') + plt.show() + + # TODO show the whole dataset as a dot plot + # Plot the dataset as a dot plot of the first two features + plt.figure(figsize=(10, 8)) + plt.scatter(features_np[:, 0], features_np[:, 1], c=labels_np, cmap='coolwarm', + s=10, alpha=0.7, edgecolors='none') + plt.colorbar(label='Label') + plt.title('Dot Plot of First Two Features') + plt.xlabel('Feature 0') + plt.ylabel('Feature 1') + plt.grid(linestyle='--', alpha=0.6) + plt.savefig('feature_dot_plot.png', dpi=300, bbox_inches='tight') + plt.show() + + # Example usage if __name__ == "__main__": # Generate dummy dataset with clustered data and labels for training num_train_samples = 8000 num_test_samples = 2000 - feature_dim = 128 + feature_dim = 64 num_clusters = 32 # Function to generate dataset with specified parameters From c461e556b74050bfde8a682e8f491b117db591c3 Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 8 May 2025 14:31:35 +0200 Subject: [PATCH 27/83] Add Graphviz installation step --- install.sh | 16 ++++++++++++++++ pip_requirements.txt | 3 ++- 2 files changed, 18 insertions(+), 1 deletion(-) diff --git a/install.sh b/install.sh index c15634e91..b43201e95 100755 --- a/install.sh +++ b/install.sh @@ -140,6 +140,22 @@ if [ ! -f "Pep2Vec/pep2vec.bin" ]; then fi echo "✔ Pep2Vec setup is done. " +# Step 12: Install graphviz +echo "Graphviz installation" +if ! command -v dot &>/dev/null; then + echo "⚠ Graphviz not found. Installing..." + if [ "$(uname)" == "Linux" ]; then + sudo apt-get install graphviz + elif [ "$(uname)" == "Darwin" ]; then + brew install graphviz + else + echo "⚠ Unsupported OS. Please install Graphviz manually." + exit 1 + fi +else + echo "✔ Graphviz is already installed." +fi + # Step 13: Cleanup and Completion cd "$CURRENT_DIR" diff --git a/pip_requirements.txt b/pip_requirements.txt index e00722504..0d12a7b91 100644 --- a/pip_requirements.txt +++ b/pip_requirements.txt @@ -28,4 +28,5 @@ matplotlib==3.6.3 datashader==0.17.0 bokeh==3.4.3 holoviews==1.20.2 -colorcet==3.1.0 \ No newline at end of file +colorcet==3.1.0 +pydot==4.0.0 \ No newline at end of file From 5724239e9d0f24b1e1fabae40d67e548914931de Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 8 May 2025 14:32:28 +0200 Subject: [PATCH 28/83] Enhance SCQ1DAutoEncoder and add new models for binary classification - Introduced BinaryMLP, TabularTransformer, and EmbeddingCNN models for diverse classification tasks. - Modified run_pMHC_DL.py to support new model types and attention-based features. - Added functionality to process and save quantized outputs with detailed logging. --- run_pMHC_DL.py | 464 ++++++++++++++++++++++++----------- utils/model.py | 641 +++++++++++++++++++++++++++++++++++-------------- 2 files changed, 790 insertions(+), 315 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index fd7db2fb0..09dd5be07 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -10,7 +10,7 @@ import seaborn as sns from sklearn.decomposition import PCA -from utils.model import SCQ1DAutoEncoder, MoEModel +from utils.model import SCQ1DAutoEncoder, MoEModel, BinaryMLP, TabularTransformer, EmbeddingCNN ''' # Set TensorFlow logging level for more information @@ -932,9 +932,10 @@ def train_and_evaluate_scqvae( output_dir='data/SCQvae', visualize=True, save_model=True, + init_k_means=False, random_state=42, test_size=0.2, - output_data="all", # Options: "val", "train", "all" + output_data="train_val_seperate", # Options: "val", "train", "train_val_seperate" **kwargs ): """ @@ -942,7 +943,7 @@ def train_and_evaluate_scqvae( Args: data_path: Path to the parquet file containing peptide embeddings - input_type: Type of input data ('latent1024' or 'pMHC-sequence') + input_type: Type of input data ('latent1024' or 'pMHC-sequence', 'attention51') num_embeddings: Number of clusters/codes in the codebook embedding_dim: Dimension of each codebook vector batch_size: Batch size for training @@ -991,7 +992,7 @@ def load_data(data_path, val_data_path=None, test_size=0.2, random_state=42, inp val_data_path: Optional path to validation data test_size: Fraction of data to use for validation if val_data_path is None random_state: Random seed for reproducibility - input_type: Type of input data ('latent1024' or 'pMHC-sequence') + input_type: Type of input data ('latent1024' or 'pMHC-sequence', 'attention51') Returns: X_train: Training data features with unique indices @@ -1025,6 +1026,13 @@ def load_data(data_path, val_data_path=None, test_size=0.2, random_state=42, inp print(f"Using sequence columns: {columns}") # Note: pMHC-sequence processing would be implemented here raise NotImplementedError("pMHC-sequence input not yet implemented") + elif input_type == 'attention51': + # Check for attention columns + columns = [col for col in df.columns if 'attn_' in col] + if not columns: + raise ValueError("No attention columns found in the dataset") + seq_length = len(columns) + print(f"Found {seq_length} attention columns") else: raise ValueError(f"Unknown input_type: {input_type}. Expected 'latent1024' or 'pMHC-sequence'") @@ -1582,6 +1590,81 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None): plt.close() return used_clusters, usage_percentage + def process_and_save(dataset: tf.data.Dataset, + split_name: str, + model: tf.keras.Model, + original_labels: np.ndarray, + output_dir: str, + num_embeddings: int): + """ + Quantize `dataset` through `model`, assemble into a DataFrame, + save to parquet, and plot distributions with split-specific filenames. + """ + quantized_latents = [] + cluster_indices_soft = [] + cluster_indices_hard = [] + + # Extract latent codes for every batch + for batch in dataset: + output, Zq, out_P_proj, _, _ = model(batch, training=False) + quantized_latents.append(Zq.numpy()) + cluster_indices_soft.append(out_P_proj.numpy()) + cluster_indices_hard.append(tf.argmax(out_P_proj, axis=-1).numpy()) + + # Concatenate across batches + quantized_latent = np.concatenate(quantized_latents, axis=0) + soft_probs = np.concatenate(cluster_indices_soft, axis=0) + hard_assign = np.concatenate(cluster_indices_hard, axis=0) + + # Build DataFrame + records = [] + for i in range(len(quantized_latent)): + rec = {} + flat_latent = quantized_latent[i].flatten() + for j, v in enumerate(flat_latent): + rec[f'latent_{j}'] = float(v) + + flat_soft = soft_probs[i].flatten() + for j, v in enumerate(flat_soft): + rec[f'soft_cluster_{j}'] = float(v) + + rec['hard_cluster'] = int(hard_assign[i]) + # binding label if available + if i < len(original_labels): + lbl = original_labels[i] + rec['binding_label'] = float(lbl[0] if hasattr(lbl, 'shape') and lbl.shape else lbl) + else: + rec['binding_label'] = np.nan + records.append(rec) + + df = pd.DataFrame(records) + # ensure output directory exists + os.makedirs(output_dir, exist_ok=True) + + # Save parquet + parquet_path = os.path.join(output_dir, f'quantized_outputs_{split_name}.parquet') + df.to_parquet(parquet_path, index=False) + print(f"[{split_name}] saved parquet → {parquet_path}") + + # Plot distributions + plot_cluster_distribution(soft_probs, + save_path=os.path.join(output_dir, f'cluster_distribution_soft_{split_name}.png')) + plot_codebook_usage(hard_assign, num_embeddings, + save_path=os.path.join(output_dir, f'codebook_usage_{split_name}.png')) + plot_soft_cluster_distribution(soft_probs, 20, + save_path=os.path.join(output_dir, + f'soft_cluster_distribution_{split_name}.png')) + + def remove_id(dataset): + """Remove the first column (ID) from the feature tensor, keep y if present.""" + return dataset.map(lambda x, y=None: (x[:, 1:], y) if y is not None else x[:, 1:]) + + def remove_y(dataset): + """Remove the last column (y) from the feature tensor.""" + return dataset.map(lambda x, y: x) + + # ======================= End of Helper Functions ======================= + # --- Main Pipeline --- print("--- Main Pipeline ---") @@ -1601,7 +1684,12 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None): # Initialize codebook with k-means print("Initializing codebook with k-means...") - initial_codebook = initialize_codebook_with_kmeans(X_train, num_embeddings, seq_length) + if init_k_means: + print("Initializing codebook with k-means") + initial_codebook = initialize_codebook_with_kmeans(X_train, num_embeddings, seq_length) + else: + print("Not initializing codebook with k-means") + initial_codebook = None # Create datasets print("Creating TensorFlow Datasets...") @@ -1610,17 +1698,18 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None): test_dataset_y = create_dataset(X_test, y_test, batch_size=batch_size, is_training=False) print("Datasets created.") - # drop labels - train_dataset = train_dataset_y.map(lambda x, y: x) - val_dataset = val_dataset_y.map(lambda x, y: x) - test_dataset = test_dataset_y.map(lambda x, y: x) - # drop IDs - train_dataset = train_dataset.map(lambda x: x[:, 1:]) - val_dataset = val_dataset.map(lambda x: x[:, 1:]) - test_dataset = test_dataset.map(lambda x: x[:, 1:]) + train_dataset = train_dataset_y.apply(remove_id) + val_dataset = val_dataset_y.apply(remove_id) + test_dataset = test_dataset_y.apply(remove_id) seq_length = seq_length - 1 # Remove the index feature + # remove labels + # train_dataset = train_dataset.apply(remove_y) + # val_dataset = val_dataset.apply(remove_y) + # test_dataset = test_dataset.apply(remove_y) + + # --- Model Instantiation --- print("Building the SCQ1DAutoEncoder model...") input_shape = (seq_length,) @@ -1636,7 +1725,9 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None): 'usage_threshold': 1e-4, # Lower threshold 'reset_interval': 5 # Frequent resets }, - initial_codebook=initial_codebook # Pass k-means initialized codebook + initial_codebook=initial_codebook, # Pass k-means initialized codebook + num_classes=1, # set binary classification + cluster_lambda=10, # Increased lambda for cluster loss ) print("Model built.") @@ -1662,7 +1753,10 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None): print("\nPlotting training history...") plot_training_metrics(history, save_path=os.path.join(output_dir, 'vqvae_training_metrics.png')) print("\nPerforming example inference...") - example_batch = next(iter(val_dataset)) + try: + example_batch, _ = next(iter(val_dataset)) + except Exception: + example_batch = next(iter(val_dataset)) output = model(example_batch, training=False) reconstruction, quantized_latent, cluster_indices, vq_loss, perplexity = output print("\nVisualizing reconstructions...") @@ -1688,102 +1782,129 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None): # --- Extract Latent Space --- print("\nExtracting quantized latent space...") - if output_data == "all": - out_dataset = tf.data.Dataset.concatenate(train_dataset, val_dataset) - elif output_data == "train": - out_dataset = train_dataset # using only training dataset for quantization - else: - out_dataset = val_dataset # using only validation dataset for quantization - quantized_latents, cluster_indices_hard_assign, cluster_indices_soft_assign = [], [], [] - for batch in out_dataset: - output, Zq, out_P_proj, _, _ = model(batch, training=False) - print(f"\nBatch shape: {batch.shape}") - print(f"\nOutput shape: {output.shape}") - print(f"\nZq shape: {Zq.shape}") - print(f"\nout_P_proj shape: {out_P_proj.shape}") - - quantized_latents.append(Zq.numpy()) - # Append soft assignments - cluster_indices_soft_assign.append(out_P_proj.numpy()) # shows the probability of each index - cluster_indices_hard_assign.append(tf.argmax(out_P_proj, axis=-1).numpy()) # shows which index has the highest probability - quantized_latent = np.concatenate(quantized_latents, axis=0) - cluster_indices_soft = np.concatenate(cluster_indices_soft_assign, axis=0) - cluster_indices_hard = np.concatenate(cluster_indices_hard_assign, axis=0) - - # Compile quantized outputs into a DataFrame and include original binding labels - # TODO save - # Check dimensions of our data - print(f"Quantized latent shape: {quantized_latent.shape}") - print(f"Cluster indices soft shape: {cluster_indices_soft.shape}") - print(f"Cluster indices hard shape: {cluster_indices_hard.shape}") - print( - f"Original labels shape: {original_labels.shape if hasattr(original_labels, 'shape') else len(original_labels)}") - - # Create a list of records instead of column-wise dictionary - # This avoids dimension issues when creating the DataFrame - records = [] - - for i in range(len(quantized_latent)): - record = {} - - # Add latent features (flattened if needed) - if len(quantized_latent.shape) > 2: - flat_latent = quantized_latent[i].flatten() - for j in range(len(flat_latent)): - record[f'latent_{j}'] = float(flat_latent[j]) - else: - for j in range(quantized_latent.shape[1]): - record[f'latent_{j}'] = float(quantized_latent[i, j]) - - # Add soft cluster probabilities (flattened if needed) - if len(cluster_indices_soft.shape) > 2: - flat_soft = cluster_indices_soft[i].flatten() - for j in range(len(flat_soft)): - record[f'soft_cluster_{j}'] = float(flat_soft[j]) - else: - for j in range(cluster_indices_soft.shape[1]): - record[f'soft_cluster_{j}'] = float(cluster_indices_soft[i, j]) - - # Add hard cluster assignment - record['hard_cluster'] = int(cluster_indices_hard[i]) - - # Add binding label (if available) - if i < len(original_labels): - # Convert to scalar if it's an array - if hasattr(original_labels[i], 'shape') and original_labels[i].shape: - record['binding_label'] = float(original_labels[i][0]) - else: - record['binding_label'] = float(original_labels[i]) - else: - record['binding_label'] = np.nan - - records.append(record) - # Create DataFrame from records - results_df = pd.DataFrame(records) + if output_data == "train_val_combined": + out_ds = tf.data.Dataset.concatenate(train_dataset, val_dataset) + process_and_save(out_ds, "combined", model, original_labels, output_dir, num_embeddings) - # Print head of the output - print("\nHead of the output DataFrame:") - print(results_df.head()) + elif output_data in ("train", "val"): + ds_name = output_data + ds = train_dataset if ds_name == "train" else val_dataset + process_and_save(ds, ds_name, model, original_labels, output_dir, num_embeddings) - # Save as parquet - parquet_path = os.path.join(output_dir, 'quantized_outputs.parquet') - results_df.to_parquet(parquet_path, index=False) - print(f"Quantized outputs saved to: {parquet_path}") + elif output_data == "train_val_seperate": + # Process train and val separately + process_and_save(train_dataset, "train", model,y_train , output_dir, num_embeddings) + process_and_save(val_dataset, "val", model,y_val , output_dir, num_embeddings) - print(f"\n head of Cluster indices hard: {cluster_indices_hard[:5]}") - print(f"\n head of Cluster indices soft: {cluster_indices_soft[:5]}") - # print shape of soft cluster indices - print(f"\n softs shape: {np.array(cluster_indices_soft).shape}") - print(f"\n head of Quantized latents: {quantized_latent[:5]}") - - # Create distribution plots for all data - print("\nCreating distribution plots for all processed data...") - plot_cluster_distribution(cluster_indices_soft, save_path=os.path.join(output_dir, 'cluster_distribution_soft.png')) - plot_codebook_usage(cluster_indices_hard, num_embeddings, - save_path=os.path.join(output_dir, 'full_codebook_usage.png')) - plot_soft_cluster_distribution(np.array(cluster_indices_soft), 20, 'soft_cluster_distribution.png') - print(f"Latent representations saved to {output_dir}") + else: + raise ValueError("Invalid output_data. Must be 'train', 'val', 'train_val_combined', or 'train_val_seperate'.") + + print(f"\nAll requested splits processed. Outputs are in: {output_dir}") + + # out_dataset2 = None + # if output_data == "train_val_combined": + # out_dataset1 = tf.data.Dataset.concatenate(train_dataset, val_dataset) + # elif output_data == "train": + # out_dataset1 = train_dataset # using only training dataset for quantization + # elif output_data == "val": + # out_dataset1 = val_dataset # using only validation dataset for quantization + # elif output_data == "train_val_seperate": + # out_dataset1 = train_dataset + # out_dataset2 = val_dataset # TODO + # else: + # raise ValueError("Invalid output_data option. Choose 'train', 'val', or 'train_val_combined'.") + # + # quantized_latents, cluster_indices_hard_assign, cluster_indices_soft_assign = [], [], [] + # for batch in out_dataset1: + # output, Zq, out_P_proj, _, _ = model(batch, training=False) + # print(f"\nBatch shape: {batch.shape}") + # print(f"\nOutput shape: {output.shape}") + # print(f"\nZq shape: {Zq.shape}") + # print(f"\nout_P_proj shape: {out_P_proj.shape}") + # + # quantized_latents.append(Zq.numpy()) + # # Append soft assignments + # cluster_indices_soft_assign.append(out_P_proj.numpy()) # shows the probability of each index + # cluster_indices_hard_assign.append(tf.argmax(out_P_proj, axis=-1).numpy()) # shows which index has the highest probability + # quantized_latent = np.concatenate(quantized_latents, axis=0) + # cluster_indices_soft = np.concatenate(cluster_indices_soft_assign, axis=0) + # cluster_indices_hard = np.concatenate(cluster_indices_hard_assign, axis=0) + # + # # Compile quantized outputs into a DataFrame and include original binding labels + # # TODO save + # # Check dimensions of our data + # print(f"Quantized latent shape: {quantized_latent.shape}") + # print(f"Cluster indices soft shape: {cluster_indices_soft.shape}") + # print(f"Cluster indices hard shape: {cluster_indices_hard.shape}") + # print( + # f"Original labels shape: {original_labels.shape if hasattr(original_labels, 'shape') else len(original_labels)}") + # + # # Create a list of records instead of column-wise dictionary + # # This avoids dimension issues when creating the DataFrame + # records = [] + # + # for i in range(len(quantized_latent)): + # record = {} + # + # # Add latent features (flattened if needed) + # if len(quantized_latent.shape) > 2: + # flat_latent = quantized_latent[i].flatten() + # for j in range(len(flat_latent)): + # record[f'latent_{j}'] = float(flat_latent[j]) + # else: + # for j in range(quantized_latent.shape[1]): + # record[f'latent_{j}'] = float(quantized_latent[i, j]) + # + # # Add soft cluster probabilities (flattened if needed) + # if len(cluster_indices_soft.shape) > 2: + # flat_soft = cluster_indices_soft[i].flatten() + # for j in range(len(flat_soft)): + # record[f'soft_cluster_{j}'] = float(flat_soft[j]) + # else: + # for j in range(cluster_indices_soft.shape[1]): + # record[f'soft_cluster_{j}'] = float(cluster_indices_soft[i, j]) + # + # # Add hard cluster assignment + # record['hard_cluster'] = int(cluster_indices_hard[i]) + # + # # Add binding label (if available) + # if i < len(original_labels): + # # Convert to scalar if it's an array + # if hasattr(original_labels[i], 'shape') and original_labels[i].shape: + # record['binding_label'] = float(original_labels[i][0]) + # else: + # record['binding_label'] = float(original_labels[i]) + # else: + # record['binding_label'] = np.nan + # + # records.append(record) + # + # # Create DataFrame from records + # results_df = pd.DataFrame(records) + # + # # Print head of the output + # print("\nHead of the output DataFrame:") + # print(results_df.head()) + # + # # Save as parquet + # parquet_path = os.path.join(output_dir, 'quantized_outputs.parquet') + # results_df.to_parquet(parquet_path, index=False) + # print(f"Quantized outputs saved to: {parquet_path}") + # + # print(f"\n head of Cluster indices hard: {cluster_indices_hard[:5]}") + # print(f"\n head of Cluster indices soft: {cluster_indices_soft[:5]}") + # # print shape of soft cluster indices + # print(f"\n softs shape: {np.array(cluster_indices_soft).shape}") + # print(f"\n head of Quantized latents: {quantized_latent[:5]}") + # + # # Create distribution plots for all data + # print("\nCreating distribution plots for all processed data...") + # plot_cluster_distribution(cluster_indices_soft, save_path=os.path.join(output_dir, 'cluster_distribution_soft.png')) + # plot_codebook_usage(cluster_indices_hard, num_embeddings, + # save_path=os.path.join(output_dir, 'full_codebook_usage.png')) + # plot_soft_cluster_distribution(np.array(cluster_indices_soft), 20, 'soft_cluster_distribution.png') + # print(f"Latent representations saved to {output_dir}") # write a pipeline that runs the MoE model on the data. @@ -1800,7 +1921,8 @@ def train_and_evaluate_moe( data_path, val_data_path=None, latent_path=None, - input_type='latent', # Options: 'latent', 'pMHC-sequence' + input_type='latent', # Options: 'latent', 'pMHC-sequence', 'attention' + model_type='MoE', # Options: 'MoE', 'MLP', 'transformer', 'CNN' batch_size=32, epochs=20, learning_rate=1e-4, @@ -1810,6 +1932,7 @@ def train_and_evaluate_moe( save_model=True, random_state=42, test_size=0.2, + use_soft_clusters_as_gates= True, **kwargs ): """ @@ -1819,7 +1942,7 @@ def train_and_evaluate_moe( data_path (str): Path to the input parquet file containing latent representations and cluster probabilities. val_data_path (str, optional): Path to a separate validation parquet file. If not provided, a train/val split is used. latent_path (str, optional): Path to a pretrained encoder model for sequence input. - input_type (str): 'latent' to use precomputed features, 'pMHC-sequence' to encode sequences. + input_type (str): 'latent' to use precomputed features, 'pMHC-sequence' to encode sequences, and 'attention' for attention-based features. batch_size (int): Batch size for training. epochs (int): Number of training epochs. learning_rate (float): Learning rate for the optimizer. @@ -1866,15 +1989,27 @@ def train_and_evaluate_moe( sequences = df[['peptide', 'mhc_sequence']].values # Encode sequences into latent vectors X = encoder.predict(sequences, batch_size=batch_size) + + elif input_type == 'attention': + # get all attention columns + attention_cols = [col for col in df.columns if col.startswith('attn_')] + if not attention_cols: + raise ValueError("No attention_* columns found in the dataset") + print(f"Found {len(attention_cols)} attention columns") + X = df[attention_cols].values + else: raise ValueError(f"Unsupported input_type: {input_type}") # Extract soft cluster probabilities - soft_cluster_cols = [col for col in df.columns if col.startswith('soft_cluster_')] - if not soft_cluster_cols: - raise ValueError("No soft_cluster_* columns found in the dataset") - print(f"Found {len(soft_cluster_cols)} soft cluster probability columns") - soft_clusters = df[soft_cluster_cols].values + if use_soft_clusters_as_gates: + soft_cluster_cols = [col for col in df.columns if col.startswith('soft_cluster_')] + if not soft_cluster_cols: + raise ValueError("No soft_cluster_* columns found in the dataset") + print(f"Found {len(soft_cluster_cols)} soft cluster probability columns") + soft_clusters = df[soft_cluster_cols].values + else: + soft_clusters = np.zeros((X.shape[0], 32)) # Dummy soft clusters if not used # Extract binding labels if 'binding_label' not in df.columns: @@ -1890,13 +2025,26 @@ def train_and_evaluate_moe( if input_type == 'latent': # Use same latent columns as training X_val = df_val[latent_cols].values + elif input_type == 'pMHC-sequence': + raise NotImplementedError("Validation data for pMHC-sequence input type is not implemented") + elif input_type == 'attention': + # Use same attention columns as training + attention_cols_val = [col for col in df_val.columns if col.startswith('attn_')] + if not attention_cols_val: + raise ValueError("No attention_* columns found in the validation dataset") + print(f"Found {len(attention_cols_val)} attention columns in validation data") + X_val = df_val[attention_cols_val].values else: # Encode sequence data sequences_val = df_val[['peptide', 'mhc_sequence']].values X_val = encoder.predict(sequences_val, batch_size=batch_size) - # Use same soft cluster columns - soft_clusters_val = df_val[soft_cluster_cols].values + if use_soft_clusters_as_gates: + # Use same soft cluster columns + soft_clusters_val = df_val[soft_cluster_cols].values + else: + soft_clusters_val = np.zeros((X_val.shape[0], 32)) + y_val = df_val['binding_label'].values print(f"Validation data loaded: X_val shape={X_val.shape}, soft_clusters_val shape={soft_clusters_val.shape}") @@ -1922,17 +2070,48 @@ def train_and_evaluate_moe( num_experts = soft_clusters.shape[1] feature_dim = X.shape[1] print(f"Building MoE model with {num_experts} experts and feature_dim={feature_dim}") - model = MoEModel( - feature_dim, - hidden_dim=hidden_dim, - num_experts=num_experts, - use_provided_gates=True - ) - model.compile( - optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate), - loss=tf.keras.losses.BinaryCrossentropy(), - metrics=['accuracy'] - ) + + if model_type == 'MoE': + model = MoEModel( + feature_dim, + hidden_dim=hidden_dim, + num_experts=num_experts, + use_provided_gates=use_soft_clusters_as_gates, + ) + model.compile( + optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate), + loss=tf.keras.losses.BinaryCrossentropy(), + metrics=['accuracy'], + ) + elif model_type == 'MLP': + model = BinaryMLP( + feature_dim, + ) + model.compile( + optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate), + loss=tf.keras.losses.BinaryCrossentropy(), + metrics=['accuracy'], + ) + elif model_type == 'transformer': + model = TabularTransformer( + feature_dim, + ) + model.compile( + optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate), + loss=tf.keras.losses.BinaryCrossentropy(), + metrics=['accuracy'], + ) + elif model_type == 'CNN': + model = EmbeddingCNN( + feature_dim, + ) + model.compile( + optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate), + loss=tf.keras.losses.BinaryCrossentropy(), + metrics=['accuracy'], + ) + else: + raise ValueError(f"Unsupported model_type: {model_type}") # Train the model print(f"Training model for {epochs} epochs...") @@ -1981,6 +2160,7 @@ def train_and_evaluate_moe( plt.title('PCA of Dataset Colored by Binding Label') plt.savefig(os.path.join(output_dir, 'pca_binding_label.png')) print(f"Saved binding label PCA plot to {os.path.join(output_dir, 'pca_binding_label.png')}") + plt.show() plt.close() # Plot by cluster assignment @@ -1989,6 +2169,7 @@ def train_and_evaluate_moe( plt.title('PCA of Dataset Colored by Soft Cluster Assignment') plt.savefig(os.path.join(output_dir, 'pca_cluster_assignment.png')) print(f"Saved cluster assignment PCA plot to {os.path.join(output_dir, 'pca_cluster_assignment.png')}") + plt.show() plt.close() # Plot training history @@ -2012,6 +2193,7 @@ def train_and_evaluate_moe( plt.tight_layout() plt.savefig(os.path.join(output_dir, 'training_history.png')) print(f"Saved training history plot to {os.path.join(output_dir, 'training_history.png')}") + plt.show() plt.close() return model, history, eval_results @@ -2020,34 +2202,40 @@ def train_and_evaluate_moe( if __name__ == "__main__": # Call train_and_evaluate_scqvae without trying to unpack return values train_and_evaluate_scqvae( - data_path="data/Pep2Vec/Conbotnet_new/pep2vec_output_fold_0.parquet", - val_data_path="data/Pep2Vec/Conbotnet_new/pep2vec_output_val_fold_0.parquet", + data_path="data/Pep2Vec/ConvNeXT-MHC_subset_new/pep2vec_output_fold_0.parquet", + val_data_path="data/Pep2Vec/ConvNeXT-MHC_subset_new/pep2vec_output_val_fold_0.parquet", input_type="latent1024", num_embeddings=32, embedding_dim=64, batch_size=32, - epochs=200, - output_dir="data/SCQvae/Conbotnet", + epochs=20, + output_dir="data/SCQvae/ConvNeXT-MHC", visualize=True, save_model=True, + init_k_means=False, random_state=42, test_size=0.2, - output_data="all", # Options: "val", "train", "all" + output_data="train_val_seperate", # Options: "val", "train", "train_val_seperate" ) - print("Running MoE") + m = "MoE" + print(f"Running {m}") train_and_evaluate_moe( - data_path="data/SCQvae/Conbotnet/quantized_outputs.parquet", - val_data_path=None, + data_path="data/SCQvae/ConvNeXT-MHC/quantized_outputs_train.parquet", + val_data_path="data/SCQvae/ConvNeXT-MHC/quantized_outputs_val.parquet", + # data_path="data/Pep2Vec/ConvNeXT-MHC_subset_new/pep2vec_output_fold_0.parquet", + # val_data_path="data/Pep2Vec/ConvNeXT-MHC_subset_new/pep2vec_output_val_fold_0.parquet", input_type="latent", + model_type=m, # Options: "MoE", "MLP", "transformer", "CNN" batch_size=32, - epochs=200, + epochs=20, learning_rate=1e-4, - hidden_dim=16, - output_dir="data/MoE/Conbotnet", + hidden_dim=4, + output_dir="data/MoE/ConvNeXT-MHC", visualize=True, save_model=True, random_state=42, test_size=0.2, + use_soft_clusters_as_gates=False, ) diff --git a/utils/model.py b/utils/model.py index 5de8c7a19..13dbf7a85 100644 --- a/utils/model.py +++ b/utils/model.py @@ -299,13 +299,18 @@ def _reset_dead_codes(self, encoder_outputs): class SCQ1DAutoEncoder(keras.Model): def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, - scq_params, initial_codebook, **kwargs): + scq_params, initial_codebook, num_classes, cluster_lambda=1.0, **kwargs): super().__init__(**kwargs) self.input_dim = input_dim # e.g., (1024,) self.embedding_dim = embedding_dim self.num_embeddings = num_embeddings self.commitment_beta = commitment_beta + # weight on the new cluster‐consistency loss + self.cluster_lambda = cluster_lambda + # number of distinct labels + self.num_classes = num_classes + # Encoder: Dense layers to compress 1024 features to embedding_dim self.encoder = keras.Sequential([ layers.Dense(512, activation='relu', input_shape=self.input_dim), @@ -342,54 +347,53 @@ def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, self.vq_loss_tracker = keras.metrics.Mean(name="vq_loss") self.perplexity_tracker = keras.metrics.Mean(name="perplexity") + @property + def metrics(self): + return [ + self.total_loss_tracker, + self.recon_loss_tracker, + self.vq_loss_tracker, + self.perplexity_tracker, + ] + + def call(self, inputs, training=False): + if isinstance(inputs, tuple): + x, labels = inputs + else: + x, labels = inputs, None # Encoder: Compress input to embedding space - x = self.encoder(inputs) # (batch_size, embedding_dim) + x = self.encoder(x) # (batch_size, embedding_dim) x = tf.expand_dims(x, axis=1) # (batch_size, 1, embedding_dim) - # SCQ: Quantize the embedding - # This now returns one-hot encodings instead of soft probabilities Zq, out_P_proj, vq_loss, perplexity = self.scq_layer(x) - # Decoder: Reconstruct from quantized embedding y = tf.squeeze(Zq, axis=1) # (batch_size, embedding_dim) output = self.decoder(y) # (batch_size, 1024) - return output, Zq, out_P_proj, vq_loss, perplexity # # Method to get just the latent sequence and one-hot encodings for inference - # def encode(self, inputs): - # """Encode inputs to latent sequence and one-hot cluster assignments.""" - # x = self.encoder(inputs) # (batch_size, embedding_dim) - # x = tf.expand_dims(x, axis=1) # (batch_size, 1, embedding_dim) - # - # # Get quantized embedding and one-hot encodings - # quantized, one_hot_encodings, _, _ = self.scq_layer(x) - # - # # Return quantized latent sequence and one-hot encodings - # return tf.squeeze(quantized, axis=1), tf.squeeze(one_hot_encodings, axis=1) - - @property - def metrics(self): - return [ - self.total_loss_tracker, - self.recon_loss_tracker, - self.vq_loss_tracker, - self.perplexity_tracker - ] + def encode(self, inputs): + """Encode inputs to latent sequence and one-hot cluster assignments.""" + x = self.encoder(inputs) # (batch_size, embedding_dim) + x = tf.expand_dims(x, axis=1) # (batch_size, 1, embedding_dim) + # Get quantized embedding and one-hot encodings + quantized, one_hot_encodings, _, _ = self.scq_layer(x) + # Return quantized latent sequence and one-hot encodings + return tf.squeeze(quantized, axis=1), tf.squeeze(one_hot_encodings, axis=1) def train_step(self, data): + # unpack features and (optional) labels if isinstance(data, tuple): - x = data[0] - y = data[1] if len(data) > 1 else data[0] + x, labels = data else: - x = y = data + x, labels = data, None with tf.GradientTape() as tape: reconstruction, Zq, _, vq_loss, perplexity = self(x, training=True) # Reconstruction loss - recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) + recon_loss = tf.reduce_mean(tf.math.squared_difference(x, reconstruction)) # Feature matching loss with tape.stop_recording(): @@ -436,7 +440,7 @@ def test_step(self, data): x = y = data reconstruction, quantized, _, vq_loss, perplexity = self(x, training=False) - recon_loss = tf.reduce_mean(tf.math.squared_difference(y, reconstruction)) + recon_loss = tf.reduce_mean(tf.math.squared_difference(x, reconstruction)) total_loss = recon_loss + vq_loss + self.commitment_beta * tf.reduce_mean( tf.math.squared_difference(x, reconstruction)) @@ -496,6 +500,24 @@ def call(self, x): x = self.fc2(x) return tf.nn.sigmoid(x) +# class Expert(layers.Layer): +# """Enhanced binary prediction expert with dropout and more layers.""" +# def __init__(self, input_dim, hidden_dim, output_dim=1, dropout_rate=0.2): +# super().__init__() +# self.fc1 = layers.Dense(hidden_dim, activation='relu', input_shape=(input_dim,)) +# self.dropout1 = layers.Dropout(dropout_rate) +# self.fc2 = layers.Dense(hidden_dim // 2, activation='relu') +# self.dropout2 = layers.Dropout(dropout_rate) +# self.fc3 = layers.Dense(output_dim) +# +# def call(self, x, training=False): +# x = self.fc1(x) +# x = self.dropout1(x, training=training) +# x = self.fc2(x) +# x = self.dropout2(x, training=training) +# x = self.fc3(x) +# return tf.nn.sigmoid(x) + class MixtureOfExperts(layers.Layer): """Mixture of Experts layer with optional learned gating network.""" @@ -827,151 +849,416 @@ def visualize_dataset_analysis(features, labels, cluster_probs, method='pca', ra plt.show() -# Example usage -if __name__ == "__main__": - # Generate dummy dataset with clustered data and labels for training - num_train_samples = 8000 - num_test_samples = 2000 - feature_dim = 64 - num_clusters = 32 - - # Function to generate dataset with specified parameters - def generate_dataset(num_samples, feature_dim, num_clusters, epsilon=0.1): - # Compute samples per cluster - base_count = num_samples // num_clusters - counts = [base_count + (1 if i < num_samples % num_clusters else 0) for i in range(num_clusters)] - - features_list = [] - labels_list = [] - cluster_probs_list = [] - distributions = ['normal', 'uniform', 'gamma', 'poisson'] - - for c in range(num_clusters): - cluster_count = counts[c] - n0 = cluster_count // 2 - n1 = cluster_count - n0 - dist = distributions[(2 * c) % len(distributions)] - print(f"Cluster {c}: {dist} distribution, {n0} samples 0, {n1} samples 1") - - if dist == 'normal': - features_0 = tf.random.normal([n0, feature_dim], mean=c, stddev=1.0) - elif dist == 'uniform': - features_0 = tf.random.uniform([n0, feature_dim], minval=0, maxval=1) - elif dist == 'gamma': - features_0 = tf.random.gamma([n0, feature_dim], alpha=2.0, beta=1.0) - elif dist == 'poisson': - features_0 = tf.cast(tf.random.poisson([n0, feature_dim], lam=3), tf.float32) - else: - features_0 = tf.random.normal([n0, feature_dim], mean=c, stddev=1.0) - - if dist == 'normal': - features_1 = tf.random.normal([n1, feature_dim], mean=c+0.5, stddev=1.5) - elif dist == 'uniform': - features_1 = tf.random.uniform([n1, feature_dim], minval=1, maxval=2) - elif dist == 'gamma': - features_1 = tf.random.gamma([n1, feature_dim], alpha=5.0, beta=2.0) - elif dist == 'poisson': - features_1 = tf.cast(tf.random.poisson([n1, feature_dim], lam=6), tf.float32) - else: - features_1 = tf.random.normal([n1, feature_dim], mean=c+0.5, stddev=1.5) - - features_i = tf.concat([features_0, features_1], axis=0) - labels_i = tf.concat([tf.zeros([n0, 1], tf.int32), tf.ones([n1, 1], tf.int32)], axis=0) - features_list.append(features_i) - labels_list.append(labels_i) - - # Generate random cluster probabilities per sample - cluster_indices = tf.fill([cluster_count], c) - lam_value = tf.maximum(tf.cast(c, tf.float32) + 1.0, 1.0) - noise = tf.cast(tf.random.poisson([cluster_count, num_clusters], lam=lam_value), tf.float32) - noise = noise + epsilon - probs = noise / (tf.reduce_sum(noise, axis=1, keepdims=True)) - alpha = tf.random.uniform([cluster_count, 1], minval=0.5, maxval=0.8) - probs = (1 - alpha) * probs + alpha * tf.one_hot(cluster_indices, num_clusters) - probs = probs / tf.reduce_sum(probs, axis=1, keepdims=True) - cluster_probs_list.append(probs) - - features = tf.concat(features_list, axis=0) - labels = tf.concat(labels_list, axis=0) - cluster_probs = tf.concat(cluster_probs_list, axis=0) - - # Shuffle dataset - indices = tf.random.shuffle(tf.range(tf.shape(features)[0])) - features = tf.gather(features, indices) - labels = tf.gather(labels, indices) - cluster_probs = tf.gather(cluster_probs, indices) - - return features, labels, cluster_probs - - # Generate training dataset - print("\nGenerating training dataset...") - train_features, train_labels, train_cluster_probs = generate_dataset( - num_train_samples, feature_dim, num_clusters) - - # Generate separate test dataset - print("\nGenerating test dataset...") - test_features, test_labels, test_cluster_probs = generate_dataset( - num_test_samples, feature_dim, num_clusters, epsilon=1) - - print(f"\nTraining labels min: {tf.reduce_min(train_labels)}, max: {tf.reduce_max(train_labels)}") - print(f"Training labels head: {train_labels[:5]}") - print(f"Test labels min: {tf.reduce_min(test_labels)}, max: {tf.reduce_max(test_labels)}") - print(f"Test labels head: {test_labels[:5]}") - - # Visualize training dataset - print("\nVisualizing training dataset...") - visualize_dataset_analysis(train_features, train_labels, train_cluster_probs, - raw_dot_plot=False, method='pca', feature_indices=(0, 1)) - - # Create training dataset - train_dataset = tf.data.Dataset.from_tensor_slices( - ((train_features, train_cluster_probs), train_labels) - ).shuffle(1000).batch(64) - - # Create test dataset (no need to shuffle extensively) - test_dataset = tf.data.Dataset.from_tensor_slices( - ((test_features, test_cluster_probs), test_labels) - ).batch(64) - - # Print info about test dataset - for features, labels in test_dataset.take(1): - print(f"\nTest features shape: {features[0].shape}, Test labels shape: {labels.shape}") - print(f"Test features head: {features[0][:3]}") - print(f"Test labels head: {labels[:3]}") - - # Create and compile model - model = MoEModel(feature_dim, hidden_dim=8, num_experts=num_clusters, use_provided_gates=True) - model.compile( - optimizer=tf.keras.optimizers.Adam(learning_rate=0.001), - loss=tf.keras.losses.BinaryCrossentropy(), - metrics=['accuracy'], - ) - - # Train model - print("\nTraining model...") - model.fit(train_dataset, epochs=20) - - # Evaluate on independent test set - print("\nEvaluating on independent test set...") - eval_results = model.evaluate(test_dataset) - print(f"Evaluation results: {eval_results}") - - # Predict and analyze - # test_batch = next(iter(test_dataset.take(1))) - # predictions = model(test_batch[0], training=False) - # print(f"Sample predictions shape: {predictions['prediction'].shape}") - # print(f"Gate activations: {tf.reduce_mean(predictions['gates'], axis=0)}") - - # Test on a single sample - for (feat, cluster_prob), label in test_dataset.unbatch().take(1): - feat = tf.expand_dims(feat, 0) - cluster_prob = tf.expand_dims(cluster_prob, 0) - output = model((feat, cluster_prob), training=False) - print("Single sample prediction:", output['prediction'].numpy()[0], "True label:", label.numpy()) - print("Gate activations:", tf.reduce_mean(output['gates'], axis=0).numpy()) - - # Optional: Visualize test dataset - print("\nVisualizing test dataset...") - visualize_dataset_analysis(test_features, test_labels, test_cluster_probs, - raw_dot_plot=False, method='pca', feature_indices=(0, 1)) +# # Example usage +# if __name__ == "__main__": +# # Generate dummy dataset with clustered data and labels for training +# num_train_samples = 8000 +# num_test_samples = 2000 +# feature_dim = 64 +# num_clusters = 32 +# +# # Function to generate dataset with specified parameters +# def generate_dataset(num_samples, feature_dim, num_clusters, epsilon=0.1): +# # Compute samples per cluster +# base_count = num_samples // num_clusters +# counts = [base_count + (1 if i < num_samples % num_clusters else 0) for i in range(num_clusters)] +# +# features_list = [] +# labels_list = [] +# cluster_probs_list = [] +# distributions = ['normal', 'uniform', 'gamma', 'poisson'] +# +# for c in range(num_clusters): +# cluster_count = counts[c] +# n0 = cluster_count // 2 +# n1 = cluster_count - n0 +# dist = distributions[(2 * c) % len(distributions)] +# print(f"Cluster {c}: {dist} distribution, {n0} samples 0, {n1} samples 1") +# +# if dist == 'normal': +# features_0 = tf.random.normal([n0, feature_dim], mean=c, stddev=1.0) +# elif dist == 'uniform': +# features_0 = tf.random.uniform([n0, feature_dim], minval=0, maxval=1) +# elif dist == 'gamma': +# features_0 = tf.random.gamma([n0, feature_dim], alpha=2.0, beta=1.0) +# elif dist == 'poisson': +# features_0 = tf.cast(tf.random.poisson([n0, feature_dim], lam=3), tf.float32) +# else: +# features_0 = tf.random.normal([n0, feature_dim], mean=c, stddev=1.0) +# +# if dist == 'normal': +# features_1 = tf.random.normal([n1, feature_dim], mean=c+0.5, stddev=1.5) +# elif dist == 'uniform': +# features_1 = tf.random.uniform([n1, feature_dim], minval=1, maxval=2) +# elif dist == 'gamma': +# features_1 = tf.random.gamma([n1, feature_dim], alpha=5.0, beta=2.0) +# elif dist == 'poisson': +# features_1 = tf.cast(tf.random.poisson([n1, feature_dim], lam=6), tf.float32) +# else: +# features_1 = tf.random.normal([n1, feature_dim], mean=c+0.5, stddev=1.5) +# +# features_i = tf.concat([features_0, features_1], axis=0) +# labels_i = tf.concat([tf.zeros([n0, 1], tf.int32), tf.ones([n1, 1], tf.int32)], axis=0) +# features_list.append(features_i) +# labels_list.append(labels_i) +# +# # Generate random cluster probabilities per sample +# cluster_indices = tf.fill([cluster_count], c) +# lam_value = tf.maximum(tf.cast(c, tf.float32) + 1.0, 1.0) +# noise = tf.cast(tf.random.poisson([cluster_count, num_clusters], lam=lam_value), tf.float32) +# noise = noise + epsilon +# probs = noise / (tf.reduce_sum(noise, axis=1, keepdims=True)) +# alpha = tf.random.uniform([cluster_count, 1], minval=0.5, maxval=0.8) +# probs = (1 - alpha) * probs + alpha * tf.one_hot(cluster_indices, num_clusters) +# probs = probs / tf.reduce_sum(probs, axis=1, keepdims=True) +# cluster_probs_list.append(probs) +# +# features = tf.concat(features_list, axis=0) +# labels = tf.concat(labels_list, axis=0) +# cluster_probs = tf.concat(cluster_probs_list, axis=0) +# +# # Shuffle dataset +# indices = tf.random.shuffle(tf.range(tf.shape(features)[0])) +# features = tf.gather(features, indices) +# labels = tf.gather(labels, indices) +# cluster_probs = tf.gather(cluster_probs, indices) +# +# return features, labels, cluster_probs +# +# # Generate training dataset +# print("\nGenerating training dataset...") +# train_features, train_labels, train_cluster_probs = generate_dataset( +# num_train_samples, feature_dim, num_clusters) +# +# # Generate separate test dataset +# print("\nGenerating test dataset...") +# test_features, test_labels, test_cluster_probs = generate_dataset( +# num_test_samples, feature_dim, num_clusters, epsilon=1) +# +# print(f"\nTraining labels min: {tf.reduce_min(train_labels)}, max: {tf.reduce_max(train_labels)}") +# print(f"Training labels head: {train_labels[:5]}") +# print(f"Test labels min: {tf.reduce_min(test_labels)}, max: {tf.reduce_max(test_labels)}") +# print(f"Test labels head: {test_labels[:5]}") +# +# # Visualize training dataset +# print("\nVisualizing training dataset...") +# visualize_dataset_analysis(train_features, train_labels, train_cluster_probs, +# raw_dot_plot=False, method='pca', feature_indices=(0, 1)) +# +# # Create training dataset +# train_dataset = tf.data.Dataset.from_tensor_slices( +# ((train_features, train_cluster_probs), train_labels) +# ).shuffle(1000).batch(64) +# +# # Create test dataset (no need to shuffle extensively) +# test_dataset = tf.data.Dataset.from_tensor_slices( +# ((test_features, test_cluster_probs), test_labels) +# ).batch(64) +# +# # Print info about test dataset +# for features, labels in test_dataset.take(1): +# print(f"\nTest features shape: {features[0].shape}, Test labels shape: {labels.shape}") +# print(f"Test features head: {features[0][:3]}") +# print(f"Test labels head: {labels[:3]}") +# +# # Create and compile model +# model = MoEModel(feature_dim, hidden_dim=8, num_experts=num_clusters, use_provided_gates=True) +# model.compile( +# optimizer=tf.keras.optimizers.Adam(learning_rate=0.001), +# loss=tf.keras.losses.BinaryCrossentropy(), +# metrics=['accuracy'], +# ) +# +# # Train model +# print("\nTraining model...") +# model.fit(train_dataset, epochs=20) +# +# # Evaluate on independent test set +# print("\nEvaluating on independent test set...") +# eval_results = model.evaluate(test_dataset) +# print(f"Evaluation results: {eval_results}") +# +# # Predict and analyze +# # test_batch = next(iter(test_dataset.take(1))) +# # predictions = model(test_batch[0], training=False) +# # print(f"Sample predictions shape: {predictions['prediction'].shape}") +# # print(f"Gate activations: {tf.reduce_mean(predictions['gates'], axis=0)}") +# +# # Test on a single sample +# for (feat, cluster_prob), label in test_dataset.unbatch().take(1): +# feat = tf.expand_dims(feat, 0) +# cluster_prob = tf.expand_dims(cluster_prob, 0) +# output = model((feat, cluster_prob), training=False) +# print("Single sample prediction:", output['prediction'].numpy()[0], "True label:", label.numpy()) +# print("Gate activations:", tf.reduce_mean(output['gates'], axis=0).numpy()) +# +# # Optional: Visualize test dataset +# print("\nVisualizing test dataset...") +# visualize_dataset_analysis(test_features, test_labels, test_cluster_probs, +# raw_dot_plot=False, method='pca', feature_indices=(0, 1)) + +class BinaryMLP(tf.keras.Model): + def __init__(self, input_dim=1024): + super(BinaryMLP, self).__init__() + # First hidden layer + self.dense1 = tf.keras.layers.Dense( + units=512, activation='relu', name='dense_1' + ) + self.dropout1 = tf.keras.layers.Dropout( + rate=0.5, name='dropout_1' + ) + # Second hidden layer + self.dense2 = tf.keras.layers.Dense( + units=256, activation='relu', name='dense_2' + ) + self.dropout2 = tf.keras.layers.Dropout( + rate=0.5, name='dropout_2' + ) + # Output layer for binary classification + self.output_layer = tf.keras.layers.Dense( + units=1, activation='sigmoid', name='output_layer' + ) + + def call(self, inputs, training=False): + # If inputs come in as (features, labels), unpack and ignore labels + if isinstance(inputs, (tuple, list)): + x, _ = inputs + else: + x = inputs + + x = self.dense1(x) + x = self.dropout1(x, training=training) + x = self.dense2(x) + x = self.dropout2(x, training=training) + return self.output_layer(x) + +# # Example usage +# if __name__ == "__main__": +# # Generate dummy dataset +# num_samples = 1000 +# input_dim = 1024 +# features = tf.random.normal((num_samples, input_dim)) +# labels = tf.random.uniform((num_samples,), minval=0, maxval=2, dtype=tf.int32) +# +# # Create and compile model +# model = BinaryMLP(input_dim=input_dim) +# model.compile(optimizer='adam', loss='binary_crossentropy', metrics=['accuracy']) +# +# # Train model +# model.fit(features, labels, epochs=5, batch_size=32) +# # Evaluate model +# loss, accuracy = model.evaluate(features, labels) +# print(f"Loss: {loss}, Accuracy: {accuracy}") +# # Predict +# predictions = model.predict(features) +# print(f"Predictions shape: {predictions.shape}") +# print(f"Predictions head: {predictions[:5]}") + + +class TransformerBlock(layers.Layer): + """Single Transformer encoder block.""" + + def __init__(self, embed_dim, num_heads, ff_dim, dropout_rate=0.1, **kwargs): + super().__init__(**kwargs) + self.attn = layers.MultiHeadAttention(num_heads=num_heads, key_dim=embed_dim) + self.dropout1 = layers.Dropout(dropout_rate) + self.norm1 = layers.LayerNormalization(epsilon=1e-6) + + self.ffn = tf.keras.Sequential([ + layers.Dense(ff_dim, activation='gelu'), + layers.Dropout(dropout_rate), + layers.Dense(embed_dim), + layers.Dropout(dropout_rate), + ]) + self.norm2 = layers.LayerNormalization(epsilon=1e-6) + + def call(self, inputs, training=False): + # Self-attention block + attn_output = self.attn(inputs, inputs) + attn_output = self.dropout1(attn_output, training=training) + out1 = self.norm1(inputs + attn_output) + + # Feed-forward block + ffn_output = self.ffn(out1, training=training) + return self.norm2(out1 + ffn_output) + + +import tensorflow as tf +from tensorflow.keras import layers, Model + +class TransformerBlock(layers.Layer): + """Single Transformer encoder block.""" + def __init__(self, embed_dim, num_heads, ff_dim, dropout_rate=0.1, **kwargs): + super().__init__(**kwargs) + self.attn = layers.MultiHeadAttention(num_heads=num_heads, key_dim=embed_dim) + self.dropout1 = layers.Dropout(dropout_rate) + self.norm1 = layers.LayerNormalization(epsilon=1e-6) + + self.ffn = tf.keras.Sequential([ + layers.Dense(ff_dim, activation='gelu'), + layers.Dropout(dropout_rate), + layers.Dense(embed_dim), + ]) + self.dropout2 = layers.Dropout(dropout_rate) + self.norm2 = layers.LayerNormalization(epsilon=1e-6) + + def call(self, x, training=False): + # Self-attention + residual + norm + attn_output = self.attn(x, x, training=training) + attn_output = self.dropout1(attn_output, training=training) + x = self.norm1(x + attn_output) + + # Feed-forward + residual + norm + ffn_output = self.ffn(x, training=training) + ffn_output = self.dropout2(ffn_output, training=training) + return self.norm2(x + ffn_output) + + +class TabularTransformer(Model): + """ + Transformer-based classifier for tabular data. + Applies a downsampling pool to reduce sequence length and avoid OOM. + """ + def __init__( + self, + input_dim=1024, + embed_dim=64, + num_heads=8, + ff_dim=256, + num_layers=4, + dropout_rate=0.1, + pool_size=4, + **kwargs + ): + super().__init__(**kwargs) + self.pool_size = pool_size + # Project each scalar feature to an embedding + self.feature_embedding = layers.Dense(embed_dim, name='feature_embedding') + # Downsample sequence length: 1024 -> 1024/pool_size + self.pool = layers.MaxPool1D(pool_size=pool_size, name='sequence_pool') + reduced_seq_len = input_dim // pool_size + + # Positional embeddings for reduced tokens + self.pos_embedding = self.add_weight( + name='pos_embedding', + shape=(1, reduced_seq_len, embed_dim), + initializer='random_normal' + ) + # Transformer encoder stack + self.transformer_blocks = [ + TransformerBlock(embed_dim, num_heads, ff_dim, dropout_rate) + for _ in range(num_layers) + ] + # Pool & classification head + self.global_pool = layers.GlobalAveragePooling1D(name='global_avg_pool') + self.dropout = layers.Dropout(dropout_rate, name='dropout_final') + self.classifier = layers.Dense(1, activation='sigmoid', name='output') + + def call(self, inputs, training=False): + # Unpack if inputs come as (features, labels) + if isinstance(inputs, (tuple, list)): + x, _ = inputs + else: + x = inputs + + # shape -> (batch, input_dim, 1) + x = tf.expand_dims(x, axis=-1) + # Embed features -> (batch, input_dim, embed_dim) + x = self.feature_embedding(x) + # Downsample tokens -> (batch, reduced_seq_len, embed_dim) + x = self.pool(x) + # Add positional embeddings + x = x + self.pos_embedding + + # Transformer encoder stack + for block in self.transformer_blocks: + x = block(x, training=training) + + # Pool over tokens -> (batch, embed_dim) + x = self.global_pool(x) + x = self.dropout(x, training=training) + return self.classifier(x) + +# # Example usage +# if __name__ == "__main__": +# num_samples = 1000 +# input_dim = 1024 +# features = tf.random.normal((num_samples, input_dim)) +# labels = tf.random.uniform((num_samples,), maxval=2, dtype=tf.int32) +# +# model = TabularTransformer(input_dim=input_dim, pool_size=4) +# model.build(input_shape=(None, input_dim)) +# model.compile(optimizer='adam', loss='binary_crossentropy', metrics=['accuracy']) +# model.summary() +# +# model.fit(features, labels, epochs=5, batch_size=32) +# loss, accuracy = model.evaluate(features, labels) +# print(f"Loss: {loss:.4f}, Accuracy: {accuracy:.4f}") +# # Predict +# predictions = model.predict(features) +# print(f"Predictions shape: {predictions.shape}") +# print(f"Predictions head: {predictions[:5]}") + + +class EmbeddingCNN(Model): + """ + 1D-CNN + MLP head for binary classification on fixed-length embeddings. + """ + + def __init__(self, input_dim, dropout_rate=0.5): + super().__init__(name='Embedding_CNN') + self.input_dim = input_dim + + # Reshape flat embedding to sequence (length=input_dim, channels=1) + self.reshape_layer = layers.Reshape((input_dim, 1), name='reshape') + + # Convolutional blocks + self.conv1 = layers.Conv1D(64, 5, padding='same', activation='relu', name='conv1') + self.pool1 = layers.MaxPool1D(2, name='pool1') + + self.conv2 = layers.Conv1D(128, 5, padding='same', activation='relu', name='conv2') + self.pool2 = layers.MaxPool1D(2, name='pool2') + + # Flatten and MLP head + self.flatten = layers.Flatten(name='flatten') + self.dense = layers.Dense(64, activation='relu', name='dense') + self.dropout = layers.Dropout(dropout_rate, name='dropout') + + # Final binary output + self.output_layer = layers.Dense(1, activation='sigmoid', name='output') + + def call(self, inputs, training=False): + # Unpack if inputs come as (features, labels) + if isinstance(inputs, (tuple, list)): + x, _ = inputs + else: + x = inputs + # Now safe to reshape just the feature tensor + x = self.reshape_layer(x) + x = self.conv1(x) + x = self.pool1(x) + x = self.conv2(x) + x = self.pool2(x) + x = self.flatten(x) + x = self.dense(x) + x = self.dropout(x, training=training) + return self.output_layer(x) + +# # # Example usage +# if __name__ == "__main__": +# num_samples = 1000 +# input_dim = 1024 +# features = tf.random.normal((num_samples, input_dim)) +# labels = tf.random.uniform((num_samples,), maxval=2, dtype=tf.int32) +# model = EmbeddingCNN(input_dim=input_dim, dropout_rate=0.5) +# model.build(input_shape=(None, input_dim)) +# model.compile(optimizer='adam', loss='binary_crossentropy', metrics=['accuracy']) +# model.summary() +# model.fit(features, labels, epochs=5, batch_size=32) +# loss, accuracy = model.evaluate(features, labels) +# print(f"Loss: {loss:.4f}, Accuracy: {accuracy:.4f}") +# # Predict +# predictions = model.predict(features) +# print(f"Predictions shape: {predictions.shape}") +# print(f"Predictions head: {predictions[:5]}") From 4f5fa102e857abeefabb19d8d6b763b538737ac5 Mon Sep 17 00:00:00 2001 From: amirreza Date: Mon, 12 May 2025 15:50:08 +0200 Subject: [PATCH 29/83] Add MHC sequence column and combine datasets functionality --- run_netmhcpan_script.py | 244 ++++++++++++++++++++++++++++++++++++---- 1 file changed, 224 insertions(+), 20 deletions(-) diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py index a12041d98..dee7e5ffc 100644 --- a/run_netmhcpan_script.py +++ b/run_netmhcpan_script.py @@ -1,6 +1,6 @@ +import difflib import json import sys - from run_utils import run_and_parse_netmhcpan import os import pandas as pd @@ -29,17 +29,150 @@ def load_data(path): return data +def add_mhc_sequence_column(input_df): + """ + Add MHC sequence information to the dataset by looking up allele sequences. + + Args: + input_df: DataFrame with an 'allele' column (like el_data_0 or el_data_1) + + Returns: + DataFrame with added 'mhc_sequence' column + """ + # TODO needs revision and validation + dict_file = "data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv" + + # Load allele-sequence mapping + try: + dict_df = pd.read_csv(dict_file, usecols=['simple_allele', 'sequence']) + dict_df['net_mhc_allele'] = ( + dict_df['simple_allele'] + .str.replace('*', '', regex=False) + .str.replace(':', '', regex=False) + ) + mhc_sequence_map = dict(zip(dict_df['net_mhc_allele'], dict_df['sequence'])) + print(f"Loaded allele sequence mapping with {len(mhc_sequence_map)} entries") + except FileNotFoundError: + print(f"Warning: Dictionary file {dict_file} not found. No sequences will be mapped.") + mhc_sequence_map = {} + except Exception as e: + print(f"Error loading dictionary file: {str(e)}") + mhc_sequence_map = {} + + def lookup_sequence(allele_str): + """Find the sequence for an allele with fallback strategies.""" + if pd.isna(allele_str): + return None + + print(f"Processing allele: {allele_str}") + + # Handle list of alleles (from el_data_0 or el_data_1) + if isinstance(allele_str, str) and allele_str.startswith('[') and allele_str.endswith(']'): + try: + allele_list = eval(allele_str) + if isinstance(allele_list, list): + # Get sequence for each allele in list and join with '/' + seqs = [lookup_sequence(a) for a in allele_list] + found = [s for s in seqs if s is not None] + return '/'.join(found) if found else None + except: + pass # If eval fails, continue with normal processing + + # Split on '-' if there are two alleles mashed together + if 'H-2' in allele_str: + parts = [allele_str] + elif '-' in allele_str: + parts = allele_str.split('-') # eg. HLA-DRB101:01-DQA101:01 to [HLA, DRB101:01, DQA101:01] or HLA-DRB101:01 to [HLA, DRB101:01] + if len(parts) > 2: # eg. [HLA, DRB101:01, DQA101:01] + pref = parts[0] # HLA + part1 = "-".join(parts[0:2]) # HLA-DRB101:01 + part2 = pref + "-" + parts[2] # HLA-DQA101:01 + parts = [part1, part2] # [HLA-DRB101:01, HLA-DQA101:01] + elif len(parts) == 2: # eg. [HLA, DRB101:01] + pref = parts[0] # HLA + part1 = parts[1] # DRB101:01 + parts = [pref + "-" + part1] # [HLA-DRB101:01] + else: + parts = [allele_str] # No split needed eg. DRB101:01 + else: + parts = [allele_str] + + seqs = [] + for part in parts: + net = part.replace('*', '').replace(':', '') + seq = mhc_sequence_map.get(net) + if seq is None: + # First try to find keys where our name is contained within + containing_matches = [k for k in mhc_sequence_map.keys() if net in k] + if containing_matches: + # Sort by length to prefer closest match in length + best = sorted(containing_matches, key=len)[0] + seq = mhc_sequence_map[best] + print(f"No exact match for '{net}', using containing match '{best}'") + else: + # fallback to closest match (cutoff can be tuned) + matches = difflib.get_close_matches(net, + mhc_sequence_map.keys(), + n=1, + cutoff=0.6) + if matches: + best = matches[0] + seq = mhc_sequence_map[best] + print(f"No exact match for '{part}', using closest match '{best}'") + seqs.append(seq) + + # if *all* parts failed, return None + if all(s is None for s in seqs): + return None + + # otherwise join only the found sequences with '/' + found = [s for s in seqs if s is not None] + return '/'.join(found) + + # Process unique alleles for efficiency + # Process unique alleles for efficiency - handle both string and list types + # Process unique alleles for efficiency - handle both string and list types + if input_df['allele'].apply(lambda x: isinstance(x, list)).any(): + # If the column contains lists, convert them to strings for uniqueness check + unique_alleles = input_df['allele'].dropna().apply(lambda x: str(x) if isinstance(x, list) else x).unique() + # Create mapping with original values + allele_seq_map = {} + for allele in unique_alleles: + # Keep allele as string for dictionary key purposes + allele_seq_map[allele] = lookup_sequence(allele) + else: + # Normal case when all values are strings or scalars + unique_alleles = input_df['allele'].dropna().unique() + allele_seq_map = {allele: lookup_sequence(allele) for allele in unique_alleles} + + # Apply mapping to the DataFrame + updated_df = input_df.copy() + # Convert lists to strings for mapping lookup + updated_df['mhc_sequence'] = updated_df['allele'].apply( + lambda x: allele_seq_map.get(str(x) if isinstance(x, list) else x) + ) + + # Report and save + n_missing = updated_df['mhc_sequence'].isna().sum() + if n_missing: + print(f"Found {n_missing} alleles without matching mhc_sequence") + print(f"Combined dataset shape: {updated_df.shape}") + + return updated_df + + def process_data(mhc_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", tmp_path = "data/NetMHCpan_dataset/tmp/", mhc_type=2): """ Load and process MHCII data for NetMHCpan This function works for only HLA inputs Args: - mhc_path: - tmp_path: + mhc_path: Path to the MHC data directory + tmp_path: Path to the temporary directory for storing intermediate files Returns: - + el_data: DataFrame containing EL data + ba_data: DataFrame containing BA data """ if not os.path.isdir(tmp_path): @@ -58,7 +191,7 @@ def process_data(mhc_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/", return if mhc_type == 1: - train_files = [f for f in os.listdir(mhc_path) if "_ba" in f or "_el" in f] + train_files = [f for f in os.listdir(mhc_path) if "_ba" in f or "_el" in f and "test" not in f] else: train_files = [f for f in os.listdir(mhc_path) if "train" in f] print(f"Found {len(train_files)} train files") @@ -335,6 +468,54 @@ def run_netmhcpan_(el_data, true_label, tmp_path, results_dir, chunk_number, mhc dropped_rows.to_csv(dropped_rows_path, mode="a", header=not os.path.exists(dropped_rows_path), index=False) +def combine_datasets_(results_dir, include_dropped=False, final_output_path=None): + """ + dropped rows are the samples that received the wrong label from netmhcpan + Args: + results_dir: + include_dropped: + + Returns: + + """ + # read all CSV files in the results directory + all_csv_files = [os.path.join(results_dir, f) for f in os.listdir(results_dir) if f.endswith('.csv')] + # select el1 files and ignore files with dropped in the names + if include_dropped: + all_csv_files = [f for f in all_csv_files if "el1" in f] + else: + all_csv_files = [f for f in all_csv_files if "el1" in f and "dropped" not in f] + print(f"Combining {len(all_csv_files)} CSV files into final output") + + for csv_file in all_csv_files: + try: + df = pd.read_csv(csv_file) + df.rename(columns={'peptide': 'long_mer', 'label': 'convoluted_label', 'MHC': 'allele'}, inplace=True) + # select only the columns that are needed + df = df[["allele", "long_mer", "assigned_label", "convoluted_label"]] + except Exception as e: + print(f"Error reading {csv_file}: {str(e)}") + continue + + # Standardize column names + if 'Peptide' in df.columns and 'peptide' not in df.columns: + df['peptide'] = df['Peptide'] + elif 'Peptide' in df.columns and 'peptide' in df.columns: + df['peptide'] = df['peptide'].fillna(df['Peptide']) + if 'MHC' in df.columns and 'allele' not in df.columns: + df['allele'] = df['MHC'] + elif 'MHC' in df.columns and 'allele' in df.columns: + df['allele'] = df['allele'].fillna(df['MHC']) + + combined_df = pd.concat([pd.read_csv(f) for f in all_csv_files if os.path.getsize(f) > 0], ignore_index=True) + + # save the combined dataframe to disk + if final_output_path: + combined_df.to_csv(final_output_path, index=False) + else: + combined_df.to_csv(os.path.join(results_dir, "combined_results.csv"), index=False) + + return # def run_netmhcpan(el_data_1, unique_alleles, tmp_path, results_dir): # for allele in unique_alleles: @@ -557,7 +738,7 @@ def run_(arg1, arg2): mhcI_path = "data/NetMHCpan_dataset/NetMHCpan_train/" # tmp_path = "data/NetMHCpan_dataset/tmp/" tmp_path = "data/NetMHCpan_dataset/tmp_I/" - results_dir = "data/NetMHCpan_dataset/results/" + results_dir = "data/NetMHCpan_dataset/results_I/" mhc_class = 1 @@ -612,6 +793,9 @@ def run_(arg1, arg2): # print the len of el_data_1 print(f"Length of el_data_1: {len(el_data_1)}") + # print the len of el_data_0 + print(f"Length of el_data_0: {len(el_data_0)}") + # subset 1000 random samples from the data for testing # el_data_1 = el_data_1.sample(n=1000, random_state=42) # unique_cell_lines = el_data_1["cell_line_id"].unique() @@ -620,24 +804,44 @@ def run_(arg1, arg2): # parallelize_netmhcpan(el_data_1, tmp_path, results_dir) # run the netmhcpan for the el_data_1 - run_netmhcpan_(el_data_1, 1, tmp_path, results_dir, arg2, mhc_class=mhc_class) + # run_netmhcpan_(el_data_1, 1, tmp_path, results_dir, arg2, mhc_class=mhc_class) # run the netmhcpan for the el_data_0 # run_netmhcpan_(el_data_0, 0, tmp_path, results_dir, arg2) - # if arg1 == "combine_results": - # # Combine results - # df = combine_results_(results_dir, final_output_path) - # - # el_data_0 = pd.read_csv("data/NetMHCpan_dataset/tmp/el_data_0.csv") - # ba_data = pd.read_csv("data/NetMHCpan_dataset/tmp/ba_data.csv") - # - # # concatenate the dataframes df and el_data_0 and ba_data - # df = pd.concat([df, el_data_0], ignore_index=True) - # df = pd.concat([df, ba_data], ignore_index=True) - # - # # save the final output - # df.to_csv("data/NetMHCpan_dataset/NetMHCIIpan_all.csv", index=False) + if arg1 == "combine_results": + # Combine results + df = combine_datasets_(results_dir, final_output_path=f"{results_dir}/combined_results.csv") + + el_data_0 = pd.read_csv(f"{tmp_path}/el_data_0.csv") + ba_data = pd.read_csv(f"{tmp_path}/ba_data.csv") + + # add labels to ba_data with threshold of 0.426 + ba_data["label"] = ba_data["label"].apply(lambda x: 1 if float(x) >= 0.426 else 0) + ba_data.rename(columns={'peptide': 'long_mer', 'label': 'convoluted_label'}, inplace=True) + + # explode the el_data_0['allele'] column (we do this because all samples in the el_data_0 have the same label with 100% confidence) + el_data_0["allele"] = el_data_0["allele"].apply(lambda x: eval(x)) + el_data_0 = el_data_0.explode("allele") + el_data_0.rename(columns={'peptide': 'long_mer', 'label': 'convoluted_label'}, inplace=True) + + # concatenate the dataframes df and el_data_0 and ba_data + df = pd.concat([df, el_data_0], ignore_index=True) + df = pd.concat([df, ba_data], ignore_index=True) + + # add mhc class column + df["mhc_class"] = mhc_class + + # drop duplicates + print(f"Before dropping duplicates: {df.shape}") + df = df.drop_duplicates(subset=["allele", "long_mer"], keep="first") + print(f"After dropping duplicates: {df.shape}") + + # add mhc_sequence column + df = add_mhc_sequence_column(df) + + # save the final output + df.to_csv(f"data/NetMHCpan_dataset/combined_data_{mhc_class}.csv", index=False) def main(): if len(sys.argv) < 1: From f7d3e9e66f0843290b79622872c775ab8baa2997 Mon Sep 17 00:00:00 2001 From: amirreza Date: Mon, 12 May 2025 15:50:17 +0200 Subject: [PATCH 30/83] Refactor data processing in run_pep2vec.py: remove test data handling, streamline binding label addition, and enhance dataset preparation for NetMHCpan --- run_pep2vec.py | 226 +++++++++++++++++++++++++++++++++++-------------- 1 file changed, 163 insertions(+), 63 deletions(-) diff --git a/run_pep2vec.py b/run_pep2vec.py index 8dc6f4c02..bcbb6d264 100644 --- a/run_pep2vec.py +++ b/run_pep2vec.py @@ -4,7 +4,7 @@ import pandas as pd import numpy as np from utils.processing_functions import create_k_fold_leave_one_out_stratified_cross_validation -from run_pMHC_DL import train_and_evaluate_scqvae +from sklearn.model_selection import train_test_split def load_data(file_path, sep=","): """ @@ -125,7 +125,7 @@ def select_columns(df, columns): # return f"{locus}*{num[:2]}:{num[2:]}" # return chain -def add_binding_label(df_path, train_path, test_path, output_dir=None): +def add_binding_label(df_path, train_path, output_dir=None): """ Add binding labels and MHC sequences to the DataFrame based on allotype and peptide pairs. @@ -135,8 +135,6 @@ def add_binding_label(df_path, train_path, test_path, output_dir=None): DataFrame, path to a file, or directory containing multiple files to add binding labels to train_path : str Path to training data CSV file with binding labels - test_path : str - Path to test data CSV file with binding labels output_dir : str, optional Directory to save labeled files, if None will overwrite original files @@ -146,32 +144,35 @@ def add_binding_label(df_path, train_path, test_path, output_dir=None): """ # Load train and test binding label mappings train_df = pd.read_csv(train_path) - test_df = pd.read_csv(test_path) + + # rename columns if needed + if "allele" not in train_df.columns: + train_df.rename(columns={"allotype": "allele"}, inplace=True) + if "long_mer" not in train_df.columns: + train_df.rename(columns={"peptide": "long_mer"}, inplace=True) + if "binding_label" not in train_df.columns: + if "assigned_label" in train_df.columns: + train_df.rename(columns={"assigned_label": "binding_label"}, inplace=True) + else: + raise ValueError("No binding label column found in the training data.") # Create binding label mappings - train_binding_labels = { + binding_labels = { (row["allele"], row["long_mer"]): row["binding_label"] for _, row in train_df.iterrows() } - test_binding_labels = { - (row["allele"], row["long_mer"]): row["binding_label"] - for _, row in test_df.iterrows() - } - # Create MHC sequence mappings - train_mhc_sequences = { - row["allele"]: row["mhc_sequence"] - for _, row in train_df.iterrows() - } - - test_mhc_sequences = { - row["allele"]: row["mhc_sequence"] - for _, row in test_df.iterrows() - } + if "mhc_sequence" in train_df.columns: + mhc_sequences = { + row["allele"]: row["mhc_sequence"] + for _, row in train_df.iterrows() + } + else: + mhc_sequences = {} # Combine MHC sequence mappings (test data takes precedence if duplicates) - mhc_sequences = {**train_mhc_sequences, **test_mhc_sequences} + mhc_sequences = {**mhc_sequences} # Check if df_path is a directory if isinstance(df_path, str) and os.path.isdir(df_path): @@ -182,15 +183,18 @@ def add_binding_label(df_path, train_path, test_path, output_dir=None): if os.path.isfile(file_path) and (file_path.endswith('.csv') or file_path.endswith('.parquet')): print(f"Processing file: {filename}") results[filename] = process_single_file( - file_path, train_binding_labels, test_binding_labels, mhc_sequences, output_dir + file_path, binding_labels, mhc_sequences, output_dir ) + # remove the file after processing + if output_dir and os.path.exists(file_path): + os.remove(file_path) return results else: # Process a single file or DataFrame - return process_single_file(df_path, train_binding_labels, test_binding_labels, mhc_sequences, output_dir) + return process_single_file(df_path, binding_labels, mhc_sequences, output_dir) -def process_single_file(df_or_path, train_binding_labels, test_binding_labels, mhc_sequences, output_dir=None): +def process_single_file(df_or_path, binding_labels, mhc_sequences, output_dir=None): """Helper function to process a single file or DataFrame""" # Process the provided dataframe or file if isinstance(df_or_path, str): @@ -205,7 +209,7 @@ def process_single_file(df_or_path, train_binding_labels, test_binding_labels, m # Determine if this is a test file based on filename is_test = file_path and "test" in os.path.basename(file_path).lower() - binding_labels = test_binding_labels if is_test else train_binding_labels + binding_labels = binding_labels if is_test else binding_labels # Check if columns use 'allotype'/'peptide' naming convention (parquet files) # or 'allele'/'long_mer' naming convention (CSV files) @@ -248,45 +252,97 @@ def process_single_file(df_or_path, train_binding_labels, test_binding_labels, m return df -def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0): - # Conbotnet dataset paths - # ConBotNet only contains mhc class II +def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5): + """ + Prepare datasets for Pep2Vec training and evaluation. + Parameters: + ----------- + dataset_name : str + Name of the dataset directory (e.g., "Conbotnet", "ConvNeXT-MHC", "NetMHCpan_dataset") + mhc_type : str + Type of MHC ("mhc1" or "mhc2") + subset_prop : float + Proportion of data to use (1.0 = all data) + n_folds : int + Number of cross-validation folds + """ # Setup paths base_dir = os.path.dirname(__file__) data_dir = os.path.join(base_dir, "data") - conbotnet_dir = os.path.join(data_dir, dataset_name) - folds_dir = os.path.join(conbotnet_dir, "folds") + dataset_dir = os.path.join(data_dir, dataset_name) + folds_dir = os.path.join(dataset_dir, "folds") output_dir = os.path.join(data_dir, "Pep2Vec", dataset_name) # Create directories os.makedirs(output_dir, exist_ok=True) os.makedirs(folds_dir, exist_ok=True) - # Define datasets - paths = { - 'train': os.path.join(conbotnet_dir, "train.csv"), - 'test': os.path.join(conbotnet_dir, "test_all.csv") - } + # Define paths and columns based on dataset + is_netmhcpan = dataset_name.lower() == "netmhcpan_dataset" + + if is_netmhcpan: + # NetMHCpan has a single cleaned_data.csv file + cleaned_data_path = os.path.join(dataset_dir, "cleaned_data.csv") + columns = ["long_mer","convoluted_label", "assigned_label", "MHC_class", "allele"] + else: + # Other datasets have separate train/test files + paths = { + 'train': os.path.join(dataset_dir, "train.csv"), + 'test': os.path.join(dataset_dir, "test_all.csv") + } + columns = ["allele", "long_mer", "binding_label", "mhc_sequence"] # Column configuration - columns = ["allele", "long_mer", "binding_label", "mhc_sequence"] - rename_map = {"allele": "allotype", "long_mer": "peptide"} # required for pep2vec + rename_map = {"allele": "allotype", "long_mer": "peptide"} # required for pep2vec + + # Rename label column for NetMHCpan + if is_netmhcpan: + rename_map["assigned_label"] = "binding_label" + # TODO if mhc_sequence is required it must be further processed + columns = ["allotype", "peptide", "binding_label"] # Load and process datasets datasets = {} - for name, path in paths.items(): - df = load_data(path) - print(f"{name.capitalize()} dataset shape: {df.shape}") - # Process dataframe - df = (select_columns(df, columns) - .rename(columns=rename_map) - .drop_duplicates(subset=["allotype", "peptide"]) - .dropna()) + if is_netmhcpan: + # Load NetMHCpan dataset from single file + print(f"Loading NetMHCpan dataset from {cleaned_data_path}") + df = load_data(cleaned_data_path) + print(f"Full dataset shape: {df.shape}") + + # Filter by MHC class based on mhc_type parameter + mhc_class = 2 if mhc_type.lower() == "mhc2" else 1 + df = df[df["mhc_class"] == mhc_class].copy() + print(f"Dataset after filtering for MHC class {mhc_class}: {df.shape}") - print(f"{name.capitalize()} dataset shape after processing: {df.shape}") - datasets[name] = df + # rename columns + df.rename(columns=rename_map, inplace=True) + + # Process dataframes + train_df = (select_columns(df, columns) + .rename(columns=rename_map) + .drop_duplicates(subset=["allotype", "peptide"]) + .dropna()) + + print(f"Train dataset shape after processing: {train_df.shape}") + + datasets['train'] = train_df + datasets['test'] = None + else: + # Regular dataset processing with separate files + for name, path in paths.items(): + df = load_data(path) + print(f"{name.capitalize()} dataset shape: {df.shape}") + + # Process dataframe + df = (select_columns(df, columns) + .rename(columns=rename_map) + .drop_duplicates(subset=["allotype", "peptide"]) + .dropna()) + + print(f"{name.capitalize()} dataset shape after processing: {df.shape}") + datasets[name] = df # # change the allele names to the ones in the NetMHCpan dataset # # Load the NetMHCpan dataset once @@ -300,8 +356,25 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0): # datasets['test']['allotype'] = datasets['test']['allotype'].apply( # lambda x: get_netmhcpan_allele(x, netmhcpan_dataset, allele_cache)) + # define test1 and test2 datasets + # test1: stratified 10% sampling from train + train_df_ = datasets['train'] + train_updated, test1 = train_test_split( + train_df_, + test_size=0.1, + stratify=train_df_['binding_label'], + random_state=42 + ) + datasets['train'] = train_updated.reset_index(drop=True) + + # test2: select allele with lowest sample count + allele_counts = datasets['train']['allotype'].value_counts() + lowest_allele = allele_counts.idxmin() + test2 = datasets['train'][datasets['train']['allotype'] == lowest_allele].copy() + datasets['train'] = datasets['train'][datasets['train']['allotype'] != lowest_allele].reset_index(drop=True) + # Create k-fold cross-validation splits - k = 5 + k = n_folds folds = create_k_fold_leave_one_out_stratified_cross_validation( datasets['train'], k=k, target_col="binding_label", id_col="allotype", train_size=0.8, subset_prop=subset_prop @@ -335,7 +408,12 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0): f.write(f"Fold {i}: {held_out_id}\n") # Save the test set - datasets['test'].to_csv(os.path.join(folds_dir, "test_set.csv"), index=False, header=True) + # if dataset has a test set, save it as well + if datasets.get('test') is not None: + datasets['test'].to_csv(os.path.join(folds_dir, "test_original.csv"), index=False, header=True) + # Save the test1 and test2 sets + test1.to_csv(os.path.join(folds_dir, "test1_stratified.csv"), index=False, header=True) + test2.to_csv(os.path.join(folds_dir, "test2_single_unique_allele.csv"), index=False, header=True) print("Test dataset saved.") ################### Pep2Vec ################### @@ -373,25 +451,47 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0): validation_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"val_set_fold_{i}.csv") output_file = os.path.join(output_dir, f"pep2vec_output_val_fold_{i}.parquet") os.system(f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {validation_file} --output_location {output_file} --mhctype {mhc_type}") - # test set - test_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", "test_set.csv") - output_file = os.path.join(output_dir, f"pep2vec_output_test_fold_{i}.parquet") - os.system(f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") + + # # test set + # test_file = os.path.join(folds_dir, "test_original.csv") + # if os.path.exists(test_file): + # output_file = os.path.join(output_dir, f"pep2vec_output_test.parquet") + # os.system( + # f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") + # # Process test1 and test2 datasets + # for test_name in ["test1_stratified", "test2_single_unique_allele"]: + # test_file = os.path.join(folds_dir, f"{test_name}.csv") + # if os.path.exists(test_file): + # output_file = os.path.join(output_dir, f"pep2vec_output_{test_name}.parquet") + # os.system( + # f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") ############################################### if __name__ == "__main__": - main("Conbotnet", "mhc2", 0.01) - add_binding_label( - df_path=os.path.join("data", "Pep2Vec", "Conbotnet"), - train_path=os.path.join("data", "Conbotnet", "train.csv"), - test_path=os.path.join("data", "Conbotnet", "test_all.csv"), - output_dir=os.path.join("data", "Pep2Vec", "Conbotnet_new") - ) - # main("ConvNeXT-MHC", "mhc1", 0.01) + # main("Conbotnet", "mhc2", 0.001) + # add_binding_label( + # df_path=os.path.join("data", "Pep2Vec", "Conbotnet"), + # train_path=os.path.join("data", "Conbotnet", "train.csv"), + # test_path=os.path.join("data", "Conbotnet", "test_all.csv"), + # output_dir=os.path.join("data", "Pep2Vec", "Conbotnet_new_subset") + # ) + # main("ConvNeXT-MHC", "mhc1", 0.001, 5) # add_binding_label( # df_path=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC"), # train_path=os.path.join("data", "ConvNeXT-MHC", "train.csv"), - # test_path=os.path.join("data", "ConvNeXT-MHC", "test_all.csv"), - # output_dir=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC_subset_new") + # output_dir=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC_new_subset") # ) + # main("NetMHCpan_dataset", "mhc2", 0.01, 5) + # add_binding_label( + # df_path=os.path.join("data", "Pep2Vec", "NetMHCIIpan_dataset"), + # train_path=os.path.join("data", "NetMHCIIpan_dataset", "cleaned_data.csv"), + # output_dir=os.path.join("data", "Pep2Vec", "NetMHCIpan_dataset_new_subset") + # ) + main("NetMHCpan_dataset", "mhc1", 0.01, 5) + add_binding_label( + df_path=os.path.join("data", "Pep2Vec", "NetMHCIpan_dataset"), + train_path=os.path.join("data", "NetMHCIIpan_dataset", "cleaned_data.csv"), + output_dir=os.path.join("data", "Pep2Vec", "NetMHCIpan_dataset_new_subset") + ) + From 857a26bf3de8fdc17f8aff2e111b400519a9ed84 Mon Sep 17 00:00:00 2001 From: amirreza Date: Mon, 12 May 2025 17:54:38 +0200 Subject: [PATCH 31/83] Refactor combine_datasets_ function in run_netmhcpan_script.py: remove final_output_path parameter and return combined dataframe --- run_netmhcpan_script.py | 12 +++--------- 1 file changed, 3 insertions(+), 9 deletions(-) diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py index dee7e5ffc..a7b34c597 100644 --- a/run_netmhcpan_script.py +++ b/run_netmhcpan_script.py @@ -468,7 +468,7 @@ def run_netmhcpan_(el_data, true_label, tmp_path, results_dir, chunk_number, mhc dropped_rows.to_csv(dropped_rows_path, mode="a", header=not os.path.exists(dropped_rows_path), index=False) -def combine_datasets_(results_dir, include_dropped=False, final_output_path=None): +def combine_datasets_(results_dir, include_dropped=False): """ dropped rows are the samples that received the wrong label from netmhcpan Args: @@ -509,13 +509,7 @@ def combine_datasets_(results_dir, include_dropped=False, final_output_path=None combined_df = pd.concat([pd.read_csv(f) for f in all_csv_files if os.path.getsize(f) > 0], ignore_index=True) - # save the combined dataframe to disk - if final_output_path: - combined_df.to_csv(final_output_path, index=False) - else: - combined_df.to_csv(os.path.join(results_dir, "combined_results.csv"), index=False) - - return + return combined_df # def run_netmhcpan(el_data_1, unique_alleles, tmp_path, results_dir): # for allele in unique_alleles: @@ -811,7 +805,7 @@ def run_(arg1, arg2): if arg1 == "combine_results": # Combine results - df = combine_datasets_(results_dir, final_output_path=f"{results_dir}/combined_results.csv") + df = combine_datasets_(results_dir) el_data_0 = pd.read_csv(f"{tmp_path}/el_data_0.csv") ba_data = pd.read_csv(f"{tmp_path}/ba_data.csv") From 4ccd5aecfe8bc6e7d48d4c8d547c3ebe4e697f51 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 13 May 2025 18:14:48 +0200 Subject: [PATCH 32/83] Refactor allele processing in run_netmhcpan_script.py: improve error handling, standardize column names, and enhance missing sequence reporting --- run_netmhcpan_script.py | 83 +++++++++++++++++++---------------------- 1 file changed, 39 insertions(+), 44 deletions(-) diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py index a7b34c597..a2f6e2f03 100644 --- a/run_netmhcpan_script.py +++ b/run_netmhcpan_script.py @@ -75,11 +75,11 @@ def lookup_sequence(allele_str): seqs = [lookup_sequence(a) for a in allele_list] found = [s for s in seqs if s is not None] return '/'.join(found) if found else None - except: - pass # If eval fails, continue with normal processing + except Exception as e: + print(f" Failed to eval list: {e}") # Split on '-' if there are two alleles mashed together - if 'H-2' in allele_str: + elif 'H-2' in allele_str: parts = [allele_str] elif '-' in allele_str: parts = allele_str.split('-') # eg. HLA-DRB101:01-DQA101:01 to [HLA, DRB101:01, DQA101:01] or HLA-DRB101:01 to [HLA, DRB101:01] @@ -100,8 +100,11 @@ def lookup_sequence(allele_str): seqs = [] for part in parts: net = part.replace('*', '').replace(':', '') + print(f" Normalized part: {part!r} → net key: {net!r}") seq = mhc_sequence_map.get(net) - if seq is None: + if seq: + print(f"Found exact match for {net}: sequence length {len(seq)}") + else: # First try to find keys where our name is contained within containing_matches = [k for k in mhc_sequence_map.keys() if net in k] if containing_matches: @@ -109,6 +112,7 @@ def lookup_sequence(allele_str): best = sorted(containing_matches, key=len)[0] seq = mhc_sequence_map[best] print(f"No exact match for '{net}', using containing match '{best}'") + print(f"No exact match for {net}, using containing '{best}'") else: # fallback to closest match (cutoff can be tuned) matches = difflib.get_close_matches(net, @@ -118,7 +122,10 @@ def lookup_sequence(allele_str): if matches: best = matches[0] seq = mhc_sequence_map[best] - print(f"No exact match for '{part}', using closest match '{best}'") + print(f"No exact match for '{net}', using closest match '{best}'") + if seq is None: + print(f"*No sequence found for part {net}*") + seqs.append(seq) # if *all* parts failed, return None @@ -130,33 +137,21 @@ def lookup_sequence(allele_str): return '/'.join(found) # Process unique alleles for efficiency - # Process unique alleles for efficiency - handle both string and list types - # Process unique alleles for efficiency - handle both string and list types - if input_df['allele'].apply(lambda x: isinstance(x, list)).any(): - # If the column contains lists, convert them to strings for uniqueness check - unique_alleles = input_df['allele'].dropna().apply(lambda x: str(x) if isinstance(x, list) else x).unique() - # Create mapping with original values - allele_seq_map = {} - for allele in unique_alleles: - # Keep allele as string for dictionary key purposes - allele_seq_map[allele] = lookup_sequence(allele) - else: - # Normal case when all values are strings or scalars - unique_alleles = input_df['allele'].dropna().unique() - allele_seq_map = {allele: lookup_sequence(allele) for allele in unique_alleles} + # Build map for unique alleles + unique = input_df['allele'].dropna().unique() + allele_seq_map = {} + for a in unique: + allele_seq_map[a] = lookup_sequence(a) - # Apply mapping to the DataFrame + # Now apply updated_df = input_df.copy() - # Convert lists to strings for mapping lookup - updated_df['mhc_sequence'] = updated_df['allele'].apply( - lambda x: allele_seq_map.get(str(x) if isinstance(x, list) else x) - ) + updated_df['mhc_sequence'] = updated_df['allele'].map(allele_seq_map) - # Report and save - n_missing = updated_df['mhc_sequence'].isna().sum() - if n_missing: - print(f"Found {n_missing} alleles without matching mhc_sequence") - print(f"Combined dataset shape: {updated_df.shape}") + # Report summary of misses + missing = [a for a, seq in allele_seq_map.items() if seq is None] + if missing: + print(f"\nTotal missing sequences: {len(missing)}") + print("Examples of alleles without a match:", missing[:10]) return updated_df @@ -490,23 +485,13 @@ def combine_datasets_(results_dir, include_dropped=False): for csv_file in all_csv_files: try: df = pd.read_csv(csv_file) - df.rename(columns={'peptide': 'long_mer', 'label': 'convoluted_label', 'MHC': 'allele'}, inplace=True) + df.rename(columns={'Peptide': 'peptide', 'MHC': 'allele'}, inplace=True) # select only the columns that are needed - df = df[["allele", "long_mer", "assigned_label", "convoluted_label"]] + df = df[["allele", "peptide", "assigned_label", "convoluted_label"]] except Exception as e: print(f"Error reading {csv_file}: {str(e)}") continue - # Standardize column names - if 'Peptide' in df.columns and 'peptide' not in df.columns: - df['peptide'] = df['Peptide'] - elif 'Peptide' in df.columns and 'peptide' in df.columns: - df['peptide'] = df['peptide'].fillna(df['Peptide']) - if 'MHC' in df.columns and 'allele' not in df.columns: - df['allele'] = df['MHC'] - elif 'MHC' in df.columns and 'allele' in df.columns: - df['allele'] = df['allele'].fillna(df['MHC']) - combined_df = pd.concat([pd.read_csv(f) for f in all_csv_files if os.path.getsize(f) > 0], ignore_index=True) return combined_df @@ -812,12 +797,12 @@ def run_(arg1, arg2): # add labels to ba_data with threshold of 0.426 ba_data["label"] = ba_data["label"].apply(lambda x: 1 if float(x) >= 0.426 else 0) - ba_data.rename(columns={'peptide': 'long_mer', 'label': 'convoluted_label'}, inplace=True) + ba_data.rename(columns={'label': 'assigned_label'}, inplace=True) # explode the el_data_0['allele'] column (we do this because all samples in the el_data_0 have the same label with 100% confidence) el_data_0["allele"] = el_data_0["allele"].apply(lambda x: eval(x)) el_data_0 = el_data_0.explode("allele") - el_data_0.rename(columns={'peptide': 'long_mer', 'label': 'convoluted_label'}, inplace=True) + el_data_0.rename(columns={'label': 'assigned_label'}, inplace=True) # concatenate the dataframes df and el_data_0 and ba_data df = pd.concat([df, el_data_0], ignore_index=True) @@ -826,9 +811,19 @@ def run_(arg1, arg2): # add mhc class column df["mhc_class"] = mhc_class + # Standardize column names + if 'Peptide' in df.columns and 'peptide' not in df.columns: + df['peptide'] = df['Peptide'] + elif 'Peptide' in df.columns and 'peptide' in df.columns: + df['peptide'] = df['peptide'].fillna(df['Peptide']) + if 'MHC' in df.columns and 'allele' not in df.columns: + df['allele'] = df['MHC'] + elif 'MHC' in df.columns and 'allele' in df.columns: + df['allele'] = df['allele'].fillna(df['MHC']) + # drop duplicates print(f"Before dropping duplicates: {df.shape}") - df = df.drop_duplicates(subset=["allele", "long_mer"], keep="first") + df = df.drop_duplicates(subset=["allele", "peptide"], keep="first") print(f"After dropping duplicates: {df.shape}") # add mhc_sequence column From 49ac34a1c9368cfca0f32f51b2c0c6c909556f9d Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 13 May 2025 18:15:03 +0200 Subject: [PATCH 33/83] Refactor add_binding_label_streaming in run_pep2vec.py: implement chunk processing for large files, standardize column names, and enhance mapping for binding labels and MHC sequences --- run_pep2vec.py | 310 +++++++++++++++++++++++++++---------------------- 1 file changed, 172 insertions(+), 138 deletions(-) diff --git a/run_pep2vec.py b/run_pep2vec.py index bcbb6d264..81cb8d395 100644 --- a/run_pep2vec.py +++ b/run_pep2vec.py @@ -6,6 +6,7 @@ from utils.processing_functions import create_k_fold_leave_one_out_stratified_cross_validation from sklearn.model_selection import train_test_split + def load_data(file_path, sep=","): """ Load data from a file and return a DataFrame. @@ -16,6 +17,7 @@ def load_data(file_path, sep=","): df = pd.read_csv(file_path, sep=sep) return df + def select_columns(df, columns): """ Select specific columns from a DataFrame. @@ -125,134 +127,129 @@ def select_columns(df, columns): # return f"{locus}*{num[:2]}:{num[2:]}" # return chain -def add_binding_label(df_path, train_path, output_dir=None): +from tqdm import tqdm +# Optional: for parquet streaming +import pyarrow as pa +import pyarrow.parquet as pq + + +def process_chunk_df(df_chunk, binding_labels, mhc_sequences): + """ + Process a DataFrame chunk: assign binding_label and mhc_sequence, map labels to ints. """ - Add binding labels and MHC sequences to the DataFrame based on allotype and peptide pairs. + # Standardize column names + if 'allotype' not in df_chunk.columns and 'MHC' in df_chunk.columns: + df_chunk = df_chunk.rename(columns={'MHC': 'allotype'}) + if 'peptide' not in df_chunk.columns and 'long_mer' in df_chunk.columns: + df_chunk = df_chunk.rename(columns={'long_mer': 'peptide'}) + + # Assign binding labels via map on MultiIndex for vectorized lookup + mi = pd.MultiIndex.from_frame(df_chunk[['allotype', 'peptide']]) + df_chunk['binding_label'] = mi.map(binding_labels) + + # Assign mhc_sequence via map + df_chunk['mhc_sequence'] = df_chunk['allotype'].map(mhc_sequences) + + # Map string labels to integers + unique_labels = pd.unique(df_chunk['binding_label'].dropna()) + label_mapping = {lbl: i for i, lbl in enumerate(sorted(unique_labels))} + df_chunk['binding_label'] = df_chunk['binding_label'].map(label_mapping) + + return df_chunk + + +def add_binding_label_streaming(input_path, csv_path, output_dir=None, is_netmhcpan=False, + csv_chunksize=1_000_000): + """ + Stream-process large files (CSV or Parquet) on disk, without loading fully into memory. Parameters: ----------- - df_path : DataFrame, str, or directory path - DataFrame, path to a file, or directory containing multiple files to add binding labels to - train_path : str - Path to training data CSV file with binding labels + input_path : str + Path to a file or directory of files (.csv or .parquet) to process. + csv_path : str + Path to small CSV file for binding_label and mhc_sequence mappings. output_dir : str, optional - Directory to save labeled files, if None will overwrite original files - - Returns: - -------- - DataFrame or dict of DataFrames with binding labels and MHC sequences added + Directory to write processed files; if None, original files will be overwritten. + is_netmhcpan : bool + Whether the CSV mapping file uses 'assigned_label' instead of 'binding_label'. + csv_chunksize : int + Number of rows per chunk when reading mapping CSV (if large), default 1e6. """ - # Load train and test binding label mappings - train_df = pd.read_csv(train_path) - - # rename columns if needed - if "allele" not in train_df.columns: - train_df.rename(columns={"allotype": "allele"}, inplace=True) - if "long_mer" not in train_df.columns: - train_df.rename(columns={"peptide": "long_mer"}, inplace=True) - if "binding_label" not in train_df.columns: - if "assigned_label" in train_df.columns: - train_df.rename(columns={"assigned_label": "binding_label"}, inplace=True) - else: - raise ValueError("No binding label column found in the training data.") - - # Create binding label mappings - binding_labels = { - (row["allele"], row["long_mer"]): row["binding_label"] - for _, row in train_df.iterrows() - } - - # Create MHC sequence mappings - if "mhc_sequence" in train_df.columns: - mhc_sequences = { - row["allele"]: row["mhc_sequence"] - for _, row in train_df.iterrows() - } - else: - mhc_sequences = {} - - # Combine MHC sequence mappings (test data takes precedence if duplicates) - mhc_sequences = {**mhc_sequences} - - # Check if df_path is a directory - if isinstance(df_path, str) and os.path.isdir(df_path): - # Process all files in the directory - results = {} - for filename in os.listdir(df_path): - file_path = os.path.join(df_path, filename) - if os.path.isfile(file_path) and (file_path.endswith('.csv') or file_path.endswith('.parquet')): - print(f"Processing file: {filename}") - results[filename] = process_single_file( - file_path, binding_labels, mhc_sequences, output_dir - ) - # remove the file after processing - if output_dir and os.path.exists(file_path): - os.remove(file_path) - return results + print(f"Starting streaming addition of binding labels for: {input_path}") + print(f"Using mapping CSV: {csv_path}") + print(f"Loading the csv file with size: {os.path.getsize(csv_path)}") + # Load mapping CSV into memory (assume it's small) + if is_netmhcpan: + usecols = ['allele', 'peptide', 'assigned_label', 'mhc_sequence'] + df_map = pd.read_csv(csv_path, usecols=usecols) + df_map = df_map.rename(columns={'assigned_label': 'binding_label', 'peptide': 'long_mer'}) else: - # Process a single file or DataFrame - return process_single_file(df_path, binding_labels, mhc_sequences, output_dir) - + usecols = ['allele', 'long_mer', 'binding_label', 'mhc_sequence'] + df_map = pd.read_csv(csv_path, usecols=usecols) + + # Ensure column consistency + df_map = df_map.rename(columns={ + 'long_mer': 'peptide' + }) + print(f"Loaded csv file with shape: {df_map.shape}") + # Build dicts for mapping + binding_labels = dict(zip(zip(df_map['allele'], df_map['peptide']), df_map['binding_label'])) + mhc_sequences = dict(zip(df_map['allele'], df_map['mhc_sequence'])) if 'mhc_sequence' in df_map.columns else {} + + def get_output_path(in_path): + fname = os.path.basename(in_path) + if output_dir: + os.makedirs(output_dir, exist_ok=True) + return os.path.join(output_dir, fname) + return in_path + + def stream_file(file_path): + fname = os.path.basename(file_path) + print(f"\n--- Processing file: {fname} ---") + out_path = get_output_path(file_path) + ext = os.path.splitext(file_path)[1].lower() + + if ext == '.csv': + first_write = True + for i, chunk in enumerate(tqdm(pd.read_csv(file_path, chunksize=csv_chunksize), desc=f"Chunks ({fname})")): + print(f"Processing chunk {i + 1}") + processed = process_chunk_df(chunk, binding_labels, mhc_sequences) + processed.to_csv(out_path, mode='w' if first_write else 'a', index=False, header=first_write) + first_write = False + print(f"Finished writing CSV to: {out_path}") + + elif ext in ['.parquet', '.pq']: + pf = pq.ParquetFile(file_path) + writer = None + print(f"Parquet row groups: {pf.num_row_groups}") + for rg in tqdm(range(pf.num_row_groups), desc=f"RowGroups ({fname})"): + print(f"Reading row group {rg}") + partial = pf.read_row_group(rg).to_pandas() + processed = process_chunk_df(partial, binding_labels, mhc_sequences) + table = pa.Table.from_pandas(processed) + if writer is None: + writer = pq.ParquetWriter(get_output_path(file_path), table.schema) + writer.write_table(table) + if writer: + writer.close() + print(f"Finished writing Parquet to: {out_path}") -def process_single_file(df_or_path, binding_labels, mhc_sequences, output_dir=None): - """Helper function to process a single file or DataFrame""" - # Process the provided dataframe or file - if isinstance(df_or_path, str): - if df_or_path.endswith('.parquet'): - df = pd.read_parquet(df_or_path) else: - df = pd.read_csv(df_or_path) - file_path = df_or_path + print(f"Skipped unsupported file type: {fname}") + + # Handle directory or single file + if os.path.isdir(input_path): + files = [f for f in os.listdir(input_path) if os.path.splitext(f)[1].lower() in ['.csv', '.parquet', '.pq']] + print(f"Found {len(files)} files to process in directory.") + for fname in files: + file_path = os.path.join(input_path, fname) + stream_file(file_path) else: - df = df_or_path - file_path = None - - # Determine if this is a test file based on filename - is_test = file_path and "test" in os.path.basename(file_path).lower() - binding_labels = binding_labels if is_test else binding_labels - - # Check if columns use 'allotype'/'peptide' naming convention (parquet files) - # or 'allele'/'long_mer' naming convention (CSV files) - has_allotype_col = "allotype" in df.columns - has_peptide_col = "peptide" in df.columns - - # Assign labels based on mapping with appropriate column names - if has_allotype_col and has_peptide_col: - # Parquet file naming convention - df["binding_label"] = df.apply( - lambda row: binding_labels.get((row["allotype"], row["peptide"])), - axis=1 - ) - # Add MHC sequence - df["mhc_sequence"] = df["allotype"].map(mhc_sequences) - else: - # CSV file naming convention - df["binding_label"] = df.apply( - lambda row: binding_labels.get((row["allele"], row["long_mer"])), - axis=1 - ) - # Add MHC sequence - df["mhc_sequence"] = df["allele"].map(mhc_sequences) + stream_file(input_path) - # Map string labels to integers - label_mapping = { - label: i for i, label in enumerate(sorted(df["binding_label"].dropna().unique())) - } - df["binding_label"] = df["binding_label"].map(label_mapping) - - # Save the file if a path was provided and output_dir is specified - if file_path and output_dir: - os.makedirs(output_dir, exist_ok=True) - output_path = os.path.join(output_dir, os.path.basename(file_path)) - if file_path.endswith('.parquet'): - df.to_parquet(output_path) - else: - df.to_csv(output_path, index=False) - return df - - -def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5): +def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, process_fold_n=None): """ Prepare datasets for Pep2Vec training and evaluation. @@ -283,8 +280,9 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5): if is_netmhcpan: # NetMHCpan has a single cleaned_data.csv file - cleaned_data_path = os.path.join(dataset_dir, "cleaned_data.csv") - columns = ["long_mer","convoluted_label", "assigned_label", "MHC_class", "allele"] + cleaned_data_path = os.path.join(dataset_dir, f"combined_data_{mhc_type[-1]}.csv") + print(cleaned_data_path) + columns = ["allele", "long_mer", "convoluted_label", "assigned_label", "MHC_class"] else: # Other datasets have separate train/test files paths = { @@ -294,13 +292,14 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5): columns = ["allele", "long_mer", "binding_label", "mhc_sequence"] # Column configuration - rename_map = {"allele": "allotype", "long_mer": "peptide"} # required for pep2vec - # Rename label column for NetMHCpan if is_netmhcpan: + rename_map = {"allele": "allotype", "Peptide": "peptide"} # required for pep2vec rename_map["assigned_label"] = "binding_label" # TODO if mhc_sequence is required it must be further processed columns = ["allotype", "peptide", "binding_label"] + else: + rename_map = {"allele": "allotype", "long_mer": "peptide"} # required for pep2vec # Load and process datasets datasets = {} @@ -311,21 +310,43 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5): df = load_data(cleaned_data_path) print(f"Full dataset shape: {df.shape}") + # rename columns + if "binding_label" not in df.columns and "assigned_label" in df.columns: + df.rename(columns=rename_map, inplace=True) + + # Check the dtype + print("mhc_class dtype:", df["mhc_class"].dtype) + + # And get counts of each class to see their distribution + print(df["mhc_class"].value_counts(dropna=False)) + # Filter by MHC class based on mhc_type parameter mhc_class = 2 if mhc_type.lower() == "mhc2" else 1 df = df[df["mhc_class"] == mhc_class].copy() print(f"Dataset after filtering for MHC class {mhc_class}: {df.shape}") - # rename columns - df.rename(columns=rename_map, inplace=True) - + subset = df[["allotype", "peptide", "binding_label"]] + print(subset.info()) + print(subset.head(10)) + print(subset.isna().sum()) + total = len(df) + uniques = df[["allotype", "peptide"]].dropna().drop_duplicates().shape[0] + print(f"Total rows: {total:,}; unique (allotype, peptide): {uniques:,}") + print(df.filter(like="label").columns) + print(df["convoluted_label"].notna().sum()) + print(df["binding_label"].notna().sum()) + + # TODO fix # Process dataframes - train_df = (select_columns(df, columns) - .rename(columns=rename_map) - .drop_duplicates(subset=["allotype", "peptide"]) - .dropna()) + # select + clean + train_df = ( + df[["allotype", "peptide", "binding_label"]] + .dropna() + .drop_duplicates(subset=["allotype", "peptide"]) + ) print(f"Train dataset shape after processing: {train_df.shape}") + print(train_df["binding_label"].value_counts()) datasets['train'] = train_df datasets['test'] = None @@ -400,9 +421,11 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5): # reset the index train_set.reset_index(drop=True, inplace=True) val_set.reset_index(drop=True, inplace=True) - with open(os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"train_set_fold_{i}.csv"), mode="w", encoding="utf-8") as train_file: + with open(os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"train_set_fold_{i}.csv"), + mode="w", encoding="utf-8") as train_file: train_set.to_csv(train_file, sep=",", index=True, header=True) - with open(os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"val_set_fold_{i}.csv"), mode="w", encoding="utf-8") as val_file: + with open(os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"val_set_fold_{i}.csv"), + mode="w", encoding="utf-8") as val_file: val_set.to_csv(val_file, sep=",", index=True, header=True) with open(held_out_ids_path, "a") as f: f.write(f"Fold {i}: {held_out_id}\n") @@ -443,14 +466,20 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5): # print(f"Error processing allele {allele}: {str(e)}") # automatically get the number of cores - num_cores = os.cpu_count()-2 + num_cores = os.cpu_count() - 2 + # TODO only process one fold? with process_fold_n for i in range(k): train_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"train_set_fold_{i}.csv") output_file = os.path.join(output_dir, f"pep2vec_output_fold_{i}.parquet") - os.system(f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {train_file} --output_location {output_file} --mhctype {mhc_type}") - validation_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"val_set_fold_{i}.csv") + os.system( + f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {train_file} --output_location {output_file} --mhctype {mhc_type}") + validation_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", + f"val_set_fold_{i}.csv") output_file = os.path.join(output_dir, f"pep2vec_output_val_fold_{i}.parquet") - os.system(f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {validation_file} --output_location {output_file} --mhctype {mhc_type}") + os.system( + f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {validation_file} --output_location {output_file} --mhctype {mhc_type}") + if process_fold_n == i: + return # # test set # test_file = os.path.join(folds_dir, "test_original.csv") @@ -488,10 +517,15 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5): # train_path=os.path.join("data", "NetMHCIIpan_dataset", "cleaned_data.csv"), # output_dir=os.path.join("data", "Pep2Vec", "NetMHCIpan_dataset_new_subset") # ) - main("NetMHCpan_dataset", "mhc1", 0.01, 5) - add_binding_label( - df_path=os.path.join("data", "Pep2Vec", "NetMHCIpan_dataset"), - train_path=os.path.join("data", "NetMHCIIpan_dataset", "cleaned_data.csv"), - output_dir=os.path.join("data", "Pep2Vec", "NetMHCIpan_dataset_new_subset") + if len(sys.argv) > 1: + fold_n = sys.argv[1] + else: + fold_n = None + main("NetMHCpan_dataset", "mhc1", 0.0001, 5, fold_n) + add_binding_label_streaming( + input_path=os.path.join("data", "Pep2Vec", "NetMHCpan_dataset"), + csv_path=os.path.join("data", "NetMHCpan_dataset", "combined_data_1.csv"), + output_dir=os.path.join("data", "Pep2Vec", "NetMHCIpan_dataset_new_subset"), + is_netmhcpan=True ) From c20335bb64d06d1a3700681517cea04973fa9f9d Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 13 May 2025 18:15:30 +0200 Subject: [PATCH 34/83] Refactor mhc_sequence handling in run_netmhcpan_script.py: drop rows with None or NaN values and standardize column names by removing duplicates --- run_netmhcpan_script.py | 8 ++++++++ 1 file changed, 8 insertions(+) diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py index a2f6e2f03..dd388edc4 100644 --- a/run_netmhcpan_script.py +++ b/run_netmhcpan_script.py @@ -153,6 +153,10 @@ def lookup_sequence(allele_str): print(f"\nTotal missing sequences: {len(missing)}") print("Examples of alleles without a match:", missing[:10]) + # TODO fix later + # Drop rows where 'mhc_sequence' is None or NaN + updated_df = updated_df[updated_df['mhc_sequence'].notna() & (updated_df['mhc_sequence'] != None)] + return updated_df @@ -814,12 +818,16 @@ def run_(arg1, arg2): # Standardize column names if 'Peptide' in df.columns and 'peptide' not in df.columns: df['peptide'] = df['Peptide'] + df.drop(columns=['Peptide'], inplace=True) elif 'Peptide' in df.columns and 'peptide' in df.columns: df['peptide'] = df['peptide'].fillna(df['Peptide']) + df.drop(columns=['Peptide'], inplace=True) if 'MHC' in df.columns and 'allele' not in df.columns: df['allele'] = df['MHC'] + df.drop(columns=['MHC'], inplace=True) elif 'MHC' in df.columns and 'allele' in df.columns: df['allele'] = df['allele'].fillna(df['MHC']) + df.drop(columns=['MHC'], inplace=True) # drop duplicates print(f"Before dropping duplicates: {df.shape}") From c99540bcd20fe8d7cb94a50b366cac3cb44bcf8d Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 14 May 2025 17:21:13 +0200 Subject: [PATCH 35/83] Refactor encoding and prediction methods in model.py: rename encode to encode_ for clarity, enhance input handling, and add predict method for improved feature and gate processing --- utils/model.py | 29 ++++++++++++++++++++++------- 1 file changed, 22 insertions(+), 7 deletions(-) diff --git a/utils/model.py b/utils/model.py index 13dbf7a85..fbf6d34ea 100644 --- a/utils/model.py +++ b/utils/model.py @@ -373,14 +373,17 @@ def call(self, inputs, training=False): return output, Zq, out_P_proj, vq_loss, perplexity # # Method to get just the latent sequence and one-hot encodings for inference - def encode(self, inputs): - """Encode inputs to latent sequence and one-hot cluster assignments.""" - x = self.encoder(inputs) # (batch_size, embedding_dim) + def encode_(self, inputs): + if isinstance(inputs, tuple): + x, labels = inputs + else: + x, labels = inputs, None + # Encoder: Compress input to embedding space + x = self.encoder(x) # (batch_size, embedding_dim) x = tf.expand_dims(x, axis=1) # (batch_size, 1, embedding_dim) - # Get quantized embedding and one-hot encodings - quantized, one_hot_encodings, _, _ = self.scq_layer(x) - # Return quantized latent sequence and one-hot encodings - return tf.squeeze(quantized, axis=1), tf.squeeze(one_hot_encodings, axis=1) + # SCQ: Quantize the embedding + Zq, out_P_proj, vq_loss, perplexity = self.scq_layer(x) + return Zq, out_P_proj, vq_loss, perplexity def train_step(self, data): # unpack features and (optional) labels @@ -674,6 +677,18 @@ def test_step(self, data): results.update({'loss': loss}) return results + def predict(self, inputs): + if isinstance(inputs, tuple) and len(inputs) == 2: + # Input includes features and gates + inputs, gates = inputs + outputs = self.moe_layer((inputs, gates), training=False) + else: + # Input is just features, gates will be computed by gating network + outputs = self.moe_layer(inputs, training=False) + + predictions = outputs['prediction'] + return predictions + def visualize_dataset_analysis(features, labels, cluster_probs, method='pca', raw_dot_plot=False, feature_indices=None): """ From c4cfca5f73ab0fb7a3b908505431cb8883a710b6 Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 14 May 2025 17:21:25 +0200 Subject: [PATCH 36/83] Refactor create_k_fold_leave_one_out_stratified_cross_validation in processing_functions.py: enhance validation set handling, ensure unique allele presence, and implement class balancing for train and validation sets --- utils/processing_functions.py | 70 ++++++++++++++++++++++++++++------- 1 file changed, 57 insertions(+), 13 deletions(-) diff --git a/utils/processing_functions.py b/utils/processing_functions.py index e91578833..c4ddc7bd7 100644 --- a/utils/processing_functions.py +++ b/utils/processing_functions.py @@ -1062,25 +1062,27 @@ def fetch_polypeptide_sequences(pdb_path): # write a function that produces 5 fold cross validation from the df, each fold must have one allele to be left out completely and produce a stratified train and validation based on the label. # take into account the subset proportion. def create_k_fold_leave_one_out_stratified_cross_validation(df, k=5, target_col="label", id_col="allele", - subset_prop=1.0, train_size=0.8, random_state=42): + subset_prop=1.0, train_size=0.8, random_state=42): """ - Creates k folds for cross-validation where each fold leaves one unique ID out - and splits the remaining data into stratified train/validation sets. + Creates k folds for cross-validation where each fold: + 1. Leaves one unique ID out completely + 2. Has a validation set with at least one unique allele not present in the training set + 3. Splits the remaining data into stratified train/validation sets + 4. Balances both train and validation sets based on target labels Args: df (pd.DataFrame): The input dataframe. k (int): The number of folds. target_col (str): The name of the column containing the target labels for stratification. id_col (str): The name of the column containing the IDs (alleles) to leave out. - subset_prop (float): The proportion of the remaining data to use for the training set. + subset_prop (float): The proportion of the remaining data to use. train_size (float): The proportion of the non-held-out data to use for training. - random_state (int): Random state for reproducibility of the stratified split. + random_state (int): Random state for reproducibility. Returns: list: A list of tuples, where each tuple contains (train_df, val_df, left_out_id) for a fold. - The left_out_id is the ID that was completely held out for that fold. """ - # take a subset of the dataframe + # Take a subset of the dataframe df = df.sample(frac=subset_prop, random_state=random_state) # Get unique IDs (alleles) @@ -1090,8 +1092,10 @@ def create_k_fold_leave_one_out_stratified_cross_validation(df, k=5, target_col= if k > len(unique_ids): raise ValueError(f"k must be less than or equal to the number of unique IDs ({len(unique_ids)}).") - # Select k IDs to leave out (one per fold) + # Set random seed for reproducibility np.random.seed(random_state) + + # Randomly select k IDs to leave out (one per fold) selected_ids = np.random.choice(unique_ids, k, replace=False) folds = [] @@ -1103,15 +1107,55 @@ def create_k_fold_leave_one_out_stratified_cross_validation(df, k=5, target_col= # Get remaining data (exclude the left out ID) remaining_df = df[~leave_out_mask].copy() - # Create stratified train/validation split on the remaining data - train_df, val_df = train_test_split( - remaining_df, + # Get remaining unique IDs + remaining_unique_ids = remaining_df[id_col].unique() + + # Select a validation-only ID (will only appear in validation set) + val_only_id = np.random.choice(remaining_unique_ids, 1)[0] + + # Split data for unique validation ID and the rest + val_only_mask = remaining_df[id_col] == val_only_id + val_only_df = remaining_df[val_only_mask].copy() + train_eligible_df = remaining_df[~val_only_mask].copy() + + # Create stratified split on the training-eligible data + train_df, extra_val_df = train_test_split( + train_eligible_df, train_size=train_size, - stratify=remaining_df[target_col], + stratify=train_eligible_df[target_col], random_state=random_state ) + # Combine validation-only data with extra validation data + val_df = pd.concat([val_only_df, extra_val_df], ignore_index=True) + + # Balance training set + train_class_counts = train_df[target_col].value_counts() + min_train_count = train_class_counts.min() + balanced_train_dfs = [] + + for label in train_class_counts.index: + label_df = train_df[train_df[target_col] == label] + # Downsample to the minority class count + balanced_label_df = label_df.sample(min_train_count, random_state=random_state) + balanced_train_dfs.append(balanced_label_df) + + balanced_train_df = pd.concat(balanced_train_dfs, ignore_index=True) + + # Balance validation set + val_class_counts = val_df[target_col].value_counts() + min_val_count = val_class_counts.min() + balanced_val_dfs = [] + + for label in val_class_counts.index: + label_df = val_df[val_df[target_col] == label] + # Downsample to the minority class count + balanced_label_df = label_df.sample(min_val_count, random_state=random_state) + balanced_val_dfs.append(balanced_label_df) + + balanced_val_df = pd.concat(balanced_val_dfs, ignore_index=True) + # Include the left_out_id in the tuple - folds.append((train_df, val_df, leave_out_id)) + folds.append((balanced_train_df, balanced_val_df, leave_out_id)) return folds From 2d043353d6106175cbd9608bfc008197c58617f4 Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 14 May 2025 17:21:29 +0200 Subject: [PATCH 37/83] Refactor add_binding_label_streaming in run_pep2vec.py: enhance mapping CSV handling, implement balanced sampling for test set, and streamline fold processing logic --- run_pep2vec.py | 273 +++++++++++++++++++++++++------------------------ 1 file changed, 139 insertions(+), 134 deletions(-) diff --git a/run_pep2vec.py b/run_pep2vec.py index 81cb8d395..a95e449be 100644 --- a/run_pep2vec.py +++ b/run_pep2vec.py @@ -1,5 +1,6 @@ # load Conbotnet subset data import os +import random import sys import pandas as pd import numpy as np @@ -158,7 +159,7 @@ def process_chunk_df(df_chunk, binding_labels, mhc_sequences): return df_chunk -def add_binding_label_streaming(input_path, csv_path, output_dir=None, is_netmhcpan=False, +def add_binding_label_streaming(input_path, map_csv, output_dir=None, is_netmhcpan=False, csv_chunksize=1_000_000): """ Stream-process large files (CSV or Parquet) on disk, without loading fully into memory. @@ -177,16 +178,7 @@ def add_binding_label_streaming(input_path, csv_path, output_dir=None, is_netmhc Number of rows per chunk when reading mapping CSV (if large), default 1e6. """ print(f"Starting streaming addition of binding labels for: {input_path}") - print(f"Using mapping CSV: {csv_path}") - print(f"Loading the csv file with size: {os.path.getsize(csv_path)}") - # Load mapping CSV into memory (assume it's small) - if is_netmhcpan: - usecols = ['allele', 'peptide', 'assigned_label', 'mhc_sequence'] - df_map = pd.read_csv(csv_path, usecols=usecols) - df_map = df_map.rename(columns={'assigned_label': 'binding_label', 'peptide': 'long_mer'}) - else: - usecols = ['allele', 'long_mer', 'binding_label', 'mhc_sequence'] - df_map = pd.read_csv(csv_path, usecols=usecols) + df_map = map_csv # Ensure column consistency df_map = df_map.rename(columns={ @@ -307,7 +299,13 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, if is_netmhcpan: # Load NetMHCpan dataset from single file print(f"Loading NetMHCpan dataset from {cleaned_data_path}") - df = load_data(cleaned_data_path) + # df = load_data(cleaned_data_path) + usecols = ['allele', 'peptide', 'assigned_label', 'mhc_sequence', 'mhc_class'] + rng = random.Random(42) + df = pd.read_csv(cleaned_data_path, + usecols=usecols, + skiprows=lambda i: i > 0 and rng.random() > subset_prop) + df_map = df.rename(columns={'assigned_label': 'binding_label', 'peptide': 'long_mer'}) print(f"Full dataset shape: {df.shape}") # rename columns @@ -333,7 +331,6 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, uniques = df[["allotype", "peptide"]].dropna().drop_duplicates().shape[0] print(f"Total rows: {total:,}; unique (allotype, peptide): {uniques:,}") print(df.filter(like="label").columns) - print(df["convoluted_label"].notna().sum()) print(df["binding_label"].notna().sum()) # TODO fix @@ -353,9 +350,13 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, else: # Regular dataset processing with separate files for name, path in paths.items(): - df = load_data(path) + rng = random.Random(42) + df = pd.read_csv(path, + skiprows=lambda i: i > 0 and rng.random() > subset_prop) print(f"{name.capitalize()} dataset shape: {df.shape}") + df_map = df.copy() + # Process dataframe df = (select_columns(df, columns) .rename(columns=rename_map) @@ -378,15 +379,28 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, # lambda x: get_netmhcpan_allele(x, netmhcpan_dataset, allele_cache)) # define test1 and test2 datasets - # test1: stratified 10% sampling from train + # test1: balanced sampling with equal representation from each binding_label train_df_ = datasets['train'] - train_updated, test1 = train_test_split( - train_df_, - test_size=0.1, - stratify=train_df_['binding_label'], - random_state=42 - ) - datasets['train'] = train_updated.reset_index(drop=True) + unique_labels = train_df_['binding_label'].unique() + + # Determine sample size (minimum of 100 or smallest class size) + samples_per_label = min(100, min(train_df_['binding_label'].value_counts())) + print(f"Creating balanced test1 with {samples_per_label} samples per label") + + # Sample equally from each label + test1_indices = [] + for label in unique_labels: + label_samples = train_df_[train_df_['binding_label'] == label].sample( + n=samples_per_label, random_state=42 + ) + test1_indices.extend(label_samples.index.tolist()) + + # Create test1 from the selected indices + test1 = train_df_.loc[test1_indices].reset_index(drop=True) + + # Create updated training set by dropping the selected indices + train_updated = train_df_.drop(index=test1_indices).reset_index(drop=True) + datasets['train'] = train_updated # test2: select allele with lowest sample count allele_counts = datasets['train']['allotype'].value_counts() @@ -394,117 +408,113 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, test2 = datasets['train'][datasets['train']['allotype'] == lowest_allele].copy() datasets['train'] = datasets['train'][datasets['train']['allotype'] != lowest_allele].reset_index(drop=True) - # Create k-fold cross-validation splits - k = n_folds - folds = create_k_fold_leave_one_out_stratified_cross_validation( - datasets['train'], k=k, target_col="binding_label", - id_col="allotype", train_size=0.8, subset_prop=subset_prop - ) + if process_fold_n == 0 or process_fold_n == None: + # Create k-fold cross-validation splits + k = n_folds + folds = create_k_fold_leave_one_out_stratified_cross_validation( + datasets['train'], k=k, target_col="binding_label", + id_col="allotype", train_size=0.8, subset_prop=subset_prop + ) - # Clear previous held_out_ids file if it exists - held_out_ids_path = os.path.join(folds_dir, "held_out_ids.txt") - if os.path.exists(held_out_ids_path): - os.remove(held_out_ids_path) - - # Save folds - for i, (train_set, val_set, held_out_id) in enumerate(folds): - # only keep the allele and peptide columns - train_set = train_set[["allotype", "peptide"]] - val_set = val_set[["allotype", "peptide"]] - # drop nan and duplicates - train_set = train_set.dropna().drop_duplicates(subset=["allotype", "peptide"]) - val_set = val_set.dropna().drop_duplicates(subset=["allotype", "peptide"]) - # TODO find a better solution later - pep2vec can't handle long peptides longer than ~25 might work upto 29 - train_set = train_set[train_set["peptide"].str.len() <= 25] - val_set = val_set[val_set["peptide"].str.len() <= 25] - - # reset the index - train_set.reset_index(drop=True, inplace=True) - val_set.reset_index(drop=True, inplace=True) - with open(os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"train_set_fold_{i}.csv"), - mode="w", encoding="utf-8") as train_file: - train_set.to_csv(train_file, sep=",", index=True, header=True) - with open(os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"val_set_fold_{i}.csv"), - mode="w", encoding="utf-8") as val_file: - val_set.to_csv(val_file, sep=",", index=True, header=True) - with open(held_out_ids_path, "a") as f: - f.write(f"Fold {i}: {held_out_id}\n") - - # Save the test set - # if dataset has a test set, save it as well - if datasets.get('test') is not None: - datasets['test'].to_csv(os.path.join(folds_dir, "test_original.csv"), index=False, header=True) - # Save the test1 and test2 sets - test1.to_csv(os.path.join(folds_dir, "test1_stratified.csv"), index=False, header=True) - test2.to_csv(os.path.join(folds_dir, "test2_single_unique_allele.csv"), index=False, header=True) - print("Test dataset saved.") + held_out_ids_path = os.path.join(folds_dir, "held_out_ids.txt") + if os.path.exists(held_out_ids_path): + os.remove(held_out_ids_path) + + # Save folds + for i, (train_set, val_set, held_out_id) in enumerate(folds): + # only keep the allele and peptide columns + train_set = train_set[["allotype", "peptide"]] + val_set = val_set[["allotype", "peptide"]] + # drop nan and duplicates + train_set = train_set.dropna().drop_duplicates(subset=["allotype", "peptide"]) + val_set = val_set.dropna().drop_duplicates(subset=["allotype", "peptide"]) + # TODO find a better solution later - pep2vec can't handle long peptides longer than ~25 might work upto 29 + train_set = train_set[train_set["peptide"].str.len() <= 25] + val_set = val_set[val_set["peptide"].str.len() <= 25] + + # reset the index + train_set.reset_index(drop=True, inplace=True) + val_set.reset_index(drop=True, inplace=True) + with open(os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"train_set_fold_{i}.csv"), + mode="w", encoding="utf-8") as train_file: + train_set.to_csv(train_file, sep=",", index=True, header=True) + with open(os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"val_set_fold_{i}.csv"), + mode="w", encoding="utf-8") as val_file: + val_set.to_csv(val_file, sep=",", index=True, header=True) + with open(held_out_ids_path, "a") as f: + f.write(f"Fold {i}: {held_out_id}\n") + + # Save the test set + # if dataset has a test set, save it as well + if datasets.get('test') is not None: + datasets['test'].to_csv(os.path.join(folds_dir, "test_original.csv"), index=False, header=True) + # Save the test1 and test2 sets + test1.to_csv(os.path.join(folds_dir, "test1_stratified.csv"), index=False, header=True) + test2.to_csv(os.path.join(folds_dir, "test2_single_unique_allele.csv"), index=False, header=True) + print("Test dataset saved.") - ################### Pep2Vec ################### - # TODO pep2vec fails for some alleles, need to check the error - # split each file to subsets for each unique allele and run pep2vec - # create tmp directory - # os.makedirs(os.path.join(output_dir, "tmp"), exist_ok=True) - # unique_alleles = datasets['train']['allotype'].unique() - # for allele in unique_alleles: - # allele_df = datasets['train'][datasets['train']['allotype'] == allele] - # allele_df.to_csv(os.path.join(output_dir, "tmp", f"pep2vec_input_{allele}.csv"), index=False, header=True) - # # run pep2vec for each allele - # failed_alleles_file = os.path.join(output_dir, "failed_alleles.txt") - # for allele in unique_alleles: - # try: - # input_file = os.path.join(output_dir,"tmp", f"pep2vec_input_{allele}.csv") - # output_file = os.path.join(output_dir, f"pep2vec_output_{allele}.parquet") - # exit_code = os.system( - # f"./Pep2Vec/pep2vec.bin --num_processes 20 --num_threads 10 --dataset {input_file} --output_location {output_file} --mhctype {mhc_type}") - # if exit_code != 0: - # with open(failed_alleles_file, "a") as f: - # f.write(f"{allele}\n") - # print(f"Failed to process allele: {allele}") - # except Exception as e: - # with open(failed_alleles_file, "a") as f: - # f.write(f"{allele} (Error: {str(e)})\n") - # print(f"Error processing allele {allele}: {str(e)}") + else: + # load the fold csv files for specified fold + fold_idx = process_fold_n + train_path = os.path.join(folds_dir, f"train_set_fold_{fold_idx}.csv") + val_path = os.path.join(folds_dir, f"val_set_fold_{fold_idx}.csv") + if os.path.exists(train_path) and os.path.exists(val_path): + datasets['train'] = pd.read_csv(train_path, index_col=0) + datasets['val'] = pd.read_csv(val_path, index_col=0) + else: + raise FileNotFoundError(f"Fold files not found for fold {fold_idx}") + ################### Pep2Vec ################### # automatically get the number of cores - num_cores = os.cpu_count() - 2 + num_cores = max(os.cpu_count() - 2, 1) # TODO only process one fold? with process_fold_n - for i in range(k): - train_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", f"train_set_fold_{i}.csv") - output_file = os.path.join(output_dir, f"pep2vec_output_fold_{i}.parquet") - os.system( - f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {train_file} --output_location {output_file} --mhctype {mhc_type}") - validation_file = os.path.join(os.path.dirname(__file__), "data", dataset_name, "folds", - f"val_set_fold_{i}.csv") - output_file = os.path.join(output_dir, f"pep2vec_output_val_fold_{i}.parquet") - os.system( - f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {validation_file} --output_location {output_file} --mhctype {mhc_type}") - if process_fold_n == i: - return + for i in range(n_folds): + if process_fold_n != None and process_fold_n == i: + continue + for split in ['train', 'val']: + csv_in = os.path.join(folds_dir, f"{split}_set_fold_{i}.csv") + out_pq = os.path.join(output_dir, f"pep2vec_output_{split}_fold_{i}.parquet") + if os.path.exists(csv_in): + os.system( + f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {csv_in} --output_location {out_pq} --mhctype {mhc_type}") + # Only run one fold if specified + if process_fold_n is not None: + break # # test set - # test_file = os.path.join(folds_dir, "test_original.csv") - # if os.path.exists(test_file): - # output_file = os.path.join(output_dir, f"pep2vec_output_test.parquet") - # os.system( - # f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") - # # Process test1 and test2 datasets - # for test_name in ["test1_stratified", "test2_single_unique_allele"]: - # test_file = os.path.join(folds_dir, f"{test_name}.csv") - # if os.path.exists(test_file): - # output_file = os.path.join(output_dir, f"pep2vec_output_{test_name}.parquet") - # os.system( - # f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") + test_file = os.path.join(folds_dir, "test_original.csv") + if os.path.exists(test_file): + output_file = os.path.join(output_dir, f"pep2vec_output_test.parquet") + os.system( + f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") + # Process test1 and test2 datasets + for test_name in ["test1_stratified", "test2_single_unique_allele"]: + test_file = os.path.join(folds_dir, f"{test_name}.csv") + if os.path.exists(test_file): + output_file = os.path.join(output_dir, f"pep2vec_output_{test_name}.parquet") + os.system( + f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {test_file} --output_location {output_file} --mhctype {mhc_type}") ############################################### + return df_map + if __name__ == "__main__": - # main("Conbotnet", "mhc2", 0.001) - # add_binding_label( - # df_path=os.path.join("data", "Pep2Vec", "Conbotnet"), - # train_path=os.path.join("data", "Conbotnet", "train.csv"), - # test_path=os.path.join("data", "Conbotnet", "test_all.csv"), - # output_dir=os.path.join("data", "Pep2Vec", "Conbotnet_new_subset") - # ) + if len(sys.argv) > 1: + fold_n = sys.argv[1] + else: + fold_n = None + + print(f"Running for Fold {fold_n}") + + df_map = main("Conbotnet", "mhc2", 0.001, 5, fold_n) + add_binding_label_streaming( + input_path=os.path.join("data", "Pep2Vec", "Conbotnet"), + map_csv=df_map, + output_dir=os.path.join("data", "Pep2Vec", "Conbotnet_new_subset"), + is_netmhcpan=False + ) + # main("ConvNeXT-MHC", "mhc1", 0.001, 5) # add_binding_label( # df_path=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC"), @@ -517,15 +527,10 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, # train_path=os.path.join("data", "NetMHCIIpan_dataset", "cleaned_data.csv"), # output_dir=os.path.join("data", "Pep2Vec", "NetMHCIpan_dataset_new_subset") # ) - if len(sys.argv) > 1: - fold_n = sys.argv[1] - else: - fold_n = None - main("NetMHCpan_dataset", "mhc1", 0.0001, 5, fold_n) - add_binding_label_streaming( - input_path=os.path.join("data", "Pep2Vec", "NetMHCpan_dataset"), - csv_path=os.path.join("data", "NetMHCpan_dataset", "combined_data_1.csv"), - output_dir=os.path.join("data", "Pep2Vec", "NetMHCIpan_dataset_new_subset"), - is_netmhcpan=True - ) - + # df_map = main("NetMHCpan_dataset", "mhc1", 0.001, 5, fold_n) + # add_binding_label_streaming( + # input_path=os.path.join("data", "Pep2Vec", "NetMHCpan_dataset"), + # map_csv=df_map, + # output_dir=os.path.join("data", "Pep2Vec", "NetMHCIpan_dataset_new_subset"), + # is_netmhcpan=True + # ) From 658818c2574ecb18b229c21865e4ab3c99626183 Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 14 May 2025 17:21:33 +0200 Subject: [PATCH 38/83] Refactor training process in run_pMHC_DL.py: implement balanced dataset sampling, enhance model fine-tuning, and streamline evaluation metrics visualization --- run_pMHC_DL.py | 359 +++++++++++++++++++++++++++++++++++++------------ 1 file changed, 276 insertions(+), 83 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index 09dd5be07..22b9411ed 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -5,10 +5,12 @@ import pandas as pd import time import matplotlib.pyplot as plt +from sklearn.metrics import roc_curve, precision_recall_curve from sklearn.model_selection import train_test_split from sklearn.cluster import KMeans import seaborn as sns from sklearn.decomposition import PCA +from collections import Counter from utils.model import SCQ1DAutoEncoder, MoEModel, BinaryMLP, TabularTransformer, EmbeddingCNN @@ -1606,7 +1608,7 @@ def process_and_save(dataset: tf.data.Dataset, # Extract latent codes for every batch for batch in dataset: - output, Zq, out_P_proj, _, _ = model(batch, training=False) + Zq, out_P_proj, _, _ = model.encode_(batch) quantized_latents.append(Zq.numpy()) cluster_indices_soft.append(out_P_proj.numpy()) cluster_indices_hard.append(tf.argmax(out_P_proj, axis=-1).numpy()) @@ -1705,9 +1707,9 @@ def remove_y(dataset): seq_length = seq_length - 1 # Remove the index feature # remove labels - # train_dataset = train_dataset.apply(remove_y) - # val_dataset = val_dataset.apply(remove_y) - # test_dataset = test_dataset.apply(remove_y) + train_dataset = train_dataset.apply(remove_y) + val_dataset = val_dataset.apply(remove_y) + test_dataset = test_dataset.apply(remove_y) # --- Model Instantiation --- @@ -1731,20 +1733,58 @@ def remove_y(dataset): ) print("Model built.") + # --- Compile and Train --- print("Compiling the model...") model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate)) print("Model compiled.") - print(f"Starting training for {epochs} epochs...") + # Determine minority class count + label_counts = Counter(y_train) + min_count = min(label_counts.values()) + # Sample balanced indices + balanced_indices = [] + for label in label_counts: + inds = np.where(y_train == label)[0] + sampled = np.random.choice(inds, min_count, replace=False) + balanced_indices.extend(sampled) + balanced_indices = np.array(balanced_indices) + # Create balanced dataset + X_bal = X_train[balanced_indices] + y_bal = y_train[balanced_indices] + balanced_dataset_y = create_dataset(X_bal, y_bal, batch_size=batch_size, is_training=True) + balanced_dataset = balanced_dataset_y.apply(remove_id).apply(remove_y) + + # Initial training on balanced set + print(f"Training on balanced set for {epochs} epochs...") start_time = time.time() history = model.fit( - train_dataset, + balanced_dataset, epochs=epochs, validation_data=val_dataset ) end_time = time.time() - print(f"\nTraining finished in {end_time - start_time:.2f} seconds.") + print(f"Balanced training finished in {end_time - start_time:.2f} seconds.") + + # TODO Experimental + # Freeze encoder layers before fine-tuning + model.encoder.trainable = False + for layer in model.encoder.layers: + layer.trainable = False + + # Recompile model after freezing layers + model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate)) + + # Fine-tune on full dataset + print(f"Fine-tuning on full dataset for {epochs} epochs...") + start_time = time.time() + history = model.fit( + train_dataset, + epochs=epochs//10, + validation_data=val_dataset + ) + end_time = time.time() + print(f"Fine-tuning finished in {end_time - start_time:.2f} seconds.") # --- Evaluation and Visualization --- print("\nEvaluating the model...") @@ -1959,6 +1999,161 @@ def train_and_evaluate_moe( history (tf.keras.callbacks.History): Training history object. eval_results (list): Evaluation results on validation data. """ + # ======================= Helper Functions ======================= + from sklearn.metrics import roc_curve, auc, precision_recall_curve + + def create_visualizations(X, X_val, y, y_val, y_pred, y_proba, soft_clusters, soft_clusters_val, history, output_dir, + random_state, visualize): + print("Creating PCA visualizations...") + pca = PCA(n_components=2, random_state=random_state) + X_all = np.vstack([X, X_val]) + y_all = np.concatenate([y, y_val]) + soft_clusters_all = np.vstack([soft_clusters, soft_clusters_val]) + pca_proj = pca.fit_transform(X_all) + + df_vis = pd.DataFrame({ + 'PC1': pca_proj[:, 0], + 'PC2': pca_proj[:, 1], + 'label': y_all, + 'cluster': np.argmax(soft_clusters_all, axis=1) + }) + + plt.figure(figsize=(8, 6)) + sns.scatterplot(data=df_vis, x='PC1', y='PC2', hue='label', alpha=0.6) + plt.title('PCA of Dataset Colored by Binding Label') + plt.savefig(os.path.join(output_dir, 'pca_binding_label.png')) + print(f"Saved binding label PCA plot to {os.path.join(output_dir, 'pca_binding_label.png')}") + if visualize: + plt.show() + plt.close() + + plt.figure(figsize=(8, 6)) + sns.scatterplot(data=df_vis, x='PC1', y='PC2', hue='cluster', legend=False, alpha=0.6) + plt.title('PCA of Dataset Colored by Soft Cluster Assignment') + plt.savefig(os.path.join(output_dir, 'pca_cluster_assignment.png')) + print(f"Saved cluster assignment PCA plot to {os.path.join(output_dir, 'pca_cluster_assignment.png')}") + if visualize: + plt.show() + plt.close() + + plt.figure(figsize=(12, 5)) + plt.subplot(1, 2, 1) + plt.plot(history.history['loss'], label='Training Loss') + plt.plot(history.history['val_loss'], label='Validation Loss') + plt.title('Model Loss') + plt.xlabel('Epoch') + plt.ylabel('Loss') + plt.legend() + + plt.subplot(1, 2, 2) + plt.plot(history.history['accuracy'], label='Training Accuracy') + plt.plot(history.history['val_accuracy'], label='Validation Accuracy') + plt.title('Model Accuracy') + plt.xlabel('Epoch') + plt.ylabel('Accuracy') + plt.legend() + + plt.tight_layout() + plt.savefig(os.path.join(output_dir, 'training_history.png')) + print(f"Saved training history plot to {os.path.join(output_dir, 'training_history.png')}") + if visualize: + plt.show() + plt.close() + + # Add ROC and PRC plots if predictions are available + if y_proba is not None: + fpr, tpr, _ = roc_curve(y_val, y_proba) + roc_auc = auc(fpr, tpr) + + plt.figure(figsize=(8, 6)) + plt.plot(fpr, tpr, label=f'ROC curve (area = {roc_auc:.2f})') + plt.plot([0, 1], [0, 1], 'k--') + plt.title('Receiver Operating Characteristic') + plt.xlabel('False Positive Rate') + plt.ylabel('True Positive Rate') + plt.legend(loc='lower right') + plt.savefig(os.path.join(output_dir, 'roc_curve.png')) + print(f"Saved ROC curve plot to {os.path.join(output_dir, 'roc_curve.png')}") + if visualize: + plt.show() + plt.close() + + precision, recall, _ = precision_recall_curve(y_val, y_proba) + pr_auc = auc(recall, precision) + + plt.figure(figsize=(8, 6)) + plt.plot(recall, precision, label=f'PR curve (area = {pr_auc:.2f})') + plt.title('Precision-Recall Curve') + plt.xlabel('Recall') + plt.ylabel('Precision') + plt.legend(loc='lower left') + plt.savefig(os.path.join(output_dir, 'precision_recall_curve.png')) + print(f"Saved Precision-Recall curve plot to {os.path.join(output_dir, 'precision_recall_curve.png')}") + if visualize: + plt.show() + plt.close() + + def evaluation_metrics(y_true, y_pred, y_prob=None): + """ + Calculate evaluation metrics for the model predictions. + + Args: + y_true (np.ndarray): True labels. + y_pred (np.ndarray): Predicted labels (class predictions). + y_prob (np.ndarray, optional): Predicted probabilities for the positive class. + Required for metrics like AUROC and AUPRC. + + Returns: + dict: Dictionary of evaluation metrics. + """ + from sklearn.metrics import (accuracy_score, precision_score, recall_score, f1_score, + roc_auc_score, average_precision_score, balanced_accuracy_score, + matthews_corrcoef, cohen_kappa_score, confusion_matrix) + + # Basic classification metrics + accuracy = accuracy_score(y_true, y_pred) + precision = precision_score(y_true, y_pred, average='weighted') + recall = recall_score(y_true, y_pred, average='weighted') + f1 = f1_score(y_true, y_pred, average='weighted') + + # Additional classification metrics + balanced_acc = balanced_accuracy_score(y_true, y_pred) + mcc = matthews_corrcoef(y_true, y_pred) + kappa = cohen_kappa_score(y_true, y_pred) + + # Confusion matrix-based metrics + tn, fp, fn, tp = confusion_matrix(y_true, y_pred).ravel() + specificity = tn / (tn + fp) if (tn + fp) > 0 else 0 + npv = tn / (tn + fn) if (tn + fn) > 0 else 0 + + metrics = { + 'accuracy': accuracy, + 'precision': precision, + 'recall': recall, + 'f1_score': f1, + 'balanced_accuracy': balanced_acc, + 'mcc': mcc, + 'kappa': kappa, + 'specificity': specificity, + 'npv': npv + } + + # Probability-based metrics (only if probabilities are provided) + if y_prob is not None: + try: + auroc = roc_auc_score(y_true, y_prob) + auprc = average_precision_score(y_true, y_prob) + metrics.update({ + 'auroc': auroc, + 'auprc': auprc + }) + except Exception as e: + print(f"Warning: Could not calculate probability-based metrics: {e}") + + return metrics + + # ============================================== + # Set random seeds for reproducibility np.random.seed(random_state) tf.random.set_seed(random_state) @@ -2113,22 +2308,71 @@ def train_and_evaluate_moe( else: raise ValueError(f"Unsupported model_type: {model_type}") - # Train the model - print(f"Training model for {epochs} epochs...") + # --- create a balanced dataset --- + label_counts = Counter(y) + min_count = min(label_counts.values()) + balanced_indices = np.concatenate([ + np.random.choice(np.where(y == lbl)[0], min_count, replace=False) + for lbl in label_counts + ]) + np.random.shuffle(balanced_indices) + X_bal = X[balanced_indices] + soft_bal = soft_clusters[balanced_indices] + y_bal = y[balanced_indices] + + train_bal_ds = tf.data.Dataset.from_tensor_slices(((X_bal, soft_bal), y_bal)) \ + .shuffle(buffer_size=1000, seed=random_state) \ + .batch(batch_size) + + # --- Train the model --- + print(f"Training on balanced set for {epochs} epochs...") history = model.fit( - train_dataset, + train_bal_ds, validation_data=val_dataset, epochs=epochs, **kwargs ) - # Evaluate on validation set - print("Evaluating model on validation data...") + # TODO experimental + # Freeze initial half of layers, then fine-tune on full dataset + for layer in model.layers[: len(model.layers) // 2]: + layer.trainable = False + model.compile( + optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate), + loss=tf.keras.losses.BinaryCrossentropy(), + metrics=['accuracy'], + ) + print(f"Fine-tuning on full dataset for {epochs} epochs...") + history = model.fit( + train_dataset, + validation_data=val_dataset, + epochs=epochs//5, + **kwargs + ) + + # print(f"Training model for {epochs} epochs...") + # history = model.fit( + # train_dataset, + # validation_data=val_dataset, + # epochs=epochs, + # **kwargs + # ) + eval_results = model.evaluate(val_dataset) print(f"Validation loss: {eval_results[0]:.4f}, accuracy: {eval_results[1]:.4f}") + # Get predictions + y_proba = model.predict((X_val, soft_clusters_val)) + + # Ensure y_proba is a NumPy array before using NumPy operations + if isinstance(y_proba, tf.Tensor): + y_prob_np = y_proba.numpy() + else: + y_prob_np = y_proba - # Ensure the model is built before saving - print(model((X[:1], soft_clusters[:1]), training=False)) + # Convert probabilities to binary predictions + y_pred = (y_prob_np > 0.5).astype(int) + eval_dict = evaluation_metrics(y_val, y_pred, y_prob=y_prob_np) + print(f"Evaluation metrics: {eval_dict}") # TODO fix later # Save the trained model @@ -2141,75 +2385,24 @@ def train_and_evaluate_moe( # Visualization using PCA if visualize: print("Creating PCA visualizations...") - pca = PCA(n_components=2, random_state=random_state) - X_all = np.vstack([X, X_val]) - y_all = np.concatenate([y, y_val]) - soft_clusters_all = np.vstack([soft_clusters, soft_clusters_val]) - pca_proj = pca.fit_transform(X_all) - - df_vis = pd.DataFrame({ - 'PC1': pca_proj[:, 0], - 'PC2': pca_proj[:, 1], - 'label': y_all, - 'cluster': np.argmax(soft_clusters_all, axis=1) - }) - - # Plot by binding label - plt.figure(figsize=(8, 6)) - sns.scatterplot(data=df_vis, x='PC1', y='PC2', hue='label', alpha=0.6) - plt.title('PCA of Dataset Colored by Binding Label') - plt.savefig(os.path.join(output_dir, 'pca_binding_label.png')) - print(f"Saved binding label PCA plot to {os.path.join(output_dir, 'pca_binding_label.png')}") - plt.show() - plt.close() - - # Plot by cluster assignment - plt.figure(figsize=(8, 6)) - sns.scatterplot(data=df_vis, x='PC1', y='PC2', hue='cluster', legend=False, alpha=0.6) - plt.title('PCA of Dataset Colored by Soft Cluster Assignment') - plt.savefig(os.path.join(output_dir, 'pca_cluster_assignment.png')) - print(f"Saved cluster assignment PCA plot to {os.path.join(output_dir, 'pca_cluster_assignment.png')}") - plt.show() - plt.close() - - # Plot training history - plt.figure(figsize=(12, 5)) - plt.subplot(1, 2, 1) - plt.plot(history.history['loss'], label='Training Loss') - plt.plot(history.history['val_loss'], label='Validation Loss') - plt.title('Model Loss') - plt.xlabel('Epoch') - plt.ylabel('Loss') - plt.legend() - - plt.subplot(1, 2, 2) - plt.plot(history.history['accuracy'], label='Training Accuracy') - plt.plot(history.history['val_accuracy'], label='Validation Accuracy') - plt.title('Model Accuracy') - plt.xlabel('Epoch') - plt.ylabel('Accuracy') - plt.legend() - - plt.tight_layout() - plt.savefig(os.path.join(output_dir, 'training_history.png')) - print(f"Saved training history plot to {os.path.join(output_dir, 'training_history.png')}") - plt.show() - plt.close() + create_visualizations(X, X_val, y, y_val, y_pred, y_proba, soft_clusters, soft_clusters_val, history, output_dir, + random_state, visualize) return model, history, eval_results if __name__ == "__main__": - # Call train_and_evaluate_scqvae without trying to unpack return values + dataset_folder = "ConvNeXT-MHC" + # # Call train_and_evaluate_scqvae without trying to unpack return values train_and_evaluate_scqvae( - data_path="data/Pep2Vec/ConvNeXT-MHC_subset_new/pep2vec_output_fold_0.parquet", - val_data_path="data/Pep2Vec/ConvNeXT-MHC_subset_new/pep2vec_output_val_fold_0.parquet", + data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_fold_0.parquet", + val_data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_val_fold_0.parquet", input_type="latent1024", num_embeddings=32, embedding_dim=64, batch_size=32, - epochs=20, - output_dir="data/SCQvae/ConvNeXT-MHC", + epochs=200, + output_dir=f"data/SCQvae/{dataset_folder}", visualize=True, save_model=True, init_k_means=False, @@ -2217,20 +2410,20 @@ def train_and_evaluate_moe( test_size=0.2, output_data="train_val_seperate", # Options: "val", "train", "train_val_seperate" ) - m = "MoE" + m = "MLP" # Options: "MoE", "MLP", "transformer", "CNN" print(f"Running {m}") train_and_evaluate_moe( - data_path="data/SCQvae/ConvNeXT-MHC/quantized_outputs_train.parquet", - val_data_path="data/SCQvae/ConvNeXT-MHC/quantized_outputs_val.parquet", - # data_path="data/Pep2Vec/ConvNeXT-MHC_subset_new/pep2vec_output_fold_0.parquet", - # val_data_path="data/Pep2Vec/ConvNeXT-MHC_subset_new/pep2vec_output_val_fold_0.parquet", + data_path=f"data/SCQvae/{dataset_folder}/quantized_outputs_train.parquet", + val_data_path=f"data/SCQvae/{dataset_folder}/quantized_outputs_val.parquet", + # data_path="data/Pep2Vec/NetMHCpan_dataset_new_subset/pep2vec_output_fold_0.parquet", + # val_data_path="data/Pep2Vec/NetMHCpan_dataset_new_subset/pep2vec_output_val_fold_0.parquet", input_type="latent", - model_type=m, # Options: "MoE", "MLP", "transformer", "CNN" - batch_size=32, - epochs=20, + model_type=m, + batch_size=64, + epochs=200, learning_rate=1e-4, - hidden_dim=4, - output_dir="data/MoE/ConvNeXT-MHC", + hidden_dim=2, + output_dir=f"data/MoE/{dataset_folder}", visualize=True, save_model=True, random_state=42, From 5ca9e40c7b1b05f2bb1ff91a0b1857d61871fb57 Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 14 May 2025 17:22:10 +0200 Subject: [PATCH 39/83] added one more allele, 5 more missing from NetMHCpan --- data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv | 6 ++++++ 1 file changed, 6 insertions(+) diff --git a/data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv b/data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv index 1aba71d56..04944156e 100644 --- a/data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv +++ b/data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv @@ -122035,3 +122035,9 @@ 122033,H-2-IAu|P14438-alpha|P06344-beta,mice,2,LSSRFGYFGGNNVNTTHNNVLR/YETNTVYNPCYEVCFYYTYYD,H-2-IAu|P14438-alpha|P06344-beta,DHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNE/HFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLERTRAELDTVCRYNYEETEVPTSLRR,,mice-H-2-IAu 122034,H-2-IEd|P01904-alpha,mice,2,SASFAFQFGANQENVDVNVM/INIHNSFESYWID,H-2-IEd|P01904-alpha,EEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDAN/RFLEYVTSECHFYNGTQHVRFLERFIYNREENLRFDSDVGEYRAVTELGRPDAENWNSQPEILEDARASVDTYCRHNYEISDKFLVRR,,mice-H-2-IEd 122035,H-2-IEk|1FNE,mice,2,SASEAFQFFGNQENVDVNVM/INIFVHNSLVEVWFKED,H-2-IEk|1FNE,EEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDAN/PWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPR,,mice-H-2-IEk +122036,H-2-Kb,,,,H-2-Kb,CTCCCAGATTGTAAAGTGATGGTTCATGACCCTCATTCTCTAGCGTGA,, +122037,H-2-Dq,,,,H-2-Dq,,, +122038,H-2-Ld,,,,H-2-Ld,,, +122039,H-2-Kq,,,,H-2-Kq,,, +122040,BoLA-T2C,,,,BoLA-T2C,,, +122041,H-2-Lq,,,,H-2-Lq,,, From b067cced9a7c9ec9ba600b8453c1dd4a1aa2e046 Mon Sep 17 00:00:00 2001 From: amirreza Date: Fri, 16 May 2025 14:42:55 +0200 Subject: [PATCH 40/83] Refactor main function in run_pep2vec.py: enhance dataset handling, implement balanced sampling, and streamline k-fold cross-validation process --- run_pep2vec.py | 126 ++++++++++++++++++++++++------------------------- 1 file changed, 62 insertions(+), 64 deletions(-) diff --git a/run_pep2vec.py b/run_pep2vec.py index a95e449be..b3b9ca6d0 100644 --- a/run_pep2vec.py +++ b/run_pep2vec.py @@ -4,8 +4,7 @@ import sys import pandas as pd import numpy as np -from utils.processing_functions import create_k_fold_leave_one_out_stratified_cross_validation -from sklearn.model_selection import train_test_split +from utils.processing_functions import create_k_fold_leave_one_out_stratified_cross_validation, create_progressive_k_fold_cross_validation def load_data(file_path, sep=","): @@ -241,7 +240,7 @@ def stream_file(file_path): stream_file(input_path) -def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, process_fold_n=None): +def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, process_fold_n=None, chunk_n=0): """ Prepare datasets for Pep2Vec training and evaluation. @@ -270,28 +269,25 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, # Define paths and columns based on dataset is_netmhcpan = dataset_name.lower() == "netmhcpan_dataset" - if is_netmhcpan: - # NetMHCpan has a single cleaned_data.csv file - cleaned_data_path = os.path.join(dataset_dir, f"combined_data_{mhc_type[-1]}.csv") - print(cleaned_data_path) - columns = ["allele", "long_mer", "convoluted_label", "assigned_label", "MHC_class"] - else: + if not is_netmhcpan: # Other datasets have separate train/test files paths = { 'train': os.path.join(dataset_dir, "train.csv"), 'test': os.path.join(dataset_dir, "test_all.csv") } columns = ["allele", "long_mer", "binding_label", "mhc_sequence"] + rename_map = {"allele": "allotype", "long_mer": "peptide"} # required for pep2vec # Column configuration # Rename label column for NetMHCpan if is_netmhcpan: + # NetMHCpan has a single cleaned_data.csv file + # cleaned_data_path = os.path.join(dataset_dir, f"combined_data_{mhc_type[-1]}.csv") + cleaned_data_path = os.path.join(dataset_dir, f"chunks_I/subset_balanced_300k.csv") + print(cleaned_data_path) rename_map = {"allele": "allotype", "Peptide": "peptide"} # required for pep2vec rename_map["assigned_label"] = "binding_label" - # TODO if mhc_sequence is required it must be further processed columns = ["allotype", "peptide", "binding_label"] - else: - rename_map = {"allele": "allotype", "long_mer": "peptide"} # required for pep2vec # Load and process datasets datasets = {} @@ -302,9 +298,9 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, # df = load_data(cleaned_data_path) usecols = ['allele', 'peptide', 'assigned_label', 'mhc_sequence', 'mhc_class'] rng = random.Random(42) - df = pd.read_csv(cleaned_data_path, - usecols=usecols, - skiprows=lambda i: i > 0 and rng.random() > subset_prop) + df = pd.read_csv(cleaned_data_path, usecols=usecols) + if subset_prop < 1.0: + df = df.sample(frac=subset_prop, random_state=42) df_map = df.rename(columns={'assigned_label': 'binding_label', 'peptide': 'long_mer'}) print(f"Full dataset shape: {df.shape}") @@ -350,11 +346,7 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, else: # Regular dataset processing with separate files for name, path in paths.items(): - rng = random.Random(42) - df = pd.read_csv(path, - skiprows=lambda i: i > 0 and rng.random() > subset_prop) - print(f"{name.capitalize()} dataset shape: {df.shape}") - + df = pd.read_csv(path) df_map = df.copy() # Process dataframe @@ -381,25 +373,20 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, # define test1 and test2 datasets # test1: balanced sampling with equal representation from each binding_label train_df_ = datasets['train'] - unique_labels = train_df_['binding_label'].unique() - # Determine sample size (minimum of 100 or smallest class size) - samples_per_label = min(100, min(train_df_['binding_label'].value_counts())) + # Determine sample size (minimum of 1000 or smallest class size) + samples_per_label = min(1000, min(train_df_['binding_label'].value_counts())) print(f"Creating balanced test1 with {samples_per_label} samples per label") # Sample equally from each label - test1_indices = [] - for label in unique_labels: - label_samples = train_df_[train_df_['binding_label'] == label].sample( - n=samples_per_label, random_state=42 - ) - test1_indices.extend(label_samples.index.tolist()) + test1 = (train_df_ + .groupby('binding_label', group_keys=False) # no re‑index shuffle + .sample(n=samples_per_label, random_state=42) # vectorised sample + .reset_index(drop=True)) - # Create test1 from the selected indices - test1 = train_df_.loc[test1_indices].reset_index(drop=True) + train_mask = ~train_df_.index.isin(test1.index) + train_updated = train_df_.loc[train_mask] - # Create updated training set by dropping the selected indices - train_updated = train_df_.drop(index=test1_indices).reset_index(drop=True) datasets['train'] = train_updated # test2: select allele with lowest sample count @@ -411,9 +398,9 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, if process_fold_n == 0 or process_fold_n == None: # Create k-fold cross-validation splits k = n_folds - folds = create_k_fold_leave_one_out_stratified_cross_validation( + folds = create_progressive_k_fold_cross_validation( datasets['train'], k=k, target_col="binding_label", - id_col="allotype", train_size=0.8, subset_prop=subset_prop + id_col="allotype" ) held_out_ids_path = os.path.join(folds_dir, "held_out_ids.txt") @@ -453,33 +440,34 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, test2.to_csv(os.path.join(folds_dir, "test2_single_unique_allele.csv"), index=False, header=True) print("Test dataset saved.") + # load the fold csv files for specified fold + train_path = os.path.join(folds_dir, f"train_set_fold_{process_fold_n}.csv") + val_path = os.path.join(folds_dir, f"val_set_fold_{process_fold_n}.csv") + if os.path.exists(train_path) and os.path.exists(val_path): + datasets['train'] = pd.read_csv(train_path, index_col=0) + datasets['val'] = pd.read_csv(val_path, index_col=0) else: - # load the fold csv files for specified fold - fold_idx = process_fold_n - train_path = os.path.join(folds_dir, f"train_set_fold_{fold_idx}.csv") - val_path = os.path.join(folds_dir, f"val_set_fold_{fold_idx}.csv") - if os.path.exists(train_path) and os.path.exists(val_path): - datasets['train'] = pd.read_csv(train_path, index_col=0) - datasets['val'] = pd.read_csv(val_path, index_col=0) - else: - raise FileNotFoundError(f"Fold files not found for fold {fold_idx}") + raise FileNotFoundError(f"Fold files not found for fold {process_fold_n}") ################### Pep2Vec ################### # automatically get the number of cores num_cores = max(os.cpu_count() - 2, 1) # TODO only process one fold? with process_fold_n - for i in range(n_folds): - if process_fold_n != None and process_fold_n == i: - continue + if process_fold_n == None: + for i in range(n_folds): + for split in ['train', 'val']: + csv_in = os.path.join(folds_dir, f"{split}_set_fold_{i}.csv") + out_pq = os.path.join(output_dir, f"pep2vec_output_{split}_fold_{i}.parquet") + if os.path.exists(csv_in): + os.system( + f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {csv_in} --output_location {out_pq} --mhctype {mhc_type}") + else: for split in ['train', 'val']: - csv_in = os.path.join(folds_dir, f"{split}_set_fold_{i}.csv") - out_pq = os.path.join(output_dir, f"pep2vec_output_{split}_fold_{i}.parquet") + csv_in = os.path.join(folds_dir, f"{split}_set_fold_{process_fold_n}.csv") + out_pq = os.path.join(output_dir, f"pep2vec_output_{split}_fold_{process_fold_n}.parquet") if os.path.exists(csv_in): os.system( f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {csv_in} --output_location {out_pq} --mhctype {mhc_type}") - # Only run one fold if specified - if process_fold_n is not None: - break # # test set test_file = os.path.join(folds_dir, "test_original.csv") @@ -507,27 +495,37 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, print(f"Running for Fold {fold_n}") - df_map = main("Conbotnet", "mhc2", 0.001, 5, fold_n) + # main("Conbotnet", "mhc2", 1, 5, fold_n) + # df_map = None + # if not df_map: + # df1 = pd.read_csv(os.path.join("data", "Conbotnet", "train.csv"),) + # df2 = pd.read_csv(os.path.join("data", "Conbotnet", "test_all.csv"),) + # df_map = pd.concat([df1, df2]) + # add_binding_label_streaming( + # input_path=os.path.join("data", "Pep2Vec", "Conbotnet"), + # map_csv=df_map, + # output_dir=os.path.join("data", "Pep2Vec", "Conbotnet_new_subset"), + # is_netmhcpan=False + # ) + + df_map = main("ConvNeXT-MHC", "mhc1", 0.01, 5, fold_n) + # df_map = None + # if not df_map: + # df1 = pd.read_csv(os.path.join("data", "ConvNeXT-MHC", "train.csv"),) + # df2 = pd.read_csv(os.path.join("data", "ConvNeXT-MHC", "test_all.csv"),) + # df_map = pd.concat([df1, df2]) add_binding_label_streaming( - input_path=os.path.join("data", "Pep2Vec", "Conbotnet"), + input_path=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC"), map_csv=df_map, - output_dir=os.path.join("data", "Pep2Vec", "Conbotnet_new_subset"), - is_netmhcpan=False + output_dir=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC_new_subset") ) - - # main("ConvNeXT-MHC", "mhc1", 0.001, 5) - # add_binding_label( - # df_path=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC"), - # train_path=os.path.join("data", "ConvNeXT-MHC", "train.csv"), - # output_dir=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC_new_subset") - # ) # main("NetMHCpan_dataset", "mhc2", 0.01, 5) # add_binding_label( # df_path=os.path.join("data", "Pep2Vec", "NetMHCIIpan_dataset"), # train_path=os.path.join("data", "NetMHCIIpan_dataset", "cleaned_data.csv"), # output_dir=os.path.join("data", "Pep2Vec", "NetMHCIpan_dataset_new_subset") # ) - # df_map = main("NetMHCpan_dataset", "mhc1", 0.001, 5, fold_n) + # df_map = main("NetMHCpan_dataset", "mhc1", 1, 5, fold_n) # add_binding_label_streaming( # input_path=os.path.join("data", "Pep2Vec", "NetMHCpan_dataset"), # map_csv=df_map, From 2e9fa761d2f43fce030cc3c9cd96be24a565ab7f Mon Sep 17 00:00:00 2001 From: amirreza Date: Fri, 16 May 2025 14:43:00 +0200 Subject: [PATCH 41/83] Refactor load_data function in run_pMHC_DL.py: streamline data loading for k-fold cross-validation, enhance dataset handling, and implement support for multiple input types --- run_pMHC_DL.py | 724 ++++++++++++++++++++++++++++--------------------- 1 file changed, 409 insertions(+), 315 deletions(-) diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index 22b9411ed..a36aa0591 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -12,7 +12,7 @@ from sklearn.decomposition import PCA from collections import Counter -from utils.model import SCQ1DAutoEncoder, MoEModel, BinaryMLP, TabularTransformer, EmbeddingCNN +from utils.model import SCQ1DAutoEncoder, MoEModel, BinaryMLP, TabularTransformer, EmbeddingCNN, EnhancedMoEModel ''' # Set TensorFlow logging level for more information @@ -985,139 +985,242 @@ def create_dataset(X, y=None, batch_size=32, is_training=True): dataset = dataset.prefetch(tf.data.AUTOTUNE) # Prefetch for better performance return dataset - def load_data(data_path, val_data_path=None, test_size=0.2, random_state=42, input_type='latent1024'): - """ - Load and prepare data for training with simplified validation. + # def load_data(data_path, val_data_path=None, test_size=0.2, random_state=42, input_type='latent1024'): + # """ + # Load and prepare data for training with simplified validation. + # + # Args: + # data_path: Path to training data parquet file + # val_data_path: Optional path to validation data + # test_size: Fraction of data to use for validation if val_data_path is None + # random_state: Random seed for reproducibility + # input_type: Type of input data ('latent1024' or 'pMHC-sequence', 'attention51') + # + # Returns: + # X_train: Training data features with unique indices + # X_test: Test/validation data features with unique indices + # X_val: Validation data features with unique indices + # y_train: Training data labels + # y_test: Test/validation data labels + # y_val: Validation data labels + # seq_length: Length of each sequence including the index feature + # """ + # print(f"Loading training data from {data_path}") + # df = pd.read_parquet(data_path) + # + # # Add original indices to track samples + # df['original_idx'] = np.arange(len(df)) + # + # # Handle different input types + # if input_type == 'latent1024': + # columns = [col for col in df.columns if 'latent' in col] + # if not columns: + # raise ValueError("No latent columns found in the dataset") + # seq_length = len(columns) + # print(f"Found {seq_length} latent columns") + # elif input_type == 'pMHC-sequence': + # # Only check for peptide column as mhc_sequence is now optional + # if 'peptide' not in df.columns: + # raise ValueError("Required column 'peptide' not found in the dataset") + # columns = ['peptide'] + # if 'mhc_sequence' in df.columns: + # columns.append('mhc_sequence') + # print(f"Using sequence columns: {columns}") + # # Note: pMHC-sequence processing would be implemented here + # raise NotImplementedError("pMHC-sequence input not yet implemented") + # elif input_type == 'attention51': + # # Check for attention columns + # columns = [col for col in df.columns if 'attn_' in col] + # if not columns: + # raise ValueError("No attention columns found in the dataset") + # seq_length = len(columns) + # print(f"Found {seq_length} attention columns") + # else: + # raise ValueError(f"Unknown input_type: {input_type}. Expected 'latent1024' or 'pMHC-sequence'") + # + # label_col = 'binding_label' + # y = df[label_col].values + # + # # Extract original indices to ensure uniqueness across splits + # original_indices = df['original_idx'].values + # + # # Extract features and clean data + # X = df[columns].values + # if np.isnan(X).any() or np.isinf(X).any(): + # print("Warning: Dataset contains NaN or Inf values. Replacing with zeros.") + # X = np.nan_to_num(X) + # + # # Add index as an additional feature + # X_with_idx = np.column_stack((original_indices.reshape(-1, 1), X)) + # + # # Reshape with the added index column + # seq_length_with_idx = seq_length + 1 + # X_with_idx = X_with_idx.reshape(-1, seq_length_with_idx) + # + # print(f"Data shape with indices: {X_with_idx.shape}, Data range: [{np.min(X):.4f}, {np.max(X):.4f}]") + # print(f"Label distribution: {np.bincount(y.astype(int) if y.dtype != object else [0])}") + # + # # Initialize test variables + # X_test = None + # y_test = None + # + # # Handle validation data if provided + # if val_data_path: + # try: + # print(f"Loading validation data from {val_data_path}") + # val_df = pd.read_parquet(val_data_path) + # + # # Create unique indices for validation data by offsetting from training data + # val_df['original_idx'] = np.arange(len(val_df)) + len(df) + 1000 # Add 1000 as buffer + # + # val_X = val_df[columns].values + # val_indices = val_df['original_idx'].values + # + # if np.isnan(val_X).any() or np.isinf(val_X).any(): + # print("Warning: Validation set contains NaN or Inf values. Replacing with zeros.") + # val_X = np.nan_to_num(val_X) + # + # # Extract validation labels + # if label_col is not None and label_col in val_df.columns: + # val_y = val_df[label_col].values + # else: + # print("Warning: No binding label column found in validation data. Using dummy labels.") + # val_y = np.zeros(len(val_df)) + # + # # Add indices to validation features + # X_test = np.column_stack((val_indices.reshape(-1, 1), val_X)) + # X_test = X_test.reshape(-1, seq_length_with_idx) + # y_test = val_y + # + # print(f"Validation data shape with indices: {X_test.shape}") + # print(f"Validation label distribution: {np.bincount(y_test.astype(int) if y_test.dtype != object else [0])}") + # except Exception as e: + # print(f"Error loading validation data: {e}") + # X_test = None + # y_test = None + # + # # Split training data for validation set (the indices will automatically be split correctly) + # X_train, X_val, y_train, y_val = train_test_split(X_with_idx, y, test_size=test_size, random_state=random_state) + # print(f"Training data shape with indices: {X_train.shape}, Validation data shape: {X_val.shape}") + # print(f"Training label distribution: {np.bincount(y_train.astype(int) if y_train.dtype != object else [0])}") + # print(f"Validation label distribution: {np.bincount(y_val.astype(int) if y_val.dtype != object else [0])}") + # + # # Verify index uniqueness + # all_indices = np.concatenate([ + # X_train[:, 0], + # X_val[:, 0], + # X_test[:, 0] if X_test is not None else np.array([]) + # ]) + # unique_indices = np.unique(all_indices) + # if len(unique_indices) != len(all_indices): + # print("Warning: Some indices are not unique across data splits!") + # else: + # print(f"Successfully created {len(unique_indices)} unique indices across all data splits") + # + # return X_train, X_test, X_val, y_train, y_test, y_val, seq_length_with_idx + def load_data(data_path, input_type='latent1024'): + """ Load training and validation folds along with test datasets. Args: - data_path: Path to training data parquet file - val_data_path: Optional path to validation data - test_size: Fraction of data to use for validation if val_data_path is None - random_state: Random seed for reproducibility - input_type: Type of input data ('latent1024' or 'pMHC-sequence', 'attention51') + data_path (str): Path to the directory containing fold data + input_type (str): Type of input data to extract ('latent1024', 'attention51', etc.) Returns: - X_train: Training data features with unique indices - X_test: Test/validation data features with unique indices - X_val: Validation data features with unique indices - y_train: Training data labels - y_test: Test/validation data labels - y_val: Validation data labels - seq_length: Length of each sequence including the index feature + tuple: (folds, test1, test2) where: + - folds is a list of (X_train, y_train, X_val, y_val) tuples for each fold + - test1 is a tuple of (X_test1, y_test1) for stratified test data + - test2 is a tuple of (X_test2, y_test2) for single unique allele test data """ - print(f"Loading training data from {data_path}") - df = pd.read_parquet(data_path) + print(f"Loading data from {data_path}") - # Add original indices to track samples - df['original_idx'] = np.arange(len(df)) + # Initialize containers + folds = [] + test1 = None + test2 = None + seq_length = 0 - # Handle different input types - if input_type == 'latent1024': - columns = [col for col in df.columns if 'latent' in col] - if not columns: - raise ValueError("No latent columns found in the dataset") - seq_length = len(columns) - print(f"Found {seq_length} latent columns") - elif input_type == 'pMHC-sequence': - # Only check for peptide column as mhc_sequence is now optional - if 'peptide' not in df.columns: - raise ValueError("Required column 'peptide' not found in the dataset") - columns = ['peptide'] - if 'mhc_sequence' in df.columns: - columns.append('mhc_sequence') - print(f"Using sequence columns: {columns}") - # Note: pMHC-sequence processing would be implemented here - raise NotImplementedError("pMHC-sequence input not yet implemented") - elif input_type == 'attention51': - # Check for attention columns - columns = [col for col in df.columns if 'attn_' in col] - if not columns: - raise ValueError("No attention columns found in the dataset") - seq_length = len(columns) - print(f"Found {seq_length} attention columns") - else: - raise ValueError(f"Unknown input_type: {input_type}. Expected 'latent1024' or 'pMHC-sequence'") + # Load all available folds + fold_index = 0 + while True: + train_path = os.path.join(data_path, f"pep2vec_output_train_fold_{fold_index}.parquet") + val_path = os.path.join(data_path, f"pep2vec_output_val_fold_{fold_index}.parquet") - label_col = 'binding_label' - y = df[label_col].values + if not (os.path.exists(train_path) and os.path.exists(val_path)): + break - # Extract original indices to ensure uniqueness across splits - original_indices = df['original_idx'].values + # Load train and validation data for this fold + train_df = pd.read_parquet(train_path) + val_df = pd.read_parquet(val_path) - # Extract features and clean data - X = df[columns].values - if np.isnan(X).any() or np.isinf(X).any(): - print("Warning: Dataset contains NaN or Inf values. Replacing with zeros.") - X = np.nan_to_num(X) + # Process features based on input_type + if input_type == 'latent1024': + train_features = [col for col in train_df.columns if 'latent' in col] + val_features = [col for col in val_df.columns if 'latent' in col] + seq_length = len(train_features) - # Add index as an additional feature - X_with_idx = np.column_stack((original_indices.reshape(-1, 1), X)) + if not train_features or not val_features: + raise ValueError(f"No latent features found in fold {fold_index}") - # Reshape with the added index column - seq_length_with_idx = seq_length + 1 - X_with_idx = X_with_idx.reshape(-1, seq_length_with_idx) + X_train = train_df[train_features].values + X_val = val_df[val_features].values - print(f"Data shape with indices: {X_with_idx.shape}, Data range: [{np.min(X):.4f}, {np.max(X):.4f}]") - print(f"Label distribution: {np.bincount(y.astype(int) if y.dtype != object else [0])}") + elif input_type == 'attention51': + train_features = [col for col in train_df.columns if 'attn_' in col] + val_features = [col for col in val_df.columns if 'attn_' in col] + seq_length = len(train_features) - # Initialize test variables - X_test = None - y_test = None + if not train_features or not val_features: + raise ValueError(f"No attention features found in fold {fold_index}") - # Handle validation data if provided - if val_data_path: - try: - print(f"Loading validation data from {val_data_path}") - val_df = pd.read_parquet(val_data_path) + X_train = train_df[train_features].values + X_val = val_df[val_features].values - # Create unique indices for validation data by offsetting from training data - val_df['original_idx'] = np.arange(len(val_df)) + len(df) + 1000 # Add 1000 as buffer + elif input_type == 'pMHC-sequence': + # Handle sequence data - placeholder for implementation + raise NotImplementedError("pMHC-sequence input type not yet implemented") + else: + raise ValueError(f"Unknown input_type: {input_type}") - val_X = val_df[columns].values - val_indices = val_df['original_idx'].values + # Extract labels if available + y_train = train_df['binding_label'].values if 'binding_label' in train_df.columns else None + y_val = val_df['binding_label'].values if 'binding_label' in val_df.columns else None - if np.isnan(val_X).any() or np.isinf(val_X).any(): - print("Warning: Validation set contains NaN or Inf values. Replacing with zeros.") - val_X = np.nan_to_num(val_X) + # Append fold data + folds.append((X_train, y_train, X_val, y_val)) + fold_index += 1 - # Extract validation labels - if label_col is not None and label_col in val_df.columns: - val_y = val_df[label_col].values - else: - print("Warning: No binding label column found in validation data. Using dummy labels.") - val_y = np.zeros(len(val_df)) + print(f"Loaded {len(folds)} folds") - # Add indices to validation features - X_test = np.column_stack((val_indices.reshape(-1, 1), val_X)) - X_test = X_test.reshape(-1, seq_length_with_idx) - y_test = val_y + # Load test1 (stratified) dataset + test1_path = os.path.join(data_path, "test1_stratified.csv") + if os.path.exists(test1_path): + test1_df = pd.read_csv(test1_path) - print(f"Validation data shape with indices: {X_test.shape}") - print(f"Validation label distribution: {np.bincount(y_test.astype(int) if y_test.dtype != object else [0])}") - except Exception as e: - print(f"Error loading validation data: {e}") - X_test = None - y_test = None - - # Split training data for validation set (the indices will automatically be split correctly) - X_train, X_val, y_train, y_val = train_test_split(X_with_idx, y, test_size=test_size, random_state=random_state) - print(f"Training data shape with indices: {X_train.shape}, Validation data shape: {X_val.shape}") - print(f"Training label distribution: {np.bincount(y_train.astype(int) if y_train.dtype != object else [0])}") - print(f"Validation label distribution: {np.bincount(y_val.astype(int) if y_val.dtype != object else [0])}") - - # Verify index uniqueness - all_indices = np.concatenate([ - X_train[:, 0], - X_val[:, 0], - X_test[:, 0] if X_test is not None else np.array([]) - ]) - unique_indices = np.unique(all_indices) - if len(unique_indices) != len(all_indices): - print("Warning: Some indices are not unique across data splits!") - else: - print(f"Successfully created {len(unique_indices)} unique indices across all data splits") + if input_type == 'latent1024': + test1_features = [col for col in test1_df.columns if 'latent' in col] + if test1_features: + X_test1 = test1_df[test1_features].values + y_test1 = test1_df['binding_label'].values if 'binding_label' in test1_df.columns else None + test1 = (X_test1, y_test1) + print(f"Loaded test1 dataset: {X_test1.shape}") + + # Load test2 (single unique allele) dataset + test2_path = os.path.join(data_path, "test2_single_unique_allele.csv") + if os.path.exists(test2_path): + test2_df = pd.read_csv(test2_path) + + if input_type == 'latent1024': + test2_features = [col for col in test2_df.columns if 'latent' in col] + if test2_features: + X_test2 = test2_df[test2_features].values + y_test2 = test2_df['binding_label'].values if 'binding_label' in test2_df.columns else None + test2 = (X_test2, y_test2) + print(f"Loaded test2 dataset: {X_test2.shape}") + + seq_length_with_idx = seq_length + + return folds, test1, test2, seq_length_with_idx - return X_train, X_test, X_val, y_train, y_test, y_val, seq_length_with_idx # def load_data_hash(data_path, val_data_path=None, test_size=0.2, random_state=42, input_type='latent1024', cache=True): # """ @@ -1666,181 +1769,168 @@ def remove_y(dataset): return dataset.map(lambda x, y: x) # ======================= End of Helper Functions ======================= - - # --- Main Pipeline --- - print("--- Main Pipeline ---") + # --- Main Pipeline for Folds --- + print("--- Main Pipeline (Folds) ---") print("Loading/Generating Training Data...") - X_train, X_test, X_val, y_train, y_test, y_val, seq_length = load_data(data_path, val_data_path, test_size=test_size, random_state=random_state) - - # Preserve original labels before dropping - if output_data == "all": - original_data = np.concatenate([X_train, X_val], axis=0) - original_labels = np.concatenate([y_train, y_val], axis=0) - elif output_data == "train": - original_data = X_train - original_labels = y_train - else: - original_data = X_val - original_labels = y_val - - # Initialize codebook with k-means - print("Initializing codebook with k-means...") - if init_k_means: - print("Initializing codebook with k-means") - initial_codebook = initialize_codebook_with_kmeans(X_train, num_embeddings, seq_length) - else: - print("Not initializing codebook with k-means") - initial_codebook = None - - # Create datasets - print("Creating TensorFlow Datasets...") - train_dataset_y = create_dataset(X_train, y_train, batch_size=batch_size, is_training=True) - val_dataset_y = create_dataset(X_val, y_val, batch_size=batch_size, is_training=False) - test_dataset_y = create_dataset(X_test, y_test, batch_size=batch_size, is_training=False) - print("Datasets created.") - - # drop IDs - train_dataset = train_dataset_y.apply(remove_id) - val_dataset = val_dataset_y.apply(remove_id) - test_dataset = test_dataset_y.apply(remove_id) - seq_length = seq_length - 1 # Remove the index feature - - # remove labels - train_dataset = train_dataset.apply(remove_y) - val_dataset = val_dataset.apply(remove_y) - test_dataset = test_dataset.apply(remove_y) - - - # --- Model Instantiation --- - print("Building the SCQ1DAutoEncoder model...") - input_shape = (seq_length,) - model = SCQ1DAutoEncoder( - input_dim=input_shape, - num_embeddings=num_embeddings, - embedding_dim=embedding_dim, - commitment_beta=commitment_beta, - scq_params={ - 'lambda_reg': 1.0, # Increased regularization - 'discrete_loss': True, # Use discrete loss - 'reset_dead_codes': True, # Reset underused vectors - 'usage_threshold': 1e-4, # Lower threshold - 'reset_interval': 5 # Frequent resets - }, - initial_codebook=initial_codebook, # Pass k-means initialized codebook - num_classes=1, # set binary classification - cluster_lambda=10, # Increased lambda for cluster loss - ) - print("Model built.") - - - # --- Compile and Train --- - print("Compiling the model...") - model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate)) - print("Model compiled.") - - # Determine minority class count - label_counts = Counter(y_train) - min_count = min(label_counts.values()) - # Sample balanced indices - balanced_indices = [] - for label in label_counts: - inds = np.where(y_train == label)[0] - sampled = np.random.choice(inds, min_count, replace=False) - balanced_indices.extend(sampled) - balanced_indices = np.array(balanced_indices) - # Create balanced dataset - X_bal = X_train[balanced_indices] - y_bal = y_train[balanced_indices] - balanced_dataset_y = create_dataset(X_bal, y_bal, batch_size=batch_size, is_training=True) - balanced_dataset = balanced_dataset_y.apply(remove_id).apply(remove_y) - - # Initial training on balanced set - print(f"Training on balanced set for {epochs} epochs...") - start_time = time.time() - history = model.fit( - balanced_dataset, - epochs=epochs, - validation_data=val_dataset - ) - end_time = time.time() - print(f"Balanced training finished in {end_time - start_time:.2f} seconds.") - - # TODO Experimental - # Freeze encoder layers before fine-tuning - model.encoder.trainable = False - for layer in model.encoder.layers: - layer.trainable = False - - # Recompile model after freezing layers - model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate)) - - # Fine-tune on full dataset - print(f"Fine-tuning on full dataset for {epochs} epochs...") - start_time = time.time() - history = model.fit( - train_dataset, - epochs=epochs//10, - validation_data=val_dataset - ) - end_time = time.time() - print(f"Fine-tuning finished in {end_time - start_time:.2f} seconds.") - - # --- Evaluation and Visualization --- - print("\nEvaluating the model...") + folds, test1, test2, seq_length = load_data(data_path, input_type=input_type) + + for fold_idx, (X_train, y_train, X_val, y_val) in enumerate(folds): + if fold_idx == 0: # only for the first fold # TODO: remove this + print(f"\n=== Processing Fold {fold_idx + 1}/{len(folds)} ===") + + # Preserve original labels before dropping + if output_data == "all": + original_data = np.concatenate([X_train, X_val], axis=0) + original_labels = np.concatenate([y_train, y_val], axis=0) + elif output_data == "train": + original_data = X_train + original_labels = y_train + else: + original_data = X_val + original_labels = y_val + + # Initialize codebook with k-means + print("Initializing codebook with k-means...") + if init_k_means: + print("Initializing codebook with k-means") + initial_codebook = initialize_codebook_with_kmeans(X_train, num_embeddings, seq_length) + else: + print("Not initializing codebook with k-means") + initial_codebook = None + + # Create datasets + print("Creating TensorFlow Datasets...") + train_dataset_y = create_dataset(X_train, y_train, batch_size=batch_size, is_training=True) + val_dataset_y = create_dataset(X_val, y_val, batch_size=batch_size, is_training=False) + print("Datasets created.") + + # drop IDs + train_dataset = train_dataset_y.apply(remove_id) + val_dataset = val_dataset_y.apply(remove_id) + seq_length_fold = seq_length - 1 # Remove the index feature + + # remove labels + train_dataset = train_dataset.apply(remove_y) + val_dataset = val_dataset.apply(remove_y) + + # --- Model Instantiation --- + print("Building the SCQ1DAutoEncoder model...") + input_shape = (seq_length_fold,) + model = SCQ1DAutoEncoder( + input_dim=input_shape, + num_embeddings=num_embeddings, + embedding_dim=embedding_dim, + commitment_beta=commitment_beta, + scq_params={ + 'lambda_reg': 1.0, + 'discrete_loss': True, + 'reset_dead_codes': True, + 'usage_threshold': 1e-4, + 'reset_interval': 5 + }, + initial_codebook=initial_codebook, + num_classes=1, + cluster_lambda=10, + ) + print("Model built.") + + # --- Compile and Train --- + print("Compiling the model...") + model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate)) + print("Model compiled.") + + # Determine minority class count + label_counts = Counter(y_train) + min_count = min(label_counts.values()) + # Sample balanced indices + balanced_indices = [] + for label in label_counts: + inds = np.where(y_train == label)[0] + sampled = np.random.choice(inds, min_count, replace=False) + balanced_indices.extend(sampled) + balanced_indices = np.array(balanced_indices) + # Create balanced dataset + X_bal = X_train[balanced_indices] + print(f"Balanced dataset shape: {X_bal.shape}") + y_bal = y_train[balanced_indices] + balanced_dataset_y = create_dataset(X_bal, y_bal, batch_size=batch_size, is_training=True) + balanced_dataset = balanced_dataset_y.apply(remove_id).apply(remove_y) + + # Initial training on balanced set + print(f"Training on balanced set for {epochs} epochs...") + start_time = time.time() + history = model.fit( + balanced_dataset, + epochs=epochs, + validation_data=val_dataset + ) + end_time = time.time() + print(f"Balanced training finished in {end_time - start_time:.2f} seconds.") + + # Freeze encoder layers before fine-tuning + model.encoder.trainable = False + for layer in model.encoder.layers: + layer.trainable = False + + # Recompile model after freezing layers + model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate)) + + # # Fine-tune on full dataset + # print(f"Fine-tuning on full dataset for {epochs} epochs...") + # start_time = time.time() + # history = model.fit( + # train_dataset, + # epochs=epochs // 10, + # validation_data=val_dataset + # ) + # end_time = time.time() + # print(f"Fine-tuning finished in {end_time - start_time:.2f} seconds.") + + # --- Evaluation and Visualization --- + print("\nEvaluating the model...") - if visualize: - print("\nPlotting training history...") - plot_training_metrics(history, save_path=os.path.join(output_dir, 'vqvae_training_metrics.png')) - print("\nPerforming example inference...") - try: - example_batch, _ = next(iter(val_dataset)) - except Exception: - example_batch = next(iter(val_dataset)) - output = model(example_batch, training=False) - reconstruction, quantized_latent, cluster_indices, vq_loss, perplexity = output - print("\nVisualizing reconstructions...") - plot_reconstructions(example_batch.numpy(), reconstruction.numpy(), - save_path=os.path.join(output_dir, 'vqvae_reconstructions.png')) - plot_reconstructions(example_batch.numpy(), reconstruction.numpy(), - save_path=os.path.join(output_dir, 'vqvae_reconstructions.png')) - print("\nAnalyzing codebook usage...") - # # Use hard indices for codebook usage analysis (index 5 in model output) - # plot_codebook_usage(cluster_indices, num_embeddings, save_path=os.path.join(output_dir, 'codebook_usage.png')) - # print("\nAnalyzing cluster distribution from one-hot encodings...") - # # Use one-hot encodings for cluster distribution (index 2 in model output) - # # print number of samples - # print(f"Shape of cluster_indices: {cluster_indices.shape}") - # plot_cluster_distribution(cluster_indices, save_path=os.path.join(output_dir, 'cluster_distribution.png')) - - # --- Save Model --- - if save_model: - model_dir = os.path.join(output_dir, 'model') - os.makedirs(model_dir, exist_ok=True) - model.save_weights(os.path.join(model_dir, 'vqvae_model_weights.h5')) - print(f"\nModel weights saved to '{os.path.join(model_dir, 'vqvae_model_weights.h5')}'") - - # --- Extract Latent Space --- - print("\nExtracting quantized latent space...") - - if output_data == "train_val_combined": - out_ds = tf.data.Dataset.concatenate(train_dataset, val_dataset) - process_and_save(out_ds, "combined", model, original_labels, output_dir, num_embeddings) - - elif output_data in ("train", "val"): - ds_name = output_data - ds = train_dataset if ds_name == "train" else val_dataset - process_and_save(ds, ds_name, model, original_labels, output_dir, num_embeddings) - - elif output_data == "train_val_seperate": - # Process train and val separately - process_and_save(train_dataset, "train", model,y_train , output_dir, num_embeddings) - process_and_save(val_dataset, "val", model,y_val , output_dir, num_embeddings) + if visualize: + print("\nPlotting training history...") + plot_training_metrics(history, save_path=os.path.join(output_dir, f'vqvae_training_metrics_fold{fold_idx}.png')) + print("\nPerforming example inference...") + try: + example_batch, _ = next(iter(val_dataset)) + except Exception: + example_batch = next(iter(val_dataset)) + output = model(example_batch, training=False) + reconstruction, quantized_latent, cluster_indices, vq_loss, perplexity = output + print("\nVisualizing reconstructions...") + plot_reconstructions(example_batch.numpy(), reconstruction.numpy(), + save_path=os.path.join(output_dir, f'vqvae_reconstructions_fold{fold_idx}.png')) + + # --- Save Model --- + if save_model: + model_dir = os.path.join(output_dir, f'model_fold{fold_idx}') + os.makedirs(model_dir, exist_ok=True) + model.save_weights(os.path.join(model_dir, 'vqvae_model_weights.h5')) + print(f"\nModel weights saved to '{os.path.join(model_dir, 'vqvae_model_weights.h5')}'") + + # --- Extract Latent Space --- + print("\nExtracting quantized latent space...") + + if output_data == "train_val_combined": + out_ds = tf.data.Dataset.concatenate(train_dataset, val_dataset) + process_and_save(out_ds, f"combined_fold{fold_idx}", model, original_labels, output_dir, num_embeddings) + + elif output_data in ("train", "val"): + ds_name = output_data + ds = train_dataset if ds_name == "train" else val_dataset + process_and_save(ds, f"{ds_name}_fold{fold_idx}", model, original_labels, output_dir, num_embeddings) + + elif output_data == "train_val_seperate": + process_and_save(train_dataset, f"train_fold{fold_idx}", model, y_train, output_dir, num_embeddings) + process_and_save(val_dataset, f"val_fold{fold_idx}", model, y_val, output_dir, num_embeddings) - else: - raise ValueError("Invalid output_data. Must be 'train', 'val', 'train_val_combined', or 'train_val_seperate'.") + else: + raise ValueError("Invalid output_data. Must be 'train', 'val', 'train_val_combined', or 'train_val_seperate'.") - print(f"\nAll requested splits processed. Outputs are in: {output_dir}") + print(f"\nAll requested splits processed for all folds. Outputs are in: {output_dir}") # out_dataset2 = None # if output_data == "train_val_combined": @@ -2278,6 +2368,18 @@ def evaluation_metrics(y_true, y_pred, y_prob=None): loss=tf.keras.losses.BinaryCrossentropy(), metrics=['accuracy'], ) + elif model_type == 'MoE_2': + model = EnhancedMoEModel( + feature_dim, + hidden_dim=hidden_dim, + num_experts=num_experts, + use_hard_clustering=use_soft_clusters_as_gates, + ) + model.compile( + optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate), + loss=tf.keras.losses.BinaryCrossentropy(), + metrics=['accuracy'], + ) elif model_type == 'MLP': model = BinaryMLP( feature_dim, @@ -2350,14 +2452,6 @@ def evaluation_metrics(y_true, y_pred, y_prob=None): **kwargs ) - # print(f"Training model for {epochs} epochs...") - # history = model.fit( - # train_dataset, - # validation_data=val_dataset, - # epochs=epochs, - # **kwargs - # ) - eval_results = model.evaluate(val_dataset) print(f"Validation loss: {eval_results[0]:.4f}, accuracy: {eval_results[1]:.4f}") # Get predictions @@ -2392,37 +2486,37 @@ def evaluation_metrics(y_true, y_pred, y_prob=None): if __name__ == "__main__": - dataset_folder = "ConvNeXT-MHC" + dataset_folder = "NetMHCIpan_dataset" # # Call train_and_evaluate_scqvae without trying to unpack return values - train_and_evaluate_scqvae( - data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_fold_0.parquet", - val_data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_val_fold_0.parquet", - input_type="latent1024", - num_embeddings=32, - embedding_dim=64, - batch_size=32, - epochs=200, - output_dir=f"data/SCQvae/{dataset_folder}", - visualize=True, - save_model=True, - init_k_means=False, - random_state=42, - test_size=0.2, - output_data="train_val_seperate", # Options: "val", "train", "train_val_seperate" - ) - m = "MLP" # Options: "MoE", "MLP", "transformer", "CNN" + # train_and_evaluate_scqvae( + # data_path=f"data/Pep2Vec/{dataset_folder}_new_subset", + # # val_data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_val_fold_0.parquet", + # input_type="latent1024", + # num_embeddings=64, + # embedding_dim=64, + # batch_size=128, + # epochs=5, + # output_dir=f"data/SCQvae/{dataset_folder}", + # visualize=True, + # save_model=True, + # init_k_means=False, + # random_state=42, + # test_size=0.2, + # output_data="train_val_seperate", # Options: "val", "train", "train_val_seperate" + # ) + m = "CNN" # Options: "MoE", "MLP", "transformer", "CNN" print(f"Running {m}") train_and_evaluate_moe( - data_path=f"data/SCQvae/{dataset_folder}/quantized_outputs_train.parquet", - val_data_path=f"data/SCQvae/{dataset_folder}/quantized_outputs_val.parquet", - # data_path="data/Pep2Vec/NetMHCpan_dataset_new_subset/pep2vec_output_fold_0.parquet", - # val_data_path="data/Pep2Vec/NetMHCpan_dataset_new_subset/pep2vec_output_val_fold_0.parquet", + # data_path=f"data/SCQvae/{dataset_folder}/quantized_outputs_train_fold0.parquet", + # val_data_path=f"data/SCQvae/{dataset_folder}/quantized_outputs_val_fold0.parquet", + data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_train_fold_0.parquet", + val_data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_val_fold_0.parquet", input_type="latent", model_type=m, - batch_size=64, - epochs=200, + batch_size=128, + epochs=5, learning_rate=1e-4, - hidden_dim=2, + hidden_dim=4, output_dir=f"data/MoE/{dataset_folder}", visualize=True, save_model=True, From f54c835583f2f1f26f61e5ca35c1506c7cc1eee3 Mon Sep 17 00:00:00 2001 From: amirreza Date: Fri, 16 May 2025 14:43:05 +0200 Subject: [PATCH 42/83] Refactor load_data function in run_pMHC_DL.py: streamline data loading for k-fold cross-validation, enhance dataset handling, and implement support for multiple input types --- utils/processing_functions.py | 86 +++++++++++++++++++++++++++++++++++ 1 file changed, 86 insertions(+) diff --git a/utils/processing_functions.py b/utils/processing_functions.py index c4ddc7bd7..0e25e07a5 100644 --- a/utils/processing_functions.py +++ b/utils/processing_functions.py @@ -1058,6 +1058,92 @@ def fetch_polypeptide_sequences(pdb_path): sequences[chain_id] = sequence return sequences +# leave out k ids, then create the first fold (train and validation) then add one ID and create fold 2 from fold 1 and added data and so on. +# the added data is sampled from the rest equal to total / k +def create_progressive_k_fold_cross_validation(df, k=5, target_col="Label", id_col="id", + random_state=42, save_to_disk=False, + output_dir=None): + """ + Creates k folds for cross-validation where each fold progressively adds IDs to training. + + Strategy: + 1. First fold leaves out k IDs for validation + 2. Each subsequent fold adds one ID to training and samples a new validation set + 3. Each fold maintains approximately equal size (total/k samples) + + Args: + df (pd.DataFrame): The input dataframe. + k (int): The number of folds. + target_col (str): The name of the column containing target labels. + id_col (str): The name of the column containing the IDs. + random_state (int): Random state for reproducibility. + save_to_disk (bool): Whether to save the folds to disk. + output_dir (str): Directory to save fold files if save_to_disk is True. + + Returns: + list: A list of tuples, where each tuple contains (train_df, val_df) for a fold. + """ + # Get unique IDs + unique_ids = df[id_col].unique() + + if len(unique_ids) < k: + raise ValueError(f"Not enough unique IDs ({len(unique_ids)}) for {k} folds") + + # Shuffle IDs + np.random.seed(random_state) + np.random.shuffle(unique_ids) + + # Calculate target size for each fold + target_fold_size = len(df) // k + + # Initialize list to store folds + folds = [] + + # Start with k IDs left out + validation_ids = unique_ids[:k] + training_ids = np.array([]) + + for fold_idx in range(k): + # For each fold, add one ID to training and get a new validation ID + if fold_idx > 0: + # Add one ID from validation to training + training_ids = np.append(training_ids, validation_ids[0]) + # Remove the first ID from validation + validation_ids = validation_ids[1:] + + # Get all data for current training and validation IDs + train_mask = df[id_col].isin(training_ids) + val_mask = df[id_col].isin([validation_ids[0]]) # Use only the first validation ID + + train_df = df[train_mask].copy() + val_df = df[val_mask].copy() + + # Add samples from remaining IDs to reach target fold size + remaining_ids = [id for id in unique_ids if id not in training_ids and id not in [validation_ids[0]]] + + if len(train_df) < target_fold_size and remaining_ids: + samples_needed = target_fold_size - len(train_df) + additional_mask = df[id_col].isin(remaining_ids) + additional_df = df[additional_mask].sample( + n=min(samples_needed, sum(additional_mask)), + random_state=random_state+fold_idx + ) + train_df = pd.concat([train_df, additional_df]) + + # Reset indices + train_df = train_df.reset_index(drop=True) + val_df = val_df.reset_index(drop=True) + + folds.append((train_df, val_df, validation_ids)) + + # Save folds to disk if requested + if save_to_disk and output_dir: + os.makedirs(output_dir, exist_ok=True) + train_df.to_parquet(f"{output_dir}/train_fold_{fold_idx}.parquet") + val_df.to_parquet(f"{output_dir}/val_fold_{fold_idx}.parquet") + + return folds + # write a function that produces 5 fold cross validation from the df, each fold must have one allele to be left out completely and produce a stratified train and validation based on the label. # take into account the subset proportion. From dda0794eba4f6629c0be4a0d8287ebabd6ca887f Mon Sep 17 00:00:00 2001 From: amirreza Date: Fri, 16 May 2025 14:43:09 +0200 Subject: [PATCH 43/83] Implement Enhanced Mixture of Experts model: add soft and hard clustering support, optimize expert routing, and streamline training and inference processes --- utils/model.py | 269 +++++++++++++++++++++++++++++++++++++++++++++++++ 1 file changed, 269 insertions(+) diff --git a/utils/model.py b/utils/model.py index fbf6d34ea..d65723cf9 100644 --- a/utils/model.py +++ b/utils/model.py @@ -1277,3 +1277,272 @@ def call(self, inputs, training=False): # predictions = model.predict(features) # print(f"Predictions shape: {predictions.shape}") # print(f"Predictions head: {predictions[:5]}") + + +# mixture_of_experts.py +""" +Mixture‑of‑Experts implementation supporting **soft** and **hard** clustering. + +* **Soft clustering** (probabilistic gates) is used **during inference** to fuse the + parameters of all experts into a *virtual* expert. +* **Hard clustering** (one‑hot gates) is used **during training**; each sample + activates exactly one expert so gradients flow only through the selected expert. + +Key ideas +--------- +1. **SparseDispatcher** routes inputs to experts and fuses outputs. It now accepts + either soft or hard gates transparently. +2. **Expert** is a light two‑layer perceptron ending in a sigmoid. +3. **MixtureOfExperts** + * consumes `inputs` **and** a *soft* clustering vector (`gates_soft`). + * converts to hard gates (`gates_hard`) with `tf.one_hot(tf.argmax(...))` when + `hard_gating=True`. + * during inference (`hard_gating=False`) the *soft* gates are used to create a + **parameter‑blended virtual expert**: every weight matrix and bias vector is + a convex combination of the corresponding parameters of the individual + experts. +4. **MoEModel** overrides `train_step` / `test_step` so that + * training → `hard_gating=True` + * inference → `hard_gating=False` + +The code is ready to run in a standard TensorFlow‑2 environment. +""" + + +class Expert(layers.Layer): + """A binary prediction expert with added complexity.""" + + def __init__(self, input_dim, hidden_dim, output_dim=1, dropout_rate=0.2): + super().__init__() + self.fc1 = layers.Dense(hidden_dim, activation='relu', input_shape=(input_dim,)) + self.dropout1 = layers.Dropout(dropout_rate) + self.fc2 = layers.Dense(hidden_dim // 2, activation='relu') + self.dropout2 = layers.Dropout(dropout_rate) + self.fc3 = layers.Dense(output_dim) + + def call(self, x, training=False): + x = self.fc1(x) + x = self.dropout1(x, training=training) + x = self.fc2(x) + x = self.dropout2(x, training=training) + x = self.fc3(x) + return tf.nn.sigmoid(x) + + +class EnhancedMixtureOfExperts(layers.Layer): + """ + Enhanced Mixture of Experts layer that uses cluster assignments. + + This implementation eliminates the need for a SparseDispatcher by: + - During training: Using hard clustering to train specific experts + - During inference: Using soft clustering to mix the experts' weights + """ + + def __init__(self, input_dim, hidden_dim, num_experts, output_dim=1, + use_hard_clustering=True, dropout_rate=0.2): + super().__init__() + self.num_experts = num_experts + self.use_hard_clustering = use_hard_clustering + self.output_dim = output_dim + + # Create n experts + self.experts = [ + Expert(input_dim, hidden_dim, output_dim, dropout_rate) + for _ in range(num_experts) + ] + + def convert_to_hard_clustering(self, soft_clusters): + """Convert soft clustering values to hard clustering (one-hot encoding)""" + # Get the index of the maximum value for each sample + hard_indices = tf.argmax(soft_clusters, axis=1) + # Convert to one-hot encoding + return tf.one_hot(hard_indices, depth=self.num_experts) + + def call(self, inputs, training=False): + # Unpack inputs + if isinstance(inputs, tuple) and len(inputs) == 2: + x, clustering = inputs + else: + raise ValueError("Inputs must include both features and clustering values") + + batch_size = tf.shape(x)[0] + + # Convert to hard clustering during training if requested + if training and self.use_hard_clustering: + clustering = self.convert_to_hard_clustering(clustering) + + # Initialize output tensor + combined_output = tf.zeros([batch_size, self.output_dim]) + + # Process each expert + for i, expert in enumerate(self.experts): + # Get the weight for this expert for each sample in the batch + expert_weights = clustering[:, i:i + 1] # Shape: [batch_size, 1] + + # Only compute outputs for samples with non-zero weights + # to save computation during training with hard clustering + if training and self.use_hard_clustering: + # Find samples assigned to this expert + assigned_indices = tf.where(expert_weights[:, 0] > 0)[:, 0] + + if tf.size(assigned_indices) > 0: + # Get assigned samples + assigned_x = tf.gather(x, assigned_indices) + + # Get expert output for assigned samples + expert_output = expert(assigned_x, training=training) + + # Use scatter_nd to place results back into full batch tensor + indices = tf.expand_dims(assigned_indices, axis=1) + updates = expert_output + combined_output += tf.scatter_nd(indices, updates, [batch_size, self.output_dim]) + else: + # During inference or when using soft clustering: + # Compute expert output for all samples + expert_output = expert(x, training=training) + + # Weight the output by the clustering values + weighted_output = expert_output * expert_weights + + # Add to combined output + combined_output += weighted_output + + return combined_output + + +class EnhancedMoEModel(tf.keras.Model): + """Complete model wrapping the Enhanced MoE layer""" + + def __init__(self, input_dim, hidden_dim, num_experts, output_dim=1, + use_hard_clustering=True, dropout_rate=0.2): + super().__init__() + self.use_hard_clustering = use_hard_clustering + self.moe_layer = EnhancedMixtureOfExperts( + input_dim, + hidden_dim, + num_experts, + output_dim=output_dim, + use_hard_clustering=use_hard_clustering, + dropout_rate=dropout_rate + ) + + def call(self, inputs, training=False): + return self.moe_layer(inputs, training=training) + + def train_step(self, data): + if isinstance(data, tuple) and len(data) == 2: + # Unpack the data + x, y = data + + # Ensure x contains both inputs and clustering values + if not (isinstance(x, tuple) and len(x) == 2): + raise ValueError("Input must be a tuple of (features, clustering)") + else: + raise ValueError("Training data must include both inputs and labels") + + # Unpack inputs + inputs, soft_cluster_vector = x + + with tf.GradientTape() as tape: + # Forward pass + predictions = self(x, training=True) + + # Compute loss + loss = self.compiled_loss(y, predictions, regularization_losses=self.losses) + + # Add expert load balancing loss if using soft clustering + if not self.use_hard_clustering: + expert_usage = tf.reduce_mean(soft_cluster_vector, axis=0) + load_balancing_loss = tf.reduce_sum(expert_usage * tf.math.log(expert_usage + 1e-10)) * 0.01 + loss += load_balancing_loss + + # Compute gradients and update weights + gradients = tape.gradient(loss, self.trainable_variables) + self.optimizer.apply_gradients(zip(gradients, self.trainable_variables)) + + # Update metrics + self.compiled_metrics.update_state(y, predictions) + + # Return metrics + results = {m.name: m.result() for m in self.metrics} + results.update({'loss': loss}) + return results + + def test_step(self, data): + if isinstance(data, tuple) and len(data) == 2: + # Unpack the data + x, y = data + + # Ensure x contains both inputs and clustering values + if not (isinstance(x, tuple) and len(x) == 2): + raise ValueError("Input must be a tuple of (features, clustering)") + else: + raise ValueError("Test data must include both inputs and labels") + + # Forward pass (always use soft clustering for inference) + original_hard_clustering = self.moe_layer.use_hard_clustering + self.moe_layer.use_hard_clustering = False + predictions = self(x, training=False) + self.moe_layer.use_hard_clustering = original_hard_clustering + + # Compute loss + loss = self.compiled_loss(y, predictions, regularization_losses=self.losses) + + # Update metrics + self.compiled_metrics.update_state(y, predictions) + + # Return metrics + results = {m.name: m.result() for m in self.metrics} + results.update({'loss': loss}) + return results + + +# Example usage: + +# Define model parameters +input_dim = 10 +hidden_dim = 64 +num_experts = 5 +output_dim = 1 + +# Create model +model = EnhancedMoEModel( + input_dim=input_dim, + hidden_dim=hidden_dim, + num_experts=num_experts, + output_dim=output_dim, + use_hard_clustering=True # Use hard clustering during training +) + +# Compile model +model.compile( + optimizer='adam', + loss='binary_crossentropy', + metrics=['accuracy'] +) + +# Generate sample data +import numpy as np + +# Sample features +X = np.random.random((100, input_dim)) + +# Sample clustering values (soft clustering, sums to 1 for each sample) +clusters = np.random.random((100, num_experts)) +clusters = clusters / clusters.sum(axis=1, keepdims=True) + +# Sample labels +y = np.random.randint(0, 2, (100, output_dim)) + +# Train model +model.fit( + x=(X, clusters), + y=y, + epochs=5, + batch_size=32 +) + +# Prediction (will use soft clustering automatically) +predictions = model.predict( + x=(X, clusters) +) From c68af8167a2928af6cf55bb0a16b65145d4d0686 Mon Sep 17 00:00:00 2001 From: amirreza Date: Mon, 26 May 2025 16:22:35 +0200 Subject: [PATCH 44/83] Add ESM dataset creation and embedding extraction scripts: implement functions for loading embeddings, normalizing allele names, and creating test sets; include visualization utilities for PCA and t-SNE analysis --- data/ESM/esmc_600m/PMGen sequences/process.py | 512 ++++++++++++++++++ run_ESM.py | 278 ++++++++++ run_netmhcpan_script.py | 2 +- run_pMHC_DL.py | 458 +++++++++------- run_pep2vec.py | 52 +- src/run_pMHC_DL_ESM.py | 337 ++++++++++++ utils/create_ESM_dataset.py | 246 +++++++++ 7 files changed, 1678 insertions(+), 207 deletions(-) create mode 100644 data/ESM/esmc_600m/PMGen sequences/process.py create mode 100644 run_ESM.py create mode 100644 src/run_pMHC_DL_ESM.py create mode 100644 utils/create_ESM_dataset.py diff --git a/data/ESM/esmc_600m/PMGen sequences/process.py b/data/ESM/esmc_600m/PMGen sequences/process.py new file mode 100644 index 000000000..e8ea838a4 --- /dev/null +++ b/data/ESM/esmc_600m/PMGen sequences/process.py @@ -0,0 +1,512 @@ +# load npz files and print the shape of the data +import numpy as np +import pandas as pd +import os + +def load_npz_files(directory): + keys = [] + embeddings = [] + sequences = [] + # load sequence from the csv file + df = pd.read_csv(os.path.join(directory, 'sequences.csv')) + for filename in os.listdir(directory): + if filename.endswith('.npz'): + print("Loading file:", filename) + file_path = os.path.join(directory, filename) + with np.load(file_path) as npz_file: + print(f"{filename}: contains {len(npz_file.files)} arrays") + for key in npz_file.files: + embedding = npz_file[key] + if embedding.shape[0] == 187 and embedding.shape[1] == 1152: + embeddings.append(embedding) + sequences.append(df[df['id'] == key]['sequence'].values[0]) + else: + print(f"Skipping {key} due to unexpected shape: {embedding.shape}") + + keys.append(key) + + return embeddings, keys, sequences + +def print_shapes(data, keys, seqs): + for arr, key, seq in zip(data, keys, seqs): + print(f"Shape of array {key}: {arr.shape} with sequence {seq}") + +def print_samples(data, keys): + for arr, key in zip(data, keys): + print(f"Sample of array {key}: {arr[:1]}") # Print first samples + +def plot_pairwise_comparison(selected_keys, keys, data, seqs): + """ + Compare sequence and embedding similarities between selected pairs of protein sequences. + + Args: + selected_keys: List of key pairs to compare (e.g., [(key1, key2), (key3, key4)]) + keys: All available keys + data: Embedding data (36, 1152) + seqs: Protein sequences + """ + import matplotlib.pyplot as plt + import numpy as np + from scipy.spatial.distance import cosine + import seaborn as sns + from Levenshtein import distance as levenshtein_distance + + for key1, key2 in selected_keys: + # Get indices of the keys in the main arrays + idx1 = keys.index(key1) + idx2 = keys.index(key2) + + # Get sequences and embeddings + seq1, seq2 = seqs[idx1], seqs[idx2] + emb1, emb2 = data[idx1], data[idx2] + + # Calculate sequence similarity + seq_distance = levenshtein_distance(seq1, seq2) + seq_similarity = 1 - (seq_distance / max(len(seq1), len(seq2))) + + # Calculate embedding similarity metrics + cosine_sim = 1 - cosine(emb1.flatten(), emb2.flatten()) + euclidean_dist = np.linalg.norm(emb1 - emb2) + + # Calculate positional differences + position_diff = np.abs(emb1 - emb2) # Shape: (36, 1152) + mean_diff_by_pos = position_diff.mean(axis=1) # Average diff across 1152 dims for each position + max_diff_by_pos = position_diff.max(axis=1) # Max diff across 1152 dims for each position + + # Calculate feature differences + feature_diff = position_diff.mean(axis=0) # Average diff across 36 positions for each feature + top_features_idx = np.argsort(feature_diff)[::-1][:20] # Top 20 most different features + + # Create visualization + fig, axs = plt.subplots(2, 2, figsize=(18, 14)) + plt.suptitle(f'Comparison: {key1} vs {key2}', fontsize=16) + + # 1. Heatmap of differences across all positions and features + im = axs[0, 0].imshow(position_diff, aspect='auto', cmap='viridis') + axs[0, 0].set_title(f'Embedding Differences (Sequence Sim: {seq_similarity:.2f}, Cosine Sim: {cosine_sim:.2f})') + axs[0, 0].set_xlabel('Feature Dimension') + axs[0, 0].set_ylabel('Sequence Position') + plt.colorbar(im, ax=axs[0, 0], label='Absolute Difference') + + # 2. Bar plot of position differences (which positions differ most) + axs[0, 1].bar(range(len(mean_diff_by_pos)), mean_diff_by_pos, alpha=0.7, label='Mean Diff') + axs[0, 1].bar(range(len(max_diff_by_pos)), max_diff_by_pos, alpha=0.5, label='Max Diff') + axs[0, 1].set_title('Differences by Position') + axs[0, 1].set_xlabel('Position in Sequence') + axs[0, 1].set_ylabel('Difference Magnitude') + axs[0, 1].legend() + + # 3. Top different features + axs[1, 0].bar(range(len(top_features_idx)), feature_diff[top_features_idx]) + axs[1, 0].set_title('Top 20 Most Different Features') + axs[1, 0].set_xlabel('Feature Rank') + axs[1, 0].set_ylabel('Mean Difference') + axs[1, 0].set_xticks(range(len(top_features_idx))) + axs[1, 0].set_xticklabels([f"{i}" for i in top_features_idx], rotation=90) + + # # 4. Correlation matrix between the two embeddings + # corr_matrix = np.corrcoef(emb1, emb2) + # sns.heatmap(corr_matrix, ax=axs[1, 1], cmap='coolwarm', vmin=-1, vmax=1) + # axs[1, 1].set_title('Correlation Between Embeddings') + # + # plt.tight_layout(rect=[0, 0, 1, 0.96]) + # plt.savefig(f'comparison_{key1}_vs_{key2}.png', dpi=300) + # print(f"Saved comparison to comparison_{key1}_vs_{key2}.png") + # + # # Print summary + # print(f"\nComparison of {key1} vs {key2}:") + # print(f" Sequence similarity: {seq_similarity:.4f}") + # print(f" Embedding cosine similarity: {cosine_sim:.4f}") + # print(f" Embedding euclidean distance: {euclidean_dist:.4f}") + # print(f" Top 5 most different positions: {np.argsort(mean_diff_by_pos)[::-1][:5]}") + # print(f" Top 5 most different features: {top_features_idx[:5]}") + + # 4. Sequence comparison visualization + ax = axs[1, 1] + ax.set_title('Sequence Comparison') + ax.axis('off') # Turn off axes + + # Find differences between sequences + differences = [] + for i, (a, b) in enumerate(zip(seq1, seq2)): + if a != b: + differences.append((i, a, b)) + + # Calculate sequence identity + seq_len = max(len(seq1), len(seq2)) + percent_identity = (seq_len - len(differences)) / seq_len * 100 + + # Show sequence statistics + ax.text(0.05, 0.95, f"Sequence length: {len(seq1)} and {len(seq2)} amino acids", fontsize=11) + ax.text(0.05, 0.9, f"Sequence identity: {percent_identity:.1f}%", fontsize=11) + ax.text(0.05, 0.85, f"Number of differences: {len(differences)}", fontsize=11) + + # Display sequence alignment based on sequence length + if len(seq1) > 80: # For longer sequences, show regions with differences + if differences: + ax.text(0.05, 0.75, "Key differences:", fontsize=11, fontweight='bold') + y_pos = 0.7 + + # Show up to 5 difference regions + for i, (pos, aa1, aa2) in enumerate(differences[:5]): + context_start = max(0, pos - 5) + context_end = min(len(seq1), pos + 6) + + # Extract regions around differences + region1 = seq1[context_start:context_end] + region2 = seq2[context_start:context_end] + + # Create marker pointing to difference + marker = " " * (pos - context_start) + "^" + + ax.text(0.05, y_pos, f"Diff {i + 1} (pos {pos + 1}):", fontsize=10) + ax.text(0.05, y_pos - 0.05, region1, fontfamily='monospace', fontsize=10) + ax.text(0.05, y_pos - 0.1, region2, fontfamily='monospace', fontsize=10) + ax.text(0.05, y_pos - 0.15, marker, fontfamily='monospace', fontsize=10) + + y_pos -= 0.2 + + if len(differences) > 5: + ax.text(0.05, y_pos, f"...and {len(differences) - 5} more differences", fontsize=10) + else: + ax.text(0.05, 0.7, "The sequences are identical.", fontsize=11) + else: + # For shorter sequences, show complete alignment + y_pos = 0.75 + ax.text(0.05, y_pos, "Sequence alignment:", fontsize=11, fontweight='bold') + y_pos -= 0.05 + + # Split into chunks of 50 for better display + chunk_size = 50 + for i in range(0, len(seq1), chunk_size): + chunk1 = seq1[i:i + chunk_size] + chunk2 = seq2[i:i + chunk_size] if i < len(seq2) else "" + + # Create marker for differences + marker = "" + for j in range(len(chunk1)): + if j < len(chunk2) and chunk1[j] != chunk2[j]: + marker += "^" + else: + marker += " " + + ax.text(0.05, y_pos, f"Pos {i + 1}:", fontsize=9) + y_pos -= 0.05 + ax.text(0.05, y_pos, chunk1, fontfamily='monospace', fontsize=10) + y_pos -= 0.05 + ax.text(0.05, y_pos, chunk2, fontfamily='monospace', fontsize=10) + y_pos -= 0.05 + ax.text(0.05, y_pos, marker, fontfamily='monospace', fontsize=10) + y_pos -= 0.05 + +def plot_3d_PCA(data, keys, seqs=None, num_samples=100): + """ + Plot 3D PCA visualization of the embeddings. + + Args: + data: List of embeddings with shape (36, 1152) + keys: List of identifiers for each embedding + seqs: Optional list of sequences for annotation + num_samples: Number of samples to plot (default: 10) + """ + import matplotlib.pyplot as plt + from mpl_toolkits.mplot3d import Axes3D + from sklearn.decomposition import PCA + import numpy as np + import random + + # Limit to num_samples if there are more samples + if len(data) > num_samples: + # Select random indices + indices = random.sample(range(len(data)), num_samples) + sampled_data = [data[i] for i in indices] + sampled_keys = [keys[i] for i in indices] + sampled_seqs = [seqs[i] for i in indices] if seqs is not None else None + else: + sampled_data = data + sampled_keys = keys + sampled_seqs = seqs + + # Convert embeddings to feature vectors + feature_vectors = [] + for embedding in sampled_data: + # Mean across features to get (36,) + feature_vectors.append(embedding.mean(axis=1)) + + feature_vectors = np.array(feature_vectors) + + # Apply PCA to reduce to 3 dimensions + pca = PCA(n_components=3) + pca_result = pca.fit_transform(feature_vectors) + + # Create 3D plot with larger size + fig = plt.figure(figsize=(16, 14)) + ax = fig.add_subplot(111, projection='3d') + + # Use a colormap with distinct colors for each sample + cmap = plt.cm.get_cmap('tab10', num_samples) + + scatter = ax.scatter( + pca_result[:, 0], + pca_result[:, 1], + pca_result[:, 2], + c=range(len(pca_result)), # Each sample gets its own color + cmap=cmap, + s=50, # Smaller dot size + alpha=0.8 + ) + + # Add annotations for all points + for i, key in enumerate(sampled_keys): + ax.text(pca_result[i, 0], pca_result[i, 1], pca_result[i, 2], key, fontsize=9) + + # Set labels and title + ax.set_xlabel(f'PC1 ({pca.explained_variance_ratio_[0]:.2%} variance)') + ax.set_ylabel(f'PC2 ({pca.explained_variance_ratio_[1]:.2%} variance)') + ax.set_zlabel(f'PC3 ({pca.explained_variance_ratio_[2]:.2%} variance)') + ax.set_title(f'3D PCA of Protein Embeddings ({num_samples} Samples)', fontsize=16) + + # Add a color bar with sample IDs + cbar = plt.colorbar(scatter, ax=ax, pad=0.1, ticks=range(len(sampled_keys))) + cbar.set_label('Sample ID') + cbar.ax.set_yticklabels(sampled_keys) + + # Add total explained variance as text + total_var = sum(pca.explained_variance_ratio_[:3]) + fig.text(0.5, 0.01, f'Total variance explained: {total_var:.2%}', ha='center', fontsize=12) + + plt.tight_layout() + plt.savefig('3d_pca_embeddings_10samples.png', dpi=300) + print(f"Saved 3D PCA visualization to 3d_pca_embeddings_10samples.png") + + # Create interactive plot if plotly is available + try: + import plotly.express as px + import pandas as pd + + df = pd.DataFrame({ + 'PC1': pca_result[:, 0], + 'PC2': pca_result[:, 1], + 'PC3': pca_result[:, 2], + 'Sample': sampled_keys + }) + + if sampled_seqs is not None: + df['Sequence'] = sampled_seqs + + fig = px.scatter_3d( + df, x='PC1', y='PC2', z='PC3', + color='Sample', # Each sample gets unique color + hover_data=['Sample'], + title='Interactive 3D PCA of Protein Embeddings (10 Samples)', + labels={ + 'PC1': f'PC1 ({pca.explained_variance_ratio_[0]:.2%})', + 'PC2': f'PC2 ({pca.explained_variance_ratio_[1]:.2%})', + 'PC3': f'PC3 ({pca.explained_variance_ratio_[2]:.2%})' + } + ) + fig.write_html('3d_pca_interactive_10samples.html') + print(f"Saved interactive 3D PCA visualization to 3d_pca_interactive_10samples.html") + except ImportError: + print("Plotly not available. Only static plot created.") + + plt.show() + return pca_result, sampled_keys + + +def plot_2d_TSNE(data, keys, seqs=None, num_samples=100, perplexity=30, learning_rate=200): + """ + Plot 2D t-SNE visualization of the embeddings. + + Args: + data: List of embeddings with shape (36, 1152) + keys: List of identifiers for each embedding + seqs: Optional list of sequences for annotation + num_samples: Number of samples to plot (default: 100) + perplexity: t-SNE perplexity parameter (default: 30) + learning_rate: t-SNE learning rate (default: 200) + """ + import matplotlib.pyplot as plt + from sklearn.manifold import TSNE + import numpy as np + import random + + # Limit to num_samples if there are more samples + if len(data) > num_samples: + # Select random indices + indices = random.sample(range(len(data)), num_samples) + sampled_data = [data[i] for i in indices] + sampled_keys = [keys[i] for i in indices] + sampled_seqs = [seqs[i] for i in indices] if seqs is not None else None + else: + sampled_data = data + sampled_keys = keys + sampled_seqs = seqs + + # Convert embeddings to feature vectors + feature_vectors = [] + for embedding in sampled_data: + # Mean across features to get (36,) + feature_vectors.append(embedding.mean(axis=1)) + + feature_vectors = np.array(feature_vectors) + + # Apply t-SNE to reduce to 2 dimensions + tsne = TSNE(n_components=2, perplexity=min(perplexity, len(feature_vectors)-1), + learning_rate=learning_rate, random_state=42) + tsne_result = tsne.fit_transform(feature_vectors) + + # Create 2D plot with larger size + fig = plt.figure(figsize=(16, 14)) + ax = fig.add_subplot(111) + + # Use a colormap with distinct colors for each sample + cmap = plt.cm.get_cmap('tab10', num_samples) + + scatter = ax.scatter( + tsne_result[:, 0], + tsne_result[:, 1], + c=range(len(tsne_result)), # Each sample gets its own color + cmap=cmap, + s=100, # Larger dot size for 2D plot + alpha=0.8 + ) + + # Add annotations for all points + for i, key in enumerate(sampled_keys): + ax.text(tsne_result[i, 0], tsne_result[i, 1], key, fontsize=9) + + # Set labels and title + ax.set_xlabel('t-SNE dimension 1') + ax.set_ylabel('t-SNE dimension 2') + ax.set_title(f'2D t-SNE of Protein Embeddings ({num_samples} Samples)', fontsize=16) + + # Add a color bar with sample IDs + cbar = plt.colorbar(scatter, ax=ax, pad=0.1, ticks=range(len(sampled_keys))) + cbar.set_label('Sample ID') + cbar.ax.set_yticklabels(sampled_keys) + + plt.tight_layout() + plt.savefig('2d_tsne_embeddings.png', dpi=300) + print(f"Saved 2D t-SNE visualization to 2d_tsne_embeddings.png") + + # Create interactive plot if plotly is available + try: + import plotly.express as px + import pandas as pd + + df = pd.DataFrame({ + 'Dimension 1': tsne_result[:, 0], + 'Dimension 2': tsne_result[:, 1], + 'Sample': sampled_keys + }) + + if sampled_seqs is not None: + df['Sequence'] = sampled_seqs + + fig = px.scatter( + df, x='Dimension 1', y='Dimension 2', + color='Sample', # Each sample gets unique color + hover_data=['Sample'], + title=f'Interactive 2D t-SNE of Protein Embeddings ({num_samples} Samples)', + ) + fig.write_html('2d_tsne_interactive.html') + print(f"Saved interactive 2D t-SNE visualization to 2d_tsne_interactive.html") + except ImportError: + print("Plotly not available. Only static plot created.") + + plt.show() + return tsne_result, sampled_keys + + +# def plot_(data, keys): +# import matplotlib.pyplot as plt +# from sklearn.decomposition import PCA +# from sklearn.manifold import TSNE +# from sklearn.cluster import KMeans +# import seaborn as sns +# import numpy as np +# from scipy.spatial.distance import pdist, squareform +# +# for arr, key in zip(data, keys): +# try: +# if len(arr.shape) != 2: +# print(f"Skipping {key} as it's not 2D") +# continue +# +# n_samples, n_features = arr.shape +# print(f"Visualizing {key}: {n_samples} samples × {n_features} features") +# +# fig = plt.figure(figsize=(18, 15)) +# +# # 1. PCA visualization +# ax1 = plt.subplot(2, 2, 1) +# pca = PCA(n_components=2) +# pca_result = pca.fit_transform(arr) +# +# # Apply KMeans to color points by cluster +# n_clusters = min(5, n_samples) +# kmeans = KMeans(n_clusters=n_clusters, random_state=42) +# clusters = kmeans.fit_predict(arr) +# +# scatter = ax1.scatter(pca_result[:, 0], pca_result[:, 1], +# c=clusters, cmap='viridis', alpha=0.8, s=100) +# ax1.set_title(f'PCA Projection') +# ax1.set_xlabel(f'PC1 ({pca.explained_variance_ratio_[0]:.2%} variance)') +# ax1.set_ylabel(f'PC2 ({pca.explained_variance_ratio_[1]:.2%} variance)') +# plt.colorbar(scatter, ax=ax1, label='Cluster') +# +# # 2. t-SNE visualization +# ax2 = plt.subplot(2, 2, 2) +# perplexity = min(30, max(5, n_samples-1)) +# tsne = TSNE(n_components=2, random_state=42, perplexity=perplexity) +# tsne_result = tsne.fit_transform(arr) +# +# scatter2 = ax2.scatter(tsne_result[:, 0], tsne_result[:, 1], +# c=clusters, cmap='viridis', alpha=0.8, s=100) +# ax2.set_title(f't-SNE Projection') +# plt.colorbar(scatter2, ax=ax2, label='Cluster') +# +# # 3. Sequence similarity heatmap +# ax3 = plt.subplot(2, 2, 3) +# distances = squareform(pdist(arr, metric='euclidean')) +# sns.heatmap(distances, cmap='coolwarm', ax=ax3) +# ax3.set_title('Pairwise Distance Matrix') +# ax3.set_xlabel('Sequence Index') +# ax3.set_ylabel('Sequence Index') +# +# # 4. Feature variance visualization +# ax4 = plt.subplot(2, 2, 4) +# feature_variance = np.var(arr, axis=0) +# sorted_idx = np.argsort(feature_variance)[::-1] +# top_k = 50 # Show top 50 most variable features +# ax4.bar(range(top_k), feature_variance[sorted_idx[:top_k]]) +# ax4.set_title('Top Variable Features') +# ax4.set_xlabel('Feature Rank') +# ax4.set_ylabel('Variance') +# +# plt.suptitle(f'Visualization of {key} Embeddings', fontsize=16) +# plt.tight_layout(rect=[0, 0, 1, 0.96]) +# +# plt.savefig(f'visualization_{key}.png', dpi=300) +# print(f"Saved visualization to visualization_{key}.png") +# plt.close() +# +# except Exception as e: +# print(f"Error visualizing {key}: {str(e)}") + +def main(): + current_path = os.path.dirname(os.path.abspath(__file__)) + directory = current_path + data, keys, seqs = load_npz_files(directory) + print_shapes(data, keys, seqs) + ## print_samples(data, keys) + ## plot_(data, keys) + # selected_keys = [('HLA-B3813', 'HLA-B3814'), ('HLA-B38:01', 'HLA-B38:05')] # second sample has same pseudoseq + selected_keys = [('HLA-B13020103', 'HLA-B13020105')] + plot_pairwise_comparison(selected_keys, keys, data, seqs) + plot_3d_PCA(data, keys, seqs) + plot_2d_TSNE(data, keys, seqs) + +if __name__ == "__main__": + main() \ No newline at end of file diff --git a/run_ESM.py b/run_ESM.py new file mode 100644 index 000000000..a2832c43e --- /dev/null +++ b/run_ESM.py @@ -0,0 +1,278 @@ +#!/usr/bin/env python +""" +requires python3.10+ +esm_embed.py +============ + +Generate protein embeddings with ESM-C or any other EvolutionaryScale/Meta +protein language model. + +Examples +-------- +# 1. Local ESM-C-300M on GPU 0, output NPZ +python esm_embed.py --input proteins.fa --model esmc_300m \ + --device cuda:0 --outfile embeddings.npz + +# 2. Remote ESM-3-large (98 B) via Forge API +export ESM_API_TOKEN="hf_xxxxxxxxxxxxxxxxxx" +python esm_embed.py --input proteins.fa --model esm3-98b-2024-08 \ + --remote --outfile embeds.parquet +""" +from __future__ import annotations +import argparse, os, sys, json, time, itertools, pathlib, warnings +from typing import List, Tuple, Dict, Iterable +from esm.sdk.api import ESMProtein, LogitsConfig + +import torch +import numpy as np +import pandas as pd +import tqdm +import csv + +############################################################################### +# --------------------------- I/O utilities --------------------------------- +############################################################################### +def read_dat(path: str) -> List[Tuple[str, str]]: + """Read tab-separated file: first col is id, second is sequence.""" + seqs = [] + with open(path, "r") as f: + for line in f: + line = line.strip() + if "\t" in line: + line = line.split("\t", 1) + elif " " in line: + line = line.split(" ") + else: + line = line.split(maxsplit=1) + if not line or len(line) < 2: + print(line) + continue + + if len(line) == 2: + seqs.append((line[0], line[1])) + + return seqs + + +def read_csv(path: str = [0, 1]) -> List[Tuple[str, ...]]: + seqs: List[Tuple[str, ...]] = [] + selected_cols = ["simple_allele", "sequence", "mhc_types"] + file = pd.read_csv(path, sep=",", usecols=selected_cols) + file = file[file["mhc_types"] == 1] + print(file.columns) + # convert simple allele, remove * and : to mtach with netmhcpan + file[selected_cols[0]] = file[selected_cols[0]].str.replace("*", "") + file[selected_cols[0]] = file[selected_cols[0]].str.replace(":", "") + # return as list of tuples + for index, row in file.iterrows(): + seqs.append((row[selected_cols[0]], row[selected_cols[1]])) + return seqs + +############################################################################### +# ------------- Local model loader (ESM-C, ESM-2, ESM3-open) ---------------- +############################################################################### +def load_local_model(model_name: str, device: str): + """ + Return (model, to_tensor_fn) for **new** ESM-C / ESM-3 + or (model, batch_converter_fn) for **legacy** ESM-2. + """ + try: # new-style ESM-C + if model_name.startswith("esmc"): + from esm.models.esmc import ESMC + from esm.sdk.api import ESMProtein, LogitsConfig + model = ESMC.from_pretrained(model_name).to(device) + def embed_one(seq: str): + protein = ESMProtein(sequence=seq) + t = model.encode(protein) + out = model.logits(t, LogitsConfig(sequence=True, + return_embeddings=True)) + return out.embeddings.mean(0).cpu().numpy() + return embed_one + # new-style ESM-3 open weight + if model_name.startswith("esm3"): + from esm.models.esm3 import ESM3 + from esm.sdk.api import ESMProtein, LogitsConfig + model = ESM3.from_pretrained(model_name).to(device) + def embed_one(seq: str): + protein = ESMProtein(sequence=seq) + t = model.encode(protein) + out = model.logits(t, LogitsConfig(sequence=True, + return_embeddings=True)) + return out.embeddings.mean(0).cpu().numpy() + return embed_one + except ImportError: + pass # will try legacy route below + + # ---------- legacy facebookresearch/esm (ESM-1/2) ---------- + try: + from esm import pretrained + create = getattr(pretrained, model_name, + pretrained.load_model_and_alphabet) + model, alphabet = create(model_name) if callable(create) else create() + model.eval().to(device) + converter = alphabet.get_batch_converter() + def embed_one(seq: str): + _, _, toks = converter([("x", seq)]) + with torch.inference_mode(): + rep = model(toks.to(device), + repr_layers=[model.num_layers])["representations"] + return rep[model.num_layers][0, 1:len(seq)+1].mean(0).cpu().numpy() + return embed_one + except Exception as e: + raise RuntimeError(f"Don’t know how to load {model_name}: {e}") + +# --------------------------------------------------------------------- # +# Remote (Forge / AWS) wrapper +# --------------------------------------------------------------------- # +def load_remote_client(model_name: str, token: str): + import esm + client = esm.sdk.client(model_name, token=token) + from esm.sdk.api import ESMProtein, LogitsConfig + def embed_one(seq: str): + protein = ESMProtein(sequence=seq) + t = client.encode(protein) + out = client.logits(t, LogitsConfig(sequence=True, + return_embeddings=True)) + return out.embeddings.mean(0) + return embed_one + +############################################################################### +# -------------------- Embedding extraction pipeline ------------------------ +############################################################################### +# @torch.inference_mode() +# def embed_local( +# model, +# batch_converter, +# sequences: List[Tuple[str, str]], +# batch_size: int = 8, +# device: str = "cpu", +# pooling: str = "mean", +# ) -> Dict[str, np.ndarray]: +# """ +# Run local model and return {id: embedding(ndarray)} dict. +# Pooling: "mean" (default) or "cls". +# """ +# embeds = {} +# for i in range(0, len(sequences), batch_size): +# sub = sequences[i : i + batch_size] +# labels, strs, toks = batch_converter(sub) +# toks = toks.to(device) +# reps = model(toks, repr_layers=[model.num_layers])["representations"][ +# model.num_layers +# ] # (B, L, D) +# for label, tok, rep in zip(labels, toks, reps): +# if pooling == "mean": +# mask = tok != model.alphabet.padding_idx +# embed = rep[mask].mean(0) +# else: # CLS – first token after padding_tok +# embed = rep[0] +# embeds[label] = embed.cpu().numpy() +# return embeds + + +def embed_remote( + client, + sequences: List[Tuple[str, str]], + batch_size: int = 16, + pooling: str = "mean", +) -> Dict[str, np.ndarray]: + """ + Use cloud client; supports .embed() (ESM-C) and .generate_embeddings() (ESM-3). + """ + embeds = {} + for i in range(0, len(sequences), batch_size): + sub = sequences[i : i + batch_size] + ids, seqs = zip(*sub) + if hasattr(client, "embed"): + out = client.embed(seqs, pooling) + else: + out = client.generate_embeddings(seqs, pooling) + embeds.update({idx: emb for idx, emb in zip(ids, out)}) + return embeds + + +############################################################################### +# -------------------------- Main CLI handler ------------------------------ +############################################################################### +def main(**local_args): + parser = argparse.ArgumentParser(description="ESM embedding generator") + + if local_args: + args = parser.parse_args([]) + for k, v in local_args.items(): + setattr(args, k, v) + else: + parser.add_argument("--input", required=True, help="dat file") + parser.add_argument("--model", default="esmc_300m", help="Model name/id") + parser.add_argument("--outfile", required=True, help="Output .npz or .parquet") + parser.add_argument("--batch_size", type=int, default=8) + parser.add_argument("--device", default="cuda:0" if torch.cuda.is_available() else "cpu") + parser.add_argument("--pooling", choices=["mean", "cls"], default="mean") + parser.add_argument("--remote", action="store_true", help="Use cloud API") + parser.add_argument("--api_token", default=os.getenv("ESM_API_TOKEN"), help="Forge/NIM token") + args = parser.parse_args() + + seqs = None + if args.input.endswith(".csv"): + seqs = read_csv(args.input) + elif args.input.endswith(".dat"): + seqs = read_dat(args.input) + if not seqs: + sys.exit("No sequences found!") + + if args.remote: + if args.api_token is None: + sys.exit("Provide --api_token or set ESM_API_TOKEN") + client = load_remote_client(args.model, args.api_token) + embeddings = embed_remote(client, seqs, args.batch_size, args.pooling) + print("embeddings with", args.model) + sequences = {seq_id: seq for seq_id, seq in seqs} + else: + embed_one = load_local_model(args.model, args.device) + print("embeddings with", args.model) + # print len of sequences + print(f"Number of sequences: {len(seqs)}") + # print first 5 sequences + print("First 5 sequences:", seqs[:5]) + embeddings = {} + for seq_id, seq in tqdm.tqdm(seqs, desc="Embedding sequences"): + embeddings[seq_id] = embed_one(seq) + sequences = {seq_id: seq for seq_id, seq in seqs} + + + # ------------------ save ------------------ + out_path = pathlib.Path(args.outfile) + if out_path.suffix == ".npz": + np.savez_compressed(out_path, **embeddings) + # create a .csv file and save the sequences + with open(out_path.with_suffix(".csv"), "w", newline="") as f: + writer = csv.writer(f) + writer.writerow(["id", "sequence"]) + for seq_id, seq in sequences.items(): + writer.writerow([seq_id, seq]) + elif out_path.suffix == ".parquet": + df = pd.DataFrame( + [(k, v.astype(np.float32)) for k, v in embeddings.items()], + columns=["id", "embedding"], + ) + df.to_parquet(out_path, index=False) + else: + sys.exit("outfile must end with .npz or .parquet") + + print(f"[✓] Saved embeddings for {len(embeddings)} sequences to {out_path}") + + +if __name__ == "__main__": + # example run + model = "esmc_600m" # "esm3-98b-2024-08" "esm3_sm_open_v1", "esm3-open" + # dat_path = "data/NetMHCpan_dataset/NetMHCpan_train/MHC_pseudo.dat" + dat_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/pseudosequence.2016.all.X.dat" + # dat_path = "data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv" + out_path = "data/ESM/mhc2_encodings.npz" + remote = False + device = "cuda:0" if torch.cuda.is_available() else "cpu" + batch_size = 1 + pooling = "mean" + # run the script + main(input=dat_path, model=model, outfile=out_path, remote=remote, + device=device, batch_size=batch_size, pooling=pooling) diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py index dd388edc4..4f33c3016 100644 --- a/run_netmhcpan_script.py +++ b/run_netmhcpan_script.py @@ -718,7 +718,7 @@ def combine_datasets_(results_dir, include_dropped=False): def run_(arg1, arg2): # mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/" - mhcI_path = "data/NetMHCpan_dataset/NetMHCpan_train/" + # mhcI_path = "data/NetMHCpan_dataset/NetMHCpan_train/" # tmp_path = "data/NetMHCpan_dataset/tmp/" tmp_path = "data/NetMHCpan_dataset/tmp_I/" results_dir = "data/NetMHCpan_dataset/results_I/" diff --git a/run_pMHC_DL.py b/run_pMHC_DL.py index a36aa0591..cace4349c 100644 --- a/run_pMHC_DL.py +++ b/run_pMHC_DL.py @@ -1,5 +1,7 @@ import json import os +import uuid + import tensorflow as tf import numpy as np import pandas as pd @@ -936,7 +938,6 @@ def train_and_evaluate_scqvae( save_model=True, init_k_means=False, random_state=42, - test_size=0.2, output_data="train_val_seperate", # Options: "val", "train", "train_val_seperate" **kwargs ): @@ -1120,106 +1121,143 @@ def create_dataset(X, y=None, batch_size=32, is_training=True): # return X_train, X_test, X_val, y_train, y_test, y_val, seq_length_with_idx def load_data(data_path, input_type='latent1024'): - """ Load training and validation folds along with test datasets. - Args: - data_path (str): Path to the directory containing fold data - input_type (str): Type of input data to extract ('latent1024', 'attention51', etc.) - - Returns: - tuple: (folds, test1, test2) where: - - folds is a list of (X_train, y_train, X_val, y_val) tuples for each fold - - test1 is a tuple of (X_test1, y_test1) for stratified test data - - test2 is a tuple of (X_test2, y_test2) for single unique allele test data - """ - print(f"Loading data from {data_path}") - - # Initialize containers - folds = [] - test1 = None - test2 = None - seq_length = 0 - - # Load all available folds - fold_index = 0 - while True: - train_path = os.path.join(data_path, f"pep2vec_output_train_fold_{fold_index}.parquet") - val_path = os.path.join(data_path, f"pep2vec_output_val_fold_{fold_index}.parquet") - - if not (os.path.exists(train_path) and os.path.exists(val_path)): - break - - # Load train and validation data for this fold - train_df = pd.read_parquet(train_path) - val_df = pd.read_parquet(val_path) - - # Process features based on input_type - if input_type == 'latent1024': - train_features = [col for col in train_df.columns if 'latent' in col] - val_features = [col for col in val_df.columns if 'latent' in col] - seq_length = len(train_features) - - if not train_features or not val_features: - raise ValueError(f"No latent features found in fold {fold_index}") - - X_train = train_df[train_features].values - X_val = val_df[val_features].values - - elif input_type == 'attention51': - train_features = [col for col in train_df.columns if 'attn_' in col] - val_features = [col for col in val_df.columns if 'attn_' in col] - seq_length = len(train_features) - - if not train_features or not val_features: - raise ValueError(f"No attention features found in fold {fold_index}") - - X_train = train_df[train_features].values - X_val = val_df[val_features].values - - elif input_type == 'pMHC-sequence': - # Handle sequence data - placeholder for implementation - raise NotImplementedError("pMHC-sequence input type not yet implemented") - else: - raise ValueError(f"Unknown input_type: {input_type}") - - # Extract labels if available - y_train = train_df['binding_label'].values if 'binding_label' in train_df.columns else None - y_val = val_df['binding_label'].values if 'binding_label' in val_df.columns else None - - # Append fold data - folds.append((X_train, y_train, X_val, y_val)) - fold_index += 1 - - print(f"Loaded {len(folds)} folds") - - # Load test1 (stratified) dataset - test1_path = os.path.join(data_path, "test1_stratified.csv") - if os.path.exists(test1_path): - test1_df = pd.read_csv(test1_path) - - if input_type == 'latent1024': - test1_features = [col for col in test1_df.columns if 'latent' in col] - if test1_features: - X_test1 = test1_df[test1_features].values - y_test1 = test1_df['binding_label'].values if 'binding_label' in test1_df.columns else None - test1 = (X_test1, y_test1) - print(f"Loaded test1 dataset: {X_test1.shape}") - - # Load test2 (single unique allele) dataset - test2_path = os.path.join(data_path, "test2_single_unique_allele.csv") - if os.path.exists(test2_path): - test2_df = pd.read_csv(test2_path) - - if input_type == 'latent1024': - test2_features = [col for col in test2_df.columns if 'latent' in col] - if test2_features: - X_test2 = test2_df[test2_features].values - y_test2 = test2_df['binding_label'].values if 'binding_label' in test2_df.columns else None - test2 = (X_test2, y_test2) - print(f"Loaded test2 dataset: {X_test2.shape}") - - seq_length_with_idx = seq_length + """ Load training and validation folds along with test datasets. + Args: + data_path (str): Path to the directory containing fold data + input_type (str): Type of input data to extract ('latent1024', 'attention51', etc.) - return folds, test1, test2, seq_length_with_idx + Returns: + tuple: (folds, test1, test2, seq_length_with_idx) + """ + print(f"[load_data] Loading data from {data_path}") + + # Initialize containers + folds = [] + seq_length = 0 + + # Load all available folds + fold_index = 0 + while True: + train_path = os.path.join(data_path, f"pep2vec_output_train_fold_{fold_index}.parquet") + val_path = os.path.join(data_path, f"pep2vec_output_val_fold_{fold_index}.parquet") + + print(f"[load_data] Checking for fold {fold_index}:") + print(f" train_path: {train_path} exists: {os.path.exists(train_path)}") + print(f" val_path: {val_path} exists: {os.path.exists(val_path)}") + + if not (os.path.exists(train_path) and os.path.exists(val_path)): + print(f"[load_data] No more folds found at index {fold_index}.") + break + + # Load train and validation data for this fold + train_df = pd.read_parquet(train_path) + val_df = pd.read_parquet(val_path) + print(f"[load_data] Fold {fold_index} train_df shape: {train_df.shape}, columns: {list(train_df.columns)}") + print(f"[load_data] Fold {fold_index} val_df shape: {val_df.shape}, columns: {list(val_df.columns)}") + + num_rows_train = len(train_df) + num_rows_val = len(val_df) + # drop rows with NaN binding_label + train_df = train_df.dropna(subset=['binding_label']) + val_df = val_df.dropna(subset=['binding_label']) + print(f"Number of dropped rows in train_df: {num_rows_train - len(train_df)}") + print(f"Number of dropped rows in val_df: {num_rows_val - len(val_df)}") + + # Process features based on input_type + if input_type == 'latent1024': + train_features = [col for col in train_df.columns if 'latent' in col] + val_features = [col for col in val_df.columns if 'latent' in col] + + print(f"[load_data] Fold {fold_index} latent features: {train_features}") + if not train_features or not val_features: + raise ValueError(f"No latent features found in fold {fold_index}") + + X_train = train_df[train_features].values + X_val = val_df[val_features].values + seq_length = len(train_features) + + elif input_type == 'attention51': + train_features = [col for col in train_df.columns if 'attn_' in col] + val_features = [col for col in val_df.columns if 'attn_' in col] + + print(f"[load_data] Fold {fold_index} attention features: {train_features}") + if not train_features or not val_features: + raise ValueError(f"No attention features found in fold {fold_index}") + + X_train = train_df[train_features].values + X_val = val_df[val_features].values + seq_length = len(train_features) + + elif input_type == 'pMHC-sequence': + print(f"[load_data] Fold {fold_index} pMHC-sequence not implemented") + raise NotImplementedError("pMHC-sequence input type not yet implemented") + else: + raise ValueError(f"Unknown input_type: {input_type}") + + print(f"[load_data] Fold {fold_index} X_train shape: {X_train.shape}, X_val shape: {X_val.shape}") + + # Check for idx column + print(f"[load_data] Fold {fold_index} train_df has 'idx': {'idx' in train_df.columns}") + print(f"[load_data] Fold {fold_index} val_df has 'idx': {'idx' in val_df.columns}") + + # Extract labels if available + y_train = train_df['binding_label'].values if 'binding_label' in train_df.columns else None + y_val = val_df['binding_label'].values if 'binding_label' in val_df.columns else None + + # Append fold data + folds.append((X_train, y_train, X_val, y_val)) + fold_index += 1 + + print(f"[load_data] Loaded {len(folds)} folds") + + X_test1, y_test1 = None, None + X_test2, y_test2 = None, None + + # Load test1 (stratified) dataset + test1_path = os.path.join(data_path, "pep2vec_output_test1_stratified.parquet") + print(f"[load_data] Checking for test1: {test1_path} exists: {os.path.exists(test1_path)}") + if os.path.exists(test1_path): + test1_df = pd.read_parquet(test1_path) + print(f"[load_data] test1_df shape: {test1_df.shape}, columns: {list(test1_df.columns)}") + + if input_type == 'latent1024': + latent_cols = [col for col in test1_df.columns if 'latent' in col] + test1_df['idx_feature'] = [int(uuid.uuid4().int) % (2 ** 31 - 1) for _ in range(len(test1_df))] + if 'binding_label' in test1_df.columns: + y_test1 = test1_df['binding_label'].values + select_cols = ['idx_feature'] + latent_cols + else: + select_cols = ['idx_feature'] + latent_cols + print(f"[load_data] test1 selected columns: {select_cols}") + if latent_cols: + X_test1 = test1_df[select_cols].values + print(f"[load_data] Loaded test1 dataset: {X_test1.shape}") + print(f"[load_data] test1_df has 'idx_feature': {'idx_feature' in test1_df.columns}") + + # Load test2 (single unique allele) dataset + test2_path = os.path.join(data_path, "pep2vec_output_test2_single_unique_allele.parquet") + print(f"[load_data] Checking for test2: {test2_path} exists: {os.path.exists(test2_path)}") + if os.path.exists(test2_path): + test2_df = pd.read_parquet(test2_path) + print(f"[load_data] test2_df shape: {test2_df.shape}, columns: {list(test2_df.columns)}") + + if input_type == 'latent1024': + latent_cols = [col for col in test2_df.columns if 'latent' in col] + test2_df['idx_feature'] = [int(uuid.uuid4().int) % (2 ** 31 - 1) for _ in range(len(test2_df))] + if 'binding_label' in test2_df.columns: + y_test2 = test2_df['binding_label'].values + select_cols = ['idx_feature'] + latent_cols + else: + select_cols = ['idx_feature'] + latent_cols + print(f"[load_data] test2 selected columns: {select_cols}") + if latent_cols: + X_test2 = test2_df[select_cols].values + print(f"[load_data] Loaded test2 dataset: {X_test2.shape}") + print(f"[load_data] test2_df has 'idx_feature': {'idx_feature' in test2_df.columns}") + + print(f"[load_data] seq_length: {seq_length}") + + return folds, X_test1, y_test1, X_test2, y_test2, seq_length # def load_data_hash(data_path, val_data_path=None, test_size=0.2, random_state=42, input_type='latent1024', cache=True): @@ -1698,7 +1736,6 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None): def process_and_save(dataset: tf.data.Dataset, split_name: str, model: tf.keras.Model, - original_labels: np.ndarray, output_dir: str, num_embeddings: int): """ @@ -1708,18 +1745,22 @@ def process_and_save(dataset: tf.data.Dataset, quantized_latents = [] cluster_indices_soft = [] cluster_indices_hard = [] + labels = [] # Extract latent codes for every batch - for batch in dataset: + for batch_X, batch_y in dataset: Zq, out_P_proj, _, _ = model.encode_(batch) quantized_latents.append(Zq.numpy()) cluster_indices_soft.append(out_P_proj.numpy()) cluster_indices_hard.append(tf.argmax(out_P_proj, axis=-1).numpy()) + labels.append(batch_y.numpy()) + # Concatenate across batches quantized_latent = np.concatenate(quantized_latents, axis=0) soft_probs = np.concatenate(cluster_indices_soft, axis=0) hard_assign = np.concatenate(cluster_indices_hard, axis=0) + labels = np.concatenate(labels, axis=0) # Build DataFrame records = [] @@ -1735,9 +1776,13 @@ def process_and_save(dataset: tf.data.Dataset, rec['hard_cluster'] = int(hard_assign[i]) # binding label if available - if i < len(original_labels): - lbl = original_labels[i] - rec['binding_label'] = float(lbl[0] if hasattr(lbl, 'shape') and lbl.shape else lbl) + if i < len(labels): + lbl = labels[i] + # Handle scalar, 0-dim, or 1-dim arrays + if isinstance(lbl, (np.ndarray, list)) and np.asarray(lbl).size > 0: + rec['binding_label'] = float(np.asarray(lbl).flatten()[0]) + else: + rec['binding_label'] = float(lbl) else: rec['binding_label'] = np.nan records.append(rec) @@ -1768,12 +1813,40 @@ def remove_y(dataset): """Remove the last column (y) from the feature tensor.""" return dataset.map(lambda x, y: x) + def plot_PCA(zq, y, num_embeddings, save_path=None): + """Plot PCA of the quantized latents.""" + pca = PCA(n_components=2) + # print the shape of zq + print(f"zq shape: {zq.shape}") + # reshape from B, 1, N to B, N + if len(zq.shape) == 3 and zq.shape[1] == 1: + zq = zq.reshape(zq.shape[0], zq.shape[2]) + zq_2d = pca.fit_transform(zq) + + plt.figure(figsize=(10, 8)) + scatter = plt.scatter(zq_2d[:, 0], zq_2d[:, 1], c=y, cmap='viridis', alpha=0.5) + plt.colorbar(scatter, label='Binding Label') + plt.title(f'PCA of Quantized Latents (num_embeddings={num_embeddings})') + plt.xlabel('PCA Component 1') + plt.ylabel('PCA Component 2') + if save_path: + plt.savefig(save_path) + if visualize: + plt.show() + else: + plt.close() + # ======================= End of Helper Functions ======================= # --- Main Pipeline for Folds --- print("--- Main Pipeline (Folds) ---") print("Loading/Generating Training Data...") - folds, test1, test2, seq_length = load_data(data_path, input_type=input_type) + folds, X_test1, y_test1, X_test2, y_test2, seq_length = load_data(data_path, input_type=input_type) + + print(f"Folds shape: {[f[0].shape for f in folds]}") + print(f"X_test1 shape: {X_test1.shape if X_test1 is not None else 'None'}") + print(f"X_test2 shape: {X_test2.shape if X_test2 is not None else 'None'}") + print(f"Sequence length: {seq_length}") for fold_idx, (X_train, y_train, X_val, y_val) in enumerate(folds): if fold_idx == 0: # only for the first fold # TODO: remove this @@ -1801,22 +1874,13 @@ def remove_y(dataset): # Create datasets print("Creating TensorFlow Datasets...") - train_dataset_y = create_dataset(X_train, y_train, batch_size=batch_size, is_training=True) - val_dataset_y = create_dataset(X_val, y_val, batch_size=batch_size, is_training=False) + train_dataset = create_dataset(X_train, y_train, batch_size=batch_size, is_training=True) + val_dataset = create_dataset(X_val, y_val, batch_size=batch_size, is_training=False) print("Datasets created.") - # drop IDs - train_dataset = train_dataset_y.apply(remove_id) - val_dataset = val_dataset_y.apply(remove_id) - seq_length_fold = seq_length - 1 # Remove the index feature - - # remove labels - train_dataset = train_dataset.apply(remove_y) - val_dataset = val_dataset.apply(remove_y) - # --- Model Instantiation --- print("Building the SCQ1DAutoEncoder model...") - input_shape = (seq_length_fold,) + input_shape = (seq_length,) model = SCQ1DAutoEncoder( input_dim=input_shape, num_embeddings=num_embeddings, @@ -1824,14 +1888,12 @@ def remove_y(dataset): commitment_beta=commitment_beta, scq_params={ 'lambda_reg': 1.0, - 'discrete_loss': True, + 'discrete_loss': False, 'reset_dead_codes': True, 'usage_threshold': 1e-4, 'reset_interval': 5 }, - initial_codebook=initial_codebook, - num_classes=1, - cluster_lambda=10, + cluster_lambda=1 ) print("Model built.") @@ -1840,22 +1902,31 @@ def remove_y(dataset): model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate)) print("Model compiled.") - # Determine minority class count + # Create balanced dataset for training + print("Creating balanced dataset...") label_counts = Counter(y_train) min_count = min(label_counts.values()) - # Sample balanced indices balanced_indices = [] for label in label_counts: inds = np.where(y_train == label)[0] sampled = np.random.choice(inds, min_count, replace=False) balanced_indices.extend(sampled) balanced_indices = np.array(balanced_indices) + # Create balanced dataset X_bal = X_train[balanced_indices] - print(f"Balanced dataset shape: {X_bal.shape}") y_bal = y_train[balanced_indices] + print(f"Balanced dataset shape: {X_bal.shape}") balanced_dataset_y = create_dataset(X_bal, y_bal, batch_size=batch_size, is_training=True) - balanced_dataset = balanced_dataset_y.apply(remove_id).apply(remove_y) + balanced_dataset = balanced_dataset_y.map(lambda x, y: x) # Remove labels + + # Print shapes for debugging + for batch in balanced_dataset.take(1): + print(f"Balanced dataset batch shape: {batch.shape}") + break + for features, labels in val_dataset.take(1): + print(f"Validation dataset batch features shape: {features.shape}, labels shape: {labels.shape}") + break # Initial training on balanced set print(f"Training on balanced set for {epochs} epochs...") @@ -1895,7 +1966,7 @@ def remove_y(dataset): plot_training_metrics(history, save_path=os.path.join(output_dir, f'vqvae_training_metrics_fold{fold_idx}.png')) print("\nPerforming example inference...") try: - example_batch, _ = next(iter(val_dataset)) + example_batch, y_batch = next(iter(val_dataset)) except Exception: example_batch = next(iter(val_dataset)) output = model(example_batch, training=False) @@ -1903,6 +1974,10 @@ def remove_y(dataset): print("\nVisualizing reconstructions...") plot_reconstructions(example_batch.numpy(), reconstruction.numpy(), save_path=os.path.join(output_dir, f'vqvae_reconstructions_fold{fold_idx}.png')) + Zq, out_P_proj, vq_loss, perplexity = model.encode_(example_batch) + print("\nVisualizing encoder output...") + plot_PCA(Zq.numpy(), y_batch, num_embeddings, + save_path=os.path.join(output_dir, f'scqvae_PCA_fold{fold_idx}.png')) # --- Save Model --- if save_model: @@ -1924,8 +1999,8 @@ def remove_y(dataset): process_and_save(ds, f"{ds_name}_fold{fold_idx}", model, original_labels, output_dir, num_embeddings) elif output_data == "train_val_seperate": - process_and_save(train_dataset, f"train_fold{fold_idx}", model, y_train, output_dir, num_embeddings) - process_and_save(val_dataset, f"val_fold{fold_idx}", model, y_val, output_dir, num_embeddings) + process_and_save(train_dataset, f"train_fold{fold_idx}", model, output_dir, num_embeddings) + process_and_save(val_dataset, f"val_fold{fold_idx}", model, output_dir, num_embeddings) else: raise ValueError("Invalid output_data. Must be 'train', 'val', 'train_val_combined', or 'train_val_seperate'.") @@ -2100,6 +2175,7 @@ def create_visualizations(X, X_val, y, y_val, y_pred, y_proba, soft_clusters, so y_all = np.concatenate([y, y_val]) soft_clusters_all = np.vstack([soft_clusters, soft_clusters_val]) pca_proj = pca.fit_transform(X_all) + print("Unique labels in y_all:", np.unique(y_all)) df_vis = pd.DataFrame({ 'PC1': pca_proj[:, 0], @@ -2255,6 +2331,10 @@ def evaluation_metrics(y_true, y_pred, y_prob=None): print(f"Loading training data from {data_path}") df = pd.read_parquet(data_path) + # drop rows with nan labels + if 'binding_label' in df.columns: + df = df.dropna(subset=['binding_label']) + # Extract features from latent columns if input_type == 'latent': # Get all latent columns @@ -2290,6 +2370,7 @@ def evaluation_metrics(y_true, y_pred, y_prob=None): if use_soft_clusters_as_gates: soft_cluster_cols = [col for col in df.columns if col.startswith('soft_cluster_')] if not soft_cluster_cols: + print(f"Dataframe columns: {df.columns}") raise ValueError("No soft_cluster_* columns found in the dataset") print(f"Found {len(soft_cluster_cols)} soft cluster probability columns") soft_clusters = df[soft_cluster_cols].values @@ -2307,6 +2388,11 @@ def evaluation_metrics(y_true, y_pred, y_prob=None): if val_data_path: print(f"Loading validation data from {val_data_path}") df_val = pd.read_parquet(val_data_path) + + # drop rows with nan labels + if 'binding_label' in df_val.columns: + df_val = df_val.dropna(subset=['binding_label']) + if input_type == 'latent': # Use same latent columns as training X_val = df_val[latent_cols].values @@ -2411,44 +2497,51 @@ def evaluation_metrics(y_true, y_pred, y_prob=None): raise ValueError(f"Unsupported model_type: {model_type}") # --- create a balanced dataset --- - label_counts = Counter(y) - min_count = min(label_counts.values()) - balanced_indices = np.concatenate([ - np.random.choice(np.where(y == lbl)[0], min_count, replace=False) - for lbl in label_counts - ]) - np.random.shuffle(balanced_indices) - X_bal = X[balanced_indices] - soft_bal = soft_clusters[balanced_indices] - y_bal = y[balanced_indices] - - train_bal_ds = tf.data.Dataset.from_tensor_slices(((X_bal, soft_bal), y_bal)) \ - .shuffle(buffer_size=1000, seed=random_state) \ - .batch(batch_size) - - # --- Train the model --- - print(f"Training on balanced set for {epochs} epochs...") - history = model.fit( - train_bal_ds, - validation_data=val_dataset, - epochs=epochs, - **kwargs - ) + # label_counts = Counter(y) + # min_count = min(label_counts.values()) + # balanced_indices = np.concatenate([ + # np.random.choice(np.where(y == lbl)[0], min_count, replace=False) + # for lbl in label_counts + # ]) + # np.random.shuffle(balanced_indices) + # X_bal = X[balanced_indices] + # soft_bal = soft_clusters[balanced_indices] + # y_bal = y[balanced_indices] + # + # train_bal_ds = tf.data.Dataset.from_tensor_slices(((X_bal, soft_bal), y_bal)) \ + # .shuffle(buffer_size=1000, seed=random_state) \ + # .batch(batch_size) + # + # # --- Train the model --- + # print(f"Training on balanced set for {epochs} epochs...") + # history = model.fit( + # train_bal_ds, + # validation_data=val_dataset, + # epochs=epochs, + # **kwargs + # ) # TODO experimental - # Freeze initial half of layers, then fine-tune on full dataset - for layer in model.layers[: len(model.layers) // 2]: - layer.trainable = False + # # Freeze initial half of layers, then fine-tune on full dataset + # for layer in model.layers[: len(model.layers) // 2]: + # layer.trainable = False model.compile( optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate), loss=tf.keras.losses.BinaryCrossentropy(), - metrics=['accuracy'], + metrics=["accuracy"], + # tf.keras.metrics.BinaryAccuracy(), + # tf.keras.metrics.Precision(), + # tf.keras.metrics.Recall(), + # tf.keras.metrics.AUC() + # ], + # run_eagerly=False ) + # tf.config.run_functions_eagerly(True) print(f"Fine-tuning on full dataset for {epochs} epochs...") history = model.fit( train_dataset, validation_data=val_dataset, - epochs=epochs//5, + epochs=epochs, **kwargs ) @@ -2487,42 +2580,41 @@ def evaluation_metrics(y_true, y_pred, y_prob=None): if __name__ == "__main__": dataset_folder = "NetMHCIpan_dataset" - # # Call train_and_evaluate_scqvae without trying to unpack return values - # train_and_evaluate_scqvae( - # data_path=f"data/Pep2Vec/{dataset_folder}_new_subset", - # # val_data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_val_fold_0.parquet", - # input_type="latent1024", - # num_embeddings=64, - # embedding_dim=64, - # batch_size=128, - # epochs=5, - # output_dir=f"data/SCQvae/{dataset_folder}", - # visualize=True, - # save_model=True, - # init_k_means=False, - # random_state=42, - # test_size=0.2, - # output_data="train_val_seperate", # Options: "val", "train", "train_val_seperate" - # ) - m = "CNN" # Options: "MoE", "MLP", "transformer", "CNN" + # Call train_and_evaluate_scqvae without trying to unpack return values + train_and_evaluate_scqvae( + data_path=f"data/Pep2Vec/{dataset_folder}_new_subset", + # val_data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_val_fold_0.parquet", + input_type="latent1024", + num_embeddings=32, + embedding_dim=32, + batch_size=1024, + epochs=20, + output_dir=f"data/SCQvae/{dataset_folder}", + visualize=True, + save_model=True, + init_k_means=False, + random_state=42, + output_data="train_val_seperate", # Options: "val", "train", "train_val_seperate" + ) + m = "MLP" # Options: "MoE", "MLP", "transformer", "CNN" print(f"Running {m}") train_and_evaluate_moe( - # data_path=f"data/SCQvae/{dataset_folder}/quantized_outputs_train_fold0.parquet", - # val_data_path=f"data/SCQvae/{dataset_folder}/quantized_outputs_val_fold0.parquet", - data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_train_fold_0.parquet", - val_data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_val_fold_0.parquet", + data_path=f"data/SCQvae/{dataset_folder}/quantized_outputs_train_fold0.parquet", + val_data_path=f"data/SCQvae/{dataset_folder}/quantized_outputs_val_fold0.parquet", + # data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_train_fold_0.parquet", + # val_data_path=f"data/Pep2Vec/{dataset_folder}_new_subset/pep2vec_output_val_fold_0.parquet", input_type="latent", model_type=m, batch_size=128, - epochs=5, + epochs=10, learning_rate=1e-4, - hidden_dim=4, + hidden_dim=16, output_dir=f"data/MoE/{dataset_folder}", visualize=True, save_model=True, random_state=42, - test_size=0.2, - use_soft_clusters_as_gates=False, + test_size=0.2, # fraction of data to use for validation if no val_data_path + use_soft_clusters_as_gates=True, ) diff --git a/run_pep2vec.py b/run_pep2vec.py index b3b9ca6d0..0e6321855 100644 --- a/run_pep2vec.py +++ b/run_pep2vec.py @@ -395,7 +395,11 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, test2 = datasets['train'][datasets['train']['allotype'] == lowest_allele].copy() datasets['train'] = datasets['train'][datasets['train']['allotype'] != lowest_allele].reset_index(drop=True) - if process_fold_n == 0 or process_fold_n == None: + if process_fold_n: + process_fold_n = int(process_fold_n) + if process_fold_n < 0 or process_fold_n >= n_folds: + raise ValueError(f"Invalid fold number: {process_fold_n}. Must be between 0 and {n_folds - 1}.") + if not process_fold_n or process_fold_n == 0: # Create k-fold cross-validation splits k = n_folds folds = create_progressive_k_fold_cross_validation( @@ -439,21 +443,30 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, test1.to_csv(os.path.join(folds_dir, "test1_stratified.csv"), index=False, header=True) test2.to_csv(os.path.join(folds_dir, "test2_single_unique_allele.csv"), index=False, header=True) print("Test dataset saved.") - - # load the fold csv files for specified fold - train_path = os.path.join(folds_dir, f"train_set_fold_{process_fold_n}.csv") - val_path = os.path.join(folds_dir, f"val_set_fold_{process_fold_n}.csv") - if os.path.exists(train_path) and os.path.exists(val_path): - datasets['train'] = pd.read_csv(train_path, index_col=0) - datasets['val'] = pd.read_csv(val_path, index_col=0) else: - raise FileNotFoundError(f"Fold files not found for fold {process_fold_n}") + print("no folds created, using the existing ones") + + # load the fold csv files for specified fold + train_path = os.path.join(folds_dir, f"train_set_fold_{process_fold_n}.csv") + val_path = os.path.join(folds_dir, f"val_set_fold_{process_fold_n}.csv") + if os.path.exists(train_path) and os.path.exists(val_path): + datasets['train'] = pd.read_csv(train_path, index_col=0) + datasets['val'] = pd.read_csv(val_path, index_col=0) + else: + raise FileNotFoundError(f"Fold files not found for fold {process_fold_n}") ################### Pep2Vec ################### # automatically get the number of cores num_cores = max(os.cpu_count() - 2, 1) # TODO only process one fold? with process_fold_n - if process_fold_n == None: + if process_fold_n: + for split in ['train', 'val']: + csv_in = os.path.join(folds_dir, f"{split}_set_fold_{process_fold_n}.csv") + out_pq = os.path.join(output_dir, f"pep2vec_output_{split}_fold_{process_fold_n}.parquet") + if os.path.exists(csv_in): + os.system( + f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {csv_in} --output_location {out_pq} --mhctype {mhc_type}") + else: for i in range(n_folds): for split in ['train', 'val']: csv_in = os.path.join(folds_dir, f"{split}_set_fold_{i}.csv") @@ -461,13 +474,6 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, if os.path.exists(csv_in): os.system( f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {csv_in} --output_location {out_pq} --mhctype {mhc_type}") - else: - for split in ['train', 'val']: - csv_in = os.path.join(folds_dir, f"{split}_set_fold_{process_fold_n}.csv") - out_pq = os.path.join(output_dir, f"pep2vec_output_{split}_fold_{process_fold_n}.parquet") - if os.path.exists(csv_in): - os.system( - f"./Pep2Vec/pep2vec.bin --num_threads {num_cores} --dataset {csv_in} --output_location {out_pq} --mhctype {mhc_type}") # # test set test_file = os.path.join(folds_dir, "test_original.csv") @@ -508,17 +514,17 @@ def main(dataset_name="Conbotnet", mhc_type="mhc2", subset_prop=1.0, n_folds=5, # is_netmhcpan=False # ) - df_map = main("ConvNeXT-MHC", "mhc1", 0.01, 5, fold_n) + # df_map = main("ConvNeXT-MHC", "mhc1", 0.01, 5, fold_n) # df_map = None # if not df_map: # df1 = pd.read_csv(os.path.join("data", "ConvNeXT-MHC", "train.csv"),) # df2 = pd.read_csv(os.path.join("data", "ConvNeXT-MHC", "test_all.csv"),) # df_map = pd.concat([df1, df2]) - add_binding_label_streaming( - input_path=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC"), - map_csv=df_map, - output_dir=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC_new_subset") - ) + # add_binding_label_streaming( + # input_path=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC"), + # map_csv=df_map, + # output_dir=os.path.join("data", "Pep2Vec", "ConvNeXT-MHC_new_subset") + # ) # main("NetMHCpan_dataset", "mhc2", 0.01, 5) # add_binding_label( # df_path=os.path.join("data", "Pep2Vec", "NetMHCIIpan_dataset"), diff --git a/src/run_pMHC_DL_ESM.py b/src/run_pMHC_DL_ESM.py new file mode 100644 index 000000000..41050c92e --- /dev/null +++ b/src/run_pMHC_DL_ESM.py @@ -0,0 +1,337 @@ +#!/usr/bin/env python +""" +mhc_crossattn_pipeline.py +========================= + +End‑to‑end trainer for a **peptide×MHC cross‑attention classifier**. +It loads a NetMHCpan‑style parquet that contains + + long_mer, assigned_label, allele, MHC_class, + mhc_embedding **OR** mhc_embedding_path + +columns. Each row supplies + +* a peptide sequence (long_mer) +* a pre‑computed MHC pseudo‑sequence embedding (36, 1152) +* a binary label (assigned_label) + +The script + +1.Derives the longest peptide length → SEQ_LEN. +2.Converts every peptide into a 21‑dim one‑hot tensor (SEQ_LEN, 21). +3.Feeds the pair + + (one_hot_peptide, mhc_latent) → classifier → P(binding) + +4.Trains with binary‑cross‑entropy and saves the best weights & metadata. + +Author : Amirreza (updated for cross‑attention, 2025‑05‑22) +""" +from __future__ import annotations +import os, sys, argparse, datetime, pathlib, json +import numpy as np +import pandas as pd +import tensorflow as tf +import matplotlib.pyplot as plt +from sklearn.model_selection import train_test_split +from tqdm import tqdm +from utils.model import build_classifier + +# --------------------------------------------------------------------------- +# Utility: peptide → one‑hot (seq_len, 21) +# --------------------------------------------------------------------------- +AA = "ACDEFGHIKLMNPQRSTVWY" # 20 standard AAs, order fixed +AA_TO_IDX = {aa: i for i, aa in enumerate(AA)} +UNK_IDX = 20 # index for unknown / padding + + +def peptides_to_onehot(seqs: list[str], seq_len: int) -> np.ndarray: + """Vectorise *seqs* into (N, seq_len, 21) one‑hot with padding.""" + N = len(seqs) + arr = np.zeros((N, seq_len, 21), dtype=np.float32) + for i, s in enumerate(seqs): + if not s: + raise "[ERR] empty peptide sequence" + for j, aa in enumerate(s.upper()[:seq_len]): + arr[i, j, AA_TO_IDX.get(aa, UNK_IDX)] = 1.0 + # remaining positions stay zero → acts as padded UNK (index 20) + return arr + + +# --------------------------------------------------------------------------- +# Robust loader for latent embeddings (same as before) +# --------------------------------------------------------------------------- + +def _read_embedding_file(path: str | os.PathLike) -> np.ndarray: + # Try fast numeric path first + try: + arr = np.load(path) + if isinstance(arr, np.ndarray) and arr.dtype == np.float32: + return arr + raise ValueError + except ValueError: + obj = np.load(path, allow_pickle=True) + if isinstance(obj, np.ndarray) and obj.dtype == object: + obj = obj.item() + if isinstance(obj, dict) and "embedding" in obj: + return obj["embedding"].astype("float32") + raise ValueError(f"Unrecognised embedding file {path}") + + +# --------------------------------------------------------------------------- +# Dataset loader – returns (peptide_onehot, latent), labels +# --------------------------------------------------------------------------- + +def load_dataset(parquet_path: str): + print(f"→ Reading {parquet_path}") + df = pd.read_parquet(parquet_path) + + # 1) Peptide one‑hot ---------------------------------------------------- + if "long_mer" not in df.columns: + raise ValueError("Expected a 'long_mer' column with peptide sequences") + seq_len = int(df["long_mer"].str.len().max()) + print(f" longest peptide = {seq_len} residues") + pep_onehot = peptides_to_onehot(df["long_mer"].tolist(), seq_len) + print(" peptide one-hot shape:", pep_onehot.shape) + + # 2) Latent embeddings -------------------------------------------------- + print(" loading MHC-I embeddings") + if "mhc_embedding" in df.columns: + latents = np.stack(df["mhc_embedding"].values).astype("float32") + elif "mhc_embedding_path" in df.columns: + latents = np.stack([_read_embedding_file(p) for p in df["mhc_embedding_path"]]) + else: + raise ValueError("Need 'mhc_embedding' or 'mhc_embedding_path' column") + + print(" latent shape:", latents.shape) + if latents.shape[1:] != (36, 1152): + raise ValueError(f"Unexpected latent shape {latents.shape[1:]}, expected (36,1152)") + + # 3) Labels ------------------------------------------------------------- + labels = df["assigned_label"].astype("float32").values[:, None] # (N,1) + + return pep_onehot, latents, labels, seq_len + + +def load_dataset_in_batches(parquet: str, batch_size: int = 100): + print(f"→ reading {parquet} in batches of {batch_size}") + df = pd.read_parquet(parquet) + if "long_mer" not in df.columns: + raise ValueError("Expected a 'long_mer' column with peptide sequences") + seq_len = int(df["long_mer"].str.len().max()) + total = len(df) + for start in range(0, total, batch_size): + end = min(start + batch_size, total) + pep_onehot = peptides_to_onehot(df["long_mer"].values[start:end].tolist(), seq_len) + if "mhc_embedding" in df.columns: + latents = np.stack(df["mhc_embedding"].values[start:end]).astype("float32") + elif "mhc_embedding_path" in df.columns: + latents = np.stack([_read_embedding_file(p) for p in tqdm(df["mhc_embedding_path"].values[start:end], + desc=f"Loading embeddings {start}-{end}")]) + else: + raise ValueError("Need a 'mhc_embedding' or 'mhc_embedding_path' column") + labels = df["assigned_label"].values[start:end].astype("float32") + yield pep_onehot, latents, labels, seq_len + + +# --------------------------------------------------------------------------- +# Visualisation utility +# --------------------------------------------------------------------------- +def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_id: int = None): + """ + Plot training curves from a Keras history object. + Args: + history: Keras history object containing training metrics. + run_dir: Directory to save the plot. + fold_id: Optional fold identifier for naming the output file. + + Returns: None + + """ + hist = history.history + plt.figure(figsize=(21, 4)) + + plt.subplot(1, 3, 1) + plt.plot(hist["loss"], label="train") + plt.plot(hist["val_loss"], label="val") + plt.xlabel("epoch") + plt.ylabel("loss") + plt.title("BCE loss") + plt.legend() + plt.grid(True) + + if "binary_accuracy" in hist and "val_binary_accuracy" in hist: + plt.subplot(1, 3, 2) + plt.plot(hist["binary_accuracy"], label="train acc") + plt.plot(hist["val_binary_accuracy"], label="val acc") + plt.xlabel("epoch") + plt.ylabel("accuracy") + plt.title("Binary Accuracy") + plt.legend() + plt.grid(True) + + if "auc" in hist and "val_auc" in hist: + plt.subplot(1, 3, 3) + plt.plot(hist["auc"], label="train AUC") + plt.plot(hist["val_auc"], label="val AUC") + plt.xlabel("epoch") + plt.ylabel("AUC") + plt.title("AUC") + plt.legend() + plt.grid(True) + + out_png = os.path.join(run_dir, f"training_curve{'_fold' + str(fold_id) if fold_id is not None else ''}.png") + plt.tight_layout() + plt.savefig(out_png) + plt.show() + print(f"✓ Training curve saved to {out_png}") + + +# --------------------------------------------------------------------------- +# TF‑data helper +# --------------------------------------------------------------------------- + +def make_tf_dataset(peps, lats, labels, batch=128, shuffle=True): + ds = tf.data.Dataset.from_tensor_slices(((peps, lats), labels)) + if shuffle: + ds = ds.shuffle(buffer_size=len(labels), seed=42) + return ds.batch(batch).prefetch(tf.data.AUTOTUNE) + + +# --------------------------------------------------------------------------- +# Training script +# --------------------------------------------------------------------------- + +def main(argv=None): + p = argparse.ArgumentParser() + p.add_argument("--parquet", required=False, + help="Input parquet with peptide, latent, label") + p.add_argument("--dataset_path", default=None, + help="Path to a custom dataset (not parquet)") + p.add_argument("--epochs", type=int, default=30) + p.add_argument("--batch", type=int, default=128) + p.add_argument("--outdir", default=None, + help="Output dir (default: runs/run_YYYYmmdd-HHMMSS)") + p.add_argument("--val_fraction", type=float, default=0.2, + help="Fraction for train/val split") + args = p.parse_args(argv) + + run_dir = args.outdir or f"runs/run_{datetime.datetime.now():%Y%m%d-%H%M%S}" + pathlib.Path(run_dir).mkdir(parents=True, exist_ok=True) + print(f"★ Outputs → {run_dir}\n") + + # ----------------------- Load & split ---------------------------------- + if args.parquet: + # peps, lats, labels, seq_len = load_dataset(args.parquet) + batch_loader = load_dataset_in_batches(args.parquet, batch_size=30000) + peps, lats, labels, seq_len = next(batch_loader) + + print(f"✓ loaded {len(peps):,} samples" + f" ({peps.shape[1]} residues, {lats.shape[1]} latent features)") + + X_train_p, X_val_p, X_train_l, X_val_l, y_train, y_val = train_test_split( + peps, lats, labels, + test_size=args.val_fraction, + random_state=42, + stratify=labels) + + train_ds = make_tf_dataset(X_train_p, X_train_l, y_train, batch=args.batch) + val_ds = make_tf_dataset(X_val_p, X_val_l, y_val, batch=args.batch, + shuffle=False) + elif args.dataset_path: + # load test sets + test1 = pd.read_parquet(args.dataset_path + "/test1.parquet") + test2 = pd.read_parquet(args.dataset_path + "/test2.parquet") + num_fold = os.listdir(args.dataset_path + "/folds") + folds = [] + for i in range(1, len(num_fold) // 2 + 1): + train_path = args.dataset_path + f"/folds/fold_{i}_train.parquet" + val_path = args.dataset_path + f"/folds/fold_{i}_val.parquet" + train_loader = load_dataset_in_batches(train_path, batch_size=3000) + val_loader = load_dataset_in_batches(val_path, batch_size=3000) + + X_train_p, X_train_l, y_train, seq_len = next(train_loader) + X_val_p, X_val_l, y_val, _ = next(val_loader) + train_ds = make_tf_dataset(X_train_p, X_train_l, y_train, batch=args.batch) + val_ds = make_tf_dataset(X_val_p, X_val_l, y_val, batch=args.batch, shuffle=False) + folds.append((train_ds, val_ds)) + + print(f"✓ loaded {len(test1):,} test1 samples, " + f"{len(test2):,} test2 samples, " + f"{len(folds)} folds") + + + else: + raise ValueError("Need either --parquet or --dataset_path argument") + + # ----------------------- Model ----------------------------------------- + # clear GPU memory + tf.keras.backend.clear_session() + # set random seeds for reproducibility + os.environ["PYTHONHASHSEED"] = "42" + os.environ["TF_DETERMINISTIC_OPS"] = "1" + + tf.random.set_seed(42); + np.random.seed(42) + model = build_classifier(seq_len) + model.summary() + + ckpt_cb = tf.keras.callbacks.ModelCheckpoint( + filepath=os.path.join(run_dir, "best_weights.h5"), + monitor="val_loss", save_best_only=True, mode="min") + early_cb = tf.keras.callbacks.EarlyStopping( + monitor="val_loss", patience=10, restore_best_weights=True) + + if args.parquet: + history = model.fit(train_ds, + validation_data=val_ds, + epochs=args.epochs, + callbacks=[ckpt_cb, early_cb]) + # ----------------------- Plot curve ------------------------------------ + plot_training_curve(history, run_dir) + # ----------------------- Save model & metadata ------------------------ + meta = dict(parquet=args.parquet, + epochs=len(history["loss"]), + batch=args.batch, + seq_len=seq_len, + model_params=dict(embed_dim=256, num_heads=8, ff_dim=512)) + json.dump(meta, open(os.path.join(run_dir, "run_config.json"), "w"), indent=2) + print("★ Done.") + + elif args.dataset_path: + # Train on folds + for i, (train_ds, val_ds) in enumerate(folds): + print(f"Training on fold {i + 1}/{len(folds)}") + # clear GPU memory + tf.keras.backend.clear_session() + # set random seeds for reproducibility + tf.random.set_seed(42); + np.random.seed(42) + model = build_classifier(seq_len) # Rebuild model for each fold + + history = model.fit(train_ds, + validation_data=val_ds, + epochs=args.epochs, + callbacks=[ckpt_cb, early_cb]) + + # Save fold metadata + fold_meta = dict(fold_id=i + 1, epochs=len(history.history["loss"]), + batch=args.batch, seq_len=seq_len) + json.dump(fold_meta, open(os.path.join(run_dir, f"fold_{i + 1}_config.json"), "w"), indent=2) + + # ----------------------- Plot training curve --------------------------- + plot_training_curve(history, run_dir) + + print("★ Done.") + # TODO think about ensembling folds later + + else: + raise ValueError("Need either --parquet or --dataset_path argument") + + +if __name__ == "__main__": + main([ + # "--parquet", "../data/Custom_dataset/NetMHCpan_dataset/mhc2_with_esm_embeddings.parquet", + "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_1", + "--epochs", "100", "--batch", "128" + ]) \ No newline at end of file diff --git a/utils/create_ESM_dataset.py b/utils/create_ESM_dataset.py new file mode 100644 index 000000000..7b2509fc5 --- /dev/null +++ b/utils/create_ESM_dataset.py @@ -0,0 +1,246 @@ +#!/usr/bin/env python +""" +requires python3.10+ +Create a parquet dataset that combines NetMHCpan metadata with ESM-2 embeddings +for each MHC-I allele. + +Usage: python make_dataset.py +""" + +import os +import pathlib +import re + +import numpy as np +import pandas as pd +from tqdm import tqdm # progress bars +from typing import Dict +from processing_functions import create_progressive_k_fold_cross_validation + +# --------------------------------------------------------------------- +# 1. CONFIGURATION – adjust if your paths change +# --------------------------------------------------------------------- +dataset_name = "NetMHCpan_dataset" +mhc_class = 1 +CSV_PATH = pathlib.Path(f"../data/{dataset_name}/combined_data_{mhc_class}.csv") +NPZ_PATH = pathlib.Path( + f"../data/ESM/esmc_600m/NetMHCpan pseudoseqs/mhc{mhc_class}_encodings.npz" +) +OUT_PARQUET = pathlib.Path( + f"../data/Custom_dataset/{dataset_name}/mhc_{mhc_class}/mhc{mhc_class}_with_esm_embeddings.parquet" +) + +# If you want to *save* each array as its own .npy rather than store the +# full tensor inside parquet, set this to a directory; otherwise None. +EMB_OUT_DIR = pathlib.Path( + f"../data/Custom_dataset/{dataset_name}/mhc_{mhc_class}/mhc{mhc_class}_encodings" +) # or `None` to embed directly +# --------------------------------------------------------------------- + + +def load_mhc1_embeddings(npz_path: pathlib.Path) -> Dict[str, np.ndarray]: + """ + Returns {allele_name: 187×1152 tensor}. + """ + emb_dict = {} + with np.load(npz_path) as npz_file: + for k in npz_file.files: + emb = npz_file[k] + # if emb.shape != (36, 1152): + # print(f"[WARN] Skipping {k}: shape {emb.shape} != (36,1152)") + # continue + emb_dict[k] = emb + print(f"Loaded embeddings for {len(emb_dict):,} alleles.") + return emb_dict + + +def normalise_allele(a: str) -> str: + """ + Make the allele string format identical to the keys inside the NPZ. + Tweak this if your formats differ! + """ + # remove * and : from the allele name + # and convert to upper case + # e.g. "HLA-A*01:01" -> "HLA-A0101" + # e.g. "HLA-A*01:01:01" -> "HLA-A010101" + # remove spaces + # e.g. "HLA-A 01:01" -> "HLA-A0101" + # TODO fix eg. HLA-DRA/HLA-DRB1_0101 > DRB10101 eg. HLA-DRA/HLA-DRB1_0401 > DRB10401 + # Format heterodimer allele strings, e.g. "HLA-DRA/HLA-DRB1_0101" -> "DRB10101" + a = a.strip() + if "HLA-DRA/" in a: + # For heterodimers, take the second chain and format as e.g. DRB10101 + _, second = a.split("/", 1) + a = second.replace("HLA-", "") + + elif "mice-" in a: + _, second = a.split("/", 1) + a = second.replace("mice-", "") + else: + a = a.replace("/HLA", "") + # remove "*" and spaces + a = a.replace("*", "").replace(" ", "") + + return a + + +def attach_embeddings( + df: pd.DataFrame, + emb_dict: Dict[str, np.ndarray], + out_dir: pathlib.Path | None = None, +) -> pd.DataFrame: + """ + Add either: + • a column "mhc_embedding" holding the full tensor (object dtype) + • or a column "mhc_embedding_path" pointing to a .npy on disk. + + Rows with no matching embedding are dropped (could also be imputed). + """ + # Pre-compute paths if we are writing .npy files + if out_dir is not None: + out_dir.mkdir(parents=True, exist_ok=True) + + paths, embeds = [], [] + for allele in tqdm(df["allele"], desc="Attaching embeddings"): + key = normalise_allele(allele) + emb = emb_dict.get(key) + if emb is None: + paths.append(None) + embeds.append(None) + continue + + if out_dir is None: + embeds.append(emb) + paths.append(None) + else: + fname = key.replace("*", "").replace(" ", "").replace("/HLA", "") + ".npy" + fpath = out_dir / fname + if not fpath.exists(): # avoid double-saving + np.save(fpath, emb) + paths.append(str(fpath)) + embeds.append(None) + + if out_dir is None: + df = df.assign(mhc_embedding=embeds) + else: + df = df.assign(mhc_embedding_path=paths) + + # Drop rows where we could not find an embedding + n_before = len(df) + # print unique alleles of missing embeddings + if "mhc_embedding" in df.columns: + missing_alleles = df.loc[df["mhc_embedding"].isna(), "allele"].unique() + else: + missing_alleles = df.loc[df["mhc_embedding_path"].isna(), "allele"].unique() + if len(missing_alleles) > 0: + print(f"Missing embeddings for {len(missing_alleles):,} alleles:") + print(", ".join(sorted(missing_alleles))) + else: + print("✓ All embeddings found.") + df = df.dropna( + subset=["mhc_embedding"] if out_dir is None else ["mhc_embedding_path"] + ) + print(f"Dropped {n_before - len(df):,} rows with no MHC-{mhc_class} embedding.") + return df + + +def create_test_set(df: pd.DataFrame, samples_per_label: int=10000) -> dict[str, pd.DataFrame]: + """ + Create two test sets: + - test1: equally sample samples_per_label from each assigned_label + - test2: select all entries of the allele with the lowest count in train + """ + datasets = {} + train_df_ = df.copy() + + # test1: sample equally from each label + test1 = ( + train_df_ + .groupby('assigned_label', group_keys=False) + .sample(n=samples_per_label, random_state=42) + .reset_index(drop=True) + ) + train_mask = ~train_df_.index.isin(test1.index) + train_updated = train_df_.loc[train_mask].reset_index(drop=True) + + datasets['train'] = train_updated + datasets['test1'] = test1 + + # test2: remove lowest-frequency allele from train to form test2 + allele_counts = datasets['train']['allele'].value_counts() + lowest_allele = allele_counts.idxmin() + test2 = datasets['train'][datasets['train']['allele'] == lowest_allele].copy() + datasets['train'] = ( + datasets['train'] + [datasets['train']['allele'] != lowest_allele] + .reset_index(drop=True) + ) + datasets['test2'] = test2 + + return datasets + + +def main() -> None: + print("→ Loading cleaned NetMHCpan CSV") + df = pd.read_csv( + CSV_PATH, + usecols=["long_mer", "assigned_label", "allele", "mhc_class"], + ) + + # filter out + df = df[df["mhc_class"] == mhc_class] + + print(f"→ Loading MHC class {mhc_class} embeddings") + emb_dict = load_mhc1_embeddings(NPZ_PATH) + + print("→ Merging") + df = attach_embeddings(df, emb_dict, EMB_OUT_DIR) + + # print("→ Dropping duplicates and nones") + df = df.drop_duplicates(subset=["long_mer", "allele"]) + df = df.dropna(subset=["long_mer"]) + + print(f"→ Writing parquet to {OUT_PARQUET}") + df.to_parquet(OUT_PARQUET, engine="pyarrow", index=False, compression="zstd") + + print(f"→ Dataset shape: {df.shape}") + + print("→ Create and save test sets") + datasets = create_test_set(df) + for name, subset in datasets.items(): + print(f"{name.capitalize()} set shape: {subset.shape}") + if name != "train": + subset.to_parquet(OUT_PARQUET.parent / f"{name}.parquet", index=False, engine="pyarrow", compression="zstd") + + + print("→ Creating cross-validation folds") + folds = create_progressive_k_fold_cross_validation( + datasets['train'], + target_col="assigned_label", + k=5, + id_col="allele", + ) + + print("→ Saving folds to CSV") + # Ensure the output directory exists /folds + (OUT_PARQUET.parent / "folds").mkdir(parents=True, exist_ok=True) + held_out_ids_path = OUT_PARQUET.parent / "folds" / "held_out_ids.txt" + if held_out_ids_path.exists(): + held_out_ids_path.unlink() + + for fold_id, (train_df, val_df, validation_ids) in enumerate(folds, start=1): + train_path = OUT_PARQUET.parent / f"folds/fold_{fold_id}_train.parquet" + val_path = OUT_PARQUET.parent / f"folds/fold_{fold_id}_val.parquet" + train_df.to_parquet(train_path, index=False, engine="pyarrow", compression="zstd") + val_df.to_parquet(val_path, index=False, engine="pyarrow", compression="zstd") + print(f"Saved fold {fold_id} train to {train_path}") + print(f"Saved fold {fold_id} val to {val_path}") + ids_str = ", ".join(map(str, validation_ids)) + with open(held_out_ids_path, "a") as f: + f.write(f"Fold {fold_id}: {ids_str}\n") + + print("✓ Done") + + +if __name__ == "__main__": + main() From 50b89150bf11b4315d41188a84dd1a8dd8c089d8 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 27 May 2025 18:20:55 +0200 Subject: [PATCH 45/83] Refactor SCQ1DAutoEncoder and add PeptideEmbedding and CrossAttentionBlock: streamline model architecture, enhance clustering handling, and implement a new classifier structure --- utils/model.py | 324 ++++++++++++++++++++++++++++++++++++++++--------- 1 file changed, 267 insertions(+), 57 deletions(-) diff --git a/utils/model.py b/utils/model.py index d65723cf9..050935dc4 100644 --- a/utils/model.py +++ b/utils/model.py @@ -8,7 +8,7 @@ class SCQ_layer(layers.Layer): def __init__(self, num_embed, dim_embed, lambda_reg=1.0, proj_iter=10, discrete_loss=False, beta_loss=0.25, reset_dead_codes=False, - usage_threshold=1e-3, reset_interval=2, **kwargs): + usage_threshold=1e-3, reset_interval=5, **kwargs): """ Soft Convex Quantization (SCQ) layer. @@ -299,8 +299,8 @@ def _reset_dead_codes(self, encoder_outputs): class SCQ1DAutoEncoder(keras.Model): def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, - scq_params, initial_codebook, num_classes, cluster_lambda=1.0, **kwargs): - super().__init__(**kwargs) + scq_params, initial_codebook=None, cluster_lambda=1.0): + super().__init__() self.input_dim = input_dim # e.g., (1024,) self.embedding_dim = embedding_dim self.num_embeddings = num_embeddings @@ -308,8 +308,6 @@ def __init__(self, input_dim, num_embeddings, embedding_dim, commitment_beta, # weight on the new cluster‐consistency loss self.cluster_lambda = cluster_lambda - # number of distinct labels - self.num_classes = num_classes # Encoder: Dense layers to compress 1024 features to embedding_dim self.encoder = keras.Sequential([ @@ -440,7 +438,7 @@ def test_step(self, data): x = data[0] y = data[1] if len(data) > 1 else data[0] else: - x = y = data + x = data reconstruction, quantized, _, vq_loss, perplexity = self(x, training=False) recon_loss = tf.reduce_mean(tf.math.squared_difference(x, reconstruction)) @@ -1361,7 +1359,7 @@ def convert_to_hard_clustering(self, soft_clusters): def call(self, inputs, training=False): # Unpack inputs if isinstance(inputs, tuple) and len(inputs) == 2: - x, clustering = inputs + x, soft_cluster_probs = inputs else: raise ValueError("Inputs must include both features and clustering values") @@ -1369,7 +1367,9 @@ def call(self, inputs, training=False): # Convert to hard clustering during training if requested if training and self.use_hard_clustering: - clustering = self.convert_to_hard_clustering(clustering) + clustering = self.convert_to_hard_clustering(soft_cluster_probs) + else: + clustering = soft_cluster_probs # Initialize output tensor combined_output = tf.zeros([batch_size, self.output_dim]) @@ -1497,52 +1497,262 @@ def test_step(self, data): return results -# Example usage: - -# Define model parameters -input_dim = 10 -hidden_dim = 64 -num_experts = 5 -output_dim = 1 - -# Create model -model = EnhancedMoEModel( - input_dim=input_dim, - hidden_dim=hidden_dim, - num_experts=num_experts, - output_dim=output_dim, - use_hard_clustering=True # Use hard clustering during training -) - -# Compile model -model.compile( - optimizer='adam', - loss='binary_crossentropy', - metrics=['accuracy'] -) - -# Generate sample data -import numpy as np - -# Sample features -X = np.random.random((100, input_dim)) - -# Sample clustering values (soft clustering, sums to 1 for each sample) -clusters = np.random.random((100, num_experts)) -clusters = clusters / clusters.sum(axis=1, keepdims=True) - -# Sample labels -y = np.random.randint(0, 2, (100, output_dim)) - -# Train model -model.fit( - x=(X, clusters), - y=y, - epochs=5, - batch_size=32 -) - -# Prediction (will use soft clustering automatically) -predictions = model.predict( - x=(X, clusters) -) +# if __name__ == "__main__": +# # Generate dummy dataset with clustered data and labels for training +# num_train_samples = 8000 +# num_test_samples = 2000 +# feature_dim = 64 +# num_clusters = 32 +# +# # Function to generate dataset with specified parameters +# def generate_dataset(num_samples, feature_dim, num_clusters, epsilon=0.1): +# # Compute samples per cluster +# base_count = num_samples // num_clusters +# counts = [base_count + (1 if i < num_samples % num_clusters else 0) for i in range(num_clusters)] +# +# features_list = [] +# labels_list = [] +# cluster_probs_list = [] +# distributions = ['normal', 'uniform', 'gamma', 'poisson'] +# +# for c in range(num_clusters): +# cluster_count = counts[c] +# n0 = cluster_count // 2 +# n1 = cluster_count - n0 +# dist = distributions[(2 * c) % len(distributions)] +# print(f"Cluster {c}: {dist} distribution, {n0} samples 0, {n1} samples 1") +# +# if dist == 'normal': +# features_0 = tf.random.normal([n0, feature_dim], mean=c, stddev=1.0) +# elif dist == 'uniform': +# features_0 = tf.random.uniform([n0, feature_dim], minval=0, maxval=1) +# elif dist == 'gamma': +# features_0 = tf.random.gamma([n0, feature_dim], alpha=2.0, beta=1.0) +# elif dist == 'poisson': +# features_0 = tf.cast(tf.random.poisson([n0, feature_dim], lam=3), tf.float32) +# else: +# features_0 = tf.random.normal([n0, feature_dim], mean=c, stddev=1.0) +# +# if dist == 'normal': +# features_1 = tf.random.normal([n1, feature_dim], mean=c+0.5, stddev=1.5) +# elif dist == 'uniform': +# features_1 = tf.random.uniform([n1, feature_dim], minval=1, maxval=2) +# elif dist == 'gamma': +# features_1 = tf.random.gamma([n1, feature_dim], alpha=5.0, beta=2.0) +# elif dist == 'poisson': +# features_1 = tf.cast(tf.random.poisson([n1, feature_dim], lam=6), tf.float32) +# else: +# features_1 = tf.random.normal([n1, feature_dim], mean=c+0.5, stddev=1.5) +# +# features_i = tf.concat([features_0, features_1], axis=0) +# labels_i = tf.concat([tf.zeros([n0, 1], tf.int32), tf.ones([n1, 1], tf.int32)], axis=0) +# features_list.append(features_i) +# labels_list.append(labels_i) +# +# # Generate random cluster probabilities per sample +# cluster_indices = tf.fill([cluster_count], c) +# lam_value = tf.maximum(tf.cast(c, tf.float32) + 1.0, 1.0) +# noise = tf.cast(tf.random.poisson([cluster_count, num_clusters], lam=lam_value), tf.float32) +# noise = noise + epsilon +# probs = noise / (tf.reduce_sum(noise, axis=1, keepdims=True)) +# alpha = tf.random.uniform([cluster_count, 1], minval=0.5, maxval=0.8) +# probs = (1 - alpha) * probs + alpha * tf.one_hot(cluster_indices, num_clusters) +# probs = probs / tf.reduce_sum(probs, axis=1, keepdims=True) +# cluster_probs_list.append(probs) +# +# features = tf.concat(features_list, axis=0) +# labels = tf.concat(labels_list, axis=0) +# cluster_probs = tf.concat(cluster_probs_list, axis=0) +# +# # Shuffle dataset +# indices = tf.random.shuffle(tf.range(tf.shape(features)[0])) +# features = tf.gather(features, indices) +# labels = tf.gather(labels, indices) +# cluster_probs = tf.gather(cluster_probs, indices) +# +# return features, labels, cluster_probs +# +# # Generate training dataset +# print("\nGenerating training dataset...") +# train_features, train_labels, train_cluster_probs = generate_dataset( +# num_train_samples, feature_dim, num_clusters) +# +# # Generate separate test dataset +# print("\nGenerating test dataset...") +# test_features, test_labels, test_cluster_probs = generate_dataset( +# num_test_samples, feature_dim, num_clusters, epsilon=1) +# +# print(f"\nTraining labels min: {tf.reduce_min(train_labels)}, max: {tf.reduce_max(train_labels)}") +# print(f"Training labels head: {train_labels[:5]}") +# print(f"Test labels min: {tf.reduce_min(test_labels)}, max: {tf.reduce_max(test_labels)}") +# print(f"Test labels head: {test_labels[:5]}") +# +# # Visualize training dataset +# print("\nVisualizing training dataset...") +# visualize_dataset_analysis(train_features, train_labels, train_cluster_probs, +# raw_dot_plot=False, method='pca', feature_indices=(0, 1)) +# +# # Create training dataset +# train_dataset = tf.data.Dataset.from_tensor_slices( +# ((train_features, train_cluster_probs), train_labels) +# ).shuffle(1000).batch(64) +# +# # Create test dataset (no need to shuffle extensively) +# test_dataset = tf.data.Dataset.from_tensor_slices( +# ((test_features, test_cluster_probs), test_labels) +# ).batch(64) +# +# # Print info about test dataset +# for features, labels in test_dataset.take(1): +# print(f"\nTest features shape: {features[0].shape}, Test labels shape: {labels.shape}") +# print(f"Test features head: {features[0][:3]}") +# print(f"Test labels head: {labels[:3]}") +# +# # Create and compile model +# model = EnhancedMoEModel(feature_dim, hidden_dim=8, num_experts=num_clusters, use_hard_clustering=True) +# model.compile( +# optimizer=tf.keras.optimizers.Adam(learning_rate=0.001), +# loss=tf.keras.losses.BinaryCrossentropy(), +# metrics=['accuracy'], +# ) +# +# # Train model +# print("\nTraining model...") +# model.fit(train_dataset, epochs=20) +# +# # Evaluate on independent test set +# print("\nEvaluating on independent test set...") +# eval_results = model.evaluate(test_dataset) +# print(f"Evaluation results: {eval_results}") +# +# # Predict and analyze +# # test_batch = next(iter(test_dataset.take(1))) +# # predictions = model(test_batch[0], training=False) +# # print(f"Sample predictions shape: {predictions['prediction'].shape}") +# # print(f"Gate activations: {tf.reduce_mean(predictions['gates'], axis=0)}") +# +# # Test on a single sample +# for (feat, cluster_prob), label in test_dataset.unbatch().take(1): +# feat = tf.expand_dims(feat, 0) +# cluster_prob = tf.expand_dims(cluster_prob, 0) +# output = model((feat, cluster_prob), training=False) +# print("Single sample prediction:", output.numpy()[0], "True label:", label.numpy()) + +import tensorflow as tf +from tensorflow.keras import layers, Model, Sequential + +# --------------------------------------------------------------------------- # +# 1. Positional + projection layer for the peptide (21-dim per residue) # +# --------------------------------------------------------------------------- # +class PeptideEmbedding(layers.Layer): + """ + Projects peptide vectors (one-hot or 21-dim physicochemical) to embed_dim + and adds a learned positional embedding. + """ + def __init__(self, seq_len, embed_dim, **kwargs): + super().__init__(**kwargs) + self.embed_dim = embed_dim + self.seq_len = seq_len + self.proj = layers.Dense(embed_dim, use_bias=False, + name="peptide_proj") + self.pos_emb = layers.Embedding(input_dim=seq_len, + output_dim=embed_dim, + name="peptide_pos") + + def call(self, x): + # x: (batch, S, 21) + h = self.proj(x) # (batch, S, embed_dim) + pos = tf.range(self.seq_len) + pos = self.pos_emb(pos)[tf.newaxis, ...] # (1, S, embed_dim) + return h + pos # broadcast add + + +# --------------------------------------------------------------------------- # +# 2. Cross-attention transformer block # +# --------------------------------------------------------------------------- # +class CrossAttentionBlock(layers.Layer): + """ + Latent queries attend over peptide keys/values, followed by FFN + residuals. + """ + def __init__(self, embed_dim, num_heads, ff_dim, rate=0.1, **kwargs): + super().__init__(**kwargs) + self.attn = layers.MultiHeadAttention(num_heads=num_heads, + key_dim=embed_dim, + name="cross_attn") + self.ffn = Sequential([ + layers.Dense(ff_dim, activation="relu"), + layers.Dense(embed_dim) + ], name="ffn") + self.norm1 = layers.LayerNormalization(epsilon=1e-6) + self.norm2 = layers.LayerNormalization(epsilon=1e-6) + self.drop1 = layers.Dropout(rate) + self.drop2 = layers.Dropout(rate) + + def call(self, latent_q, pep_kv, pep_mask, training=False): + # Cross-attention: latent as queries, peptide as keys/values + # pep_mask: (B,S) => broadcast to (B, L, S) + attn_mask = tf.cast(pep_mask, dtype=tf.float32)[:, tf.newaxis, :] # (B, 1, S) + + z = self.attn(query=latent_q, key=pep_kv, value=pep_kv, attention_mask=attn_mask) + z = self.drop1(z, training=training) + x = self.norm1(latent_q + z) # residual + norm + + f = self.ffn(x) + f = self.drop2(f, training=training) + return self.norm2(x + f) # residual + norm + + +# --------------------------------------------------------------------------- # +# 3. Build the complete classifier # +# --------------------------------------------------------------------------- # +def build_classifier(seq_len, + embed_dim = 256, + num_heads = 8, + ff_dim = 512, + dropout_rate = 0.1): + # --- Inputs ------------------------------------------------------------- + peptide_in = layers.Input(shape=(seq_len, 21), name="peptide") # (B, S, 21) + latent_in = layers.Input(shape=(36, 1152), name="latent_raw") # (B, 36, 1152) + + # --- Projections -------------------------------------------------------- + pep_mask = tf.reduce_any(peptide_in > 0, axis=-1) # bool (B,S) + pep_emb = PeptideEmbedding(seq_len, embed_dim)(peptide_in) # (B, S, D) + + latent_proj = layers.Dense(embed_dim, use_bias=False, + name="latent_proj")(latent_in) # (B, 36, D) + + # --- Cross-attention fusion -------------------------------------------- + x = CrossAttentionBlock(embed_dim, num_heads, ff_dim, + rate=dropout_rate)(latent_proj, pep_emb, pep_mask) # (B, 36, D) + + # --- Pool & prediction head -------------------------------------------- + x = layers.GlobalAveragePooling1D(name="pool")(x) # (B, D) + x = layers.Dropout(dropout_rate)(x) + out = layers.Dense(1, activation="sigmoid", name="output")(x) # (B, 1) + + # --- Compile the model ------------------------------------------------- + + model = Model(inputs=[peptide_in, latent_in], outputs=out, + name="peptide_latent_classifier") + model.compile(optimizer="adam", + loss="binary_crossentropy", + metrics=[tf.keras.metrics.AUC(name="auc"), + tf.keras.metrics.BinaryAccuracy(name="acc")]) + return model + + +# --------------------------------------------------------------------------- # +# 4. Demo: instantiate and inspect # +# --------------------------------------------------------------------------- # +# if __name__ == "__main__": +# SEQ_LEN = 15 # typical peptide length (adjust to your data) +# +# model = build_classifier(seq_len=SEQ_LEN) +# model.summary() +# +# # Training example (dummy): +# peptide_batch = tf.random.uniform((320, SEQ_LEN, 21)) +# latent_batch = tf.random.uniform((320, 36, 1152)) +# labels = tf.random.uniform((320, 1), maxval=2, dtype=tf.int32) +# model.fit([peptide_batch, latent_batch], labels, epochs=100) + From 702983c5fadd9d644772facf098c4ad98373cab3 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 27 May 2025 18:29:38 +0200 Subject: [PATCH 46/83] Enhance ESM dataset handling and model training: implement stratified k-fold cross-validation, improve data loading with consistent sequence lengths, and add evaluation metrics visualization for test datasets --- src/run_pMHC_DL_ESM.py | 518 ++++++++++++++++++++++++++++------ utils/create_ESM_dataset.py | 30 +- utils/processing_functions.py | 306 ++++++++++++++------ 3 files changed, 676 insertions(+), 178 deletions(-) diff --git a/src/run_pMHC_DL_ESM.py b/src/run_pMHC_DL_ESM.py index 41050c92e..494fe5bc7 100644 --- a/src/run_pMHC_DL_ESM.py +++ b/src/run_pMHC_DL_ESM.py @@ -1,6 +1,5 @@ #!/usr/bin/env python """ -mhc_crossattn_pipeline.py ========================= End‑to‑end trainer for a **peptide×MHC cross‑attention classifier**. @@ -36,6 +35,8 @@ from sklearn.model_selection import train_test_split from tqdm import tqdm from utils.model import build_classifier +from sklearn.metrics import confusion_matrix, roc_curve, auc, roc_auc_score +import seaborn as sns # --------------------------------------------------------------------------- # Utility: peptide → one‑hot (seq_len, 21) @@ -89,9 +90,9 @@ def load_dataset(parquet_path: str): # 1) Peptide one‑hot ---------------------------------------------------- if "long_mer" not in df.columns: raise ValueError("Expected a 'long_mer' column with peptide sequences") - seq_len = int(df["long_mer"].str.len().max()) - print(f" longest peptide = {seq_len} residues") - pep_onehot = peptides_to_onehot(df["long_mer"].tolist(), seq_len) + pep_seq_len = int(df["long_mer"].str.len().max()) + print(f" longest peptide = {pep_seq_len} residues") + pep_onehot = peptides_to_onehot(df["long_mer"].tolist(), pep_seq_len) print(" peptide one-hot shape:", pep_onehot.shape) # 2) Latent embeddings -------------------------------------------------- @@ -110,48 +111,59 @@ def load_dataset(parquet_path: str): # 3) Labels ------------------------------------------------------------- labels = df["assigned_label"].astype("float32").values[:, None] # (N,1) - return pep_onehot, latents, labels, seq_len + return pep_onehot, latents, labels, pep_seq_len -def load_dataset_in_batches(parquet: str, batch_size: int = 100): +def load_dataset_in_batches(parquet: str, target_seq_len: int, batch_size: int = 100): print(f"→ reading {parquet} in batches of {batch_size}") df = pd.read_parquet(parquet) if "long_mer" not in df.columns: raise ValueError("Expected a 'long_mer' column with peptide sequences") - seq_len = int(df["long_mer"].str.len().max()) + # REMOVE or IGNORE: pep_seq_len = int(df["long_mer"].str.len().max()) # This was the problematic line for one-hot encoding total = len(df) for start in range(0, total, batch_size): end = min(start + batch_size, total) - pep_onehot = peptides_to_onehot(df["long_mer"].values[start:end].tolist(), seq_len) + # Use target_seq_len for one-hot encoding + pep_onehot = peptides_to_onehot(df["long_mer"].values[start:end].tolist(), target_seq_len) if "mhc_embedding" in df.columns: latents = np.stack(df["mhc_embedding"].values[start:end]).astype("float32") elif "mhc_embedding_path" in df.columns: - latents = np.stack([_read_embedding_file(p) for p in tqdm(df["mhc_embedding_path"].values[start:end], - desc=f"Loading embeddings {start}-{end}")]) + latents = np.stack([_read_embedding_file(p) for p in df["mhc_embedding_path"].values[start:end]]) else: raise ValueError("Need a 'mhc_embedding' or 'mhc_embedding_path' column") + + if latents.shape[1:] != (36, 1152): + raise ValueError(f"Unexpected latent shape {latents.shape[1:]}, expected (36,1152)") + labels = df["assigned_label"].values[start:end].astype("float32") - yield pep_onehot, latents, labels, seq_len + labels = labels[:, None] + + yield pep_onehot, latents, labels # Removed the local pep_seq_len from yield + # --------------------------------------------------------------------------- # Visualisation utility # --------------------------------------------------------------------------- -def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_id: int = None): +def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_id: int = None, + model=None, val_dataset=None): """ - Plot training curves from a Keras history object. + Plot training curves and validation metrics from a Keras history object. + Args: history: Keras history object containing training metrics. run_dir: Directory to save the plot. fold_id: Optional fold identifier for naming the output file. + model: Optional model to compute confusion matrix and ROC curve. + val_dataset: Optional validation dataset to generate predictions. Returns: None - """ hist = history.history - plt.figure(figsize=(21, 4)) + plt.figure(figsize=(21, 6)) - plt.subplot(1, 3, 1) + # Plot 1: Loss curve + plt.subplot(1, 4, 1) plt.plot(hist["loss"], label="train") plt.plot(hist["val_loss"], label="val") plt.xlabel("epoch") @@ -160,8 +172,9 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.legend() plt.grid(True) + # Plot 2: Accuracy curve if "binary_accuracy" in hist and "val_binary_accuracy" in hist: - plt.subplot(1, 3, 2) + plt.subplot(1, 4, 2) plt.plot(hist["binary_accuracy"], label="train acc") plt.plot(hist["val_binary_accuracy"], label="val acc") plt.xlabel("epoch") @@ -170,8 +183,9 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.legend() plt.grid(True) + # Plot 3: AUC curve if "auc" in hist and "val_auc" in hist: - plt.subplot(1, 3, 3) + plt.subplot(1, 4, 3) plt.plot(hist["auc"], label="train AUC") plt.plot(hist["val_auc"], label="val AUC") plt.xlabel("epoch") @@ -180,23 +194,277 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.legend() plt.grid(True) - out_png = os.path.join(run_dir, f"training_curve{'_fold' + str(fold_id) if fold_id is not None else ''}.png") + # Plot 4: Confusion matrix + if model is not None and val_dataset is not None: + plt.subplot(1, 4, 4) + + try: + # Collect validation predictions and true labels simultaneously + y_true_list = [] + y_pred_proba_list = [] + + for features, labels in val_dataset: + y_true_list.append(labels.numpy()) + batch_pred = model(features, training=False).numpy() + y_pred_proba_list.append(batch_pred) + + y_true = np.concatenate(y_true_list, axis=0).flatten() + y_pred_proba = np.concatenate(y_pred_proba_list, axis=0).flatten() + # print min, max, mean of y_pred_proba + print(f"y_pred_proba: min={y_pred_proba.min():.4f}, max={y_pred_proba.max():.4f}, mean={y_pred_proba.mean():.4f}") + y_pred = (y_pred_proba > 0.5).astype(int) + + # Compute confusion matrix + cm = confusion_matrix(y_true, y_pred) + + # Plot confusion matrix + sns.heatmap(cm, annot=True, fmt="d", cmap="Blues", + xticklabels=["Negative", "Positive"], + yticklabels=["Negative", "Positive"]) + plt.xlabel("Predicted") + plt.ylabel("True") + plt.title(f"Confusion Matrix\nAUROC: {roc_auc_score(y_true, y_pred_proba):.4f}") + except Exception as e: + print(f"Warning: could not generate confusion matrix: {e}") + + # Save main plot + plt.figure(1) plt.tight_layout() + out_png = os.path.join(run_dir, f"training_curve{'_fold' + str(fold_id) if fold_id is not None else ''}.png") plt.savefig(out_png) plt.show() print(f"✓ Training curve saved to {out_png}") +def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, history=None): + """ + Plot comprehensive evaluation metrics for a test dataset using a trained model. + + Args: + model: Trained Keras model. + test_dataset: TensorFlow dataset for testing. + run_dir: Directory to save the plot. + fold_id: Optional fold identifier for naming the output file. + history: Optional training history object to display loss/accuracy curves. + + Returns: None + """ + # Collect predictions + y_true_list = [] + y_pred_proba_list = [] + + for features, labels in test_dataset: + y_true_list.append(labels.numpy()) + batch_pred = model(features, training=False).numpy() + y_pred_proba_list.append(batch_pred) + + y_true = np.concatenate(y_true_list, axis=0) + y_pred_proba = np.concatenate(y_pred_proba_list, axis=0) + # print min, max, mean of y_pred_proba + print(f"y_pred_proba: min={y_pred_proba.min():.4f}, max={y_pred_proba.max():.4f}, mean={y_pred_proba.mean():.4f}") + y_pred = (y_pred_proba > 0.5).astype(int) + + # Create a multi-panel figure + plt.figure(figsize=(20, 12)) + + # Panel 1: ROC Curve + plt.subplot(2, 2, 1) + fpr, tpr, _ = roc_curve(y_true, y_pred_proba) + roc_auc = auc(fpr, tpr) + plt.plot(fpr, tpr, color='blue', label=f'ROC curve (area = {roc_auc:.4f})') + plt.plot([0, 1], [0, 1], color='red', linestyle='--') + plt.xlim([0.0, 1.0]) + plt.ylim([0.0, 1.05]) + plt.xlabel('False Positive Rate') + plt.ylabel('True Positive Rate') + plt.title('ROC Curve') + plt.legend(loc='lower right') + + # Panel 2: Confusion Matrix + plt.subplot(2, 2, 2) + cm = confusion_matrix(y_true.flatten(), y_pred.flatten()) + sns.heatmap(cm, annot=True, fmt="d", cmap="Blues", + xticklabels=["Negative", "Positive"], + yticklabels=["Negative", "Positive"]) + plt.xlabel("Predicted") + plt.ylabel("True") + plt.title("Confusion Matrix") + + # Panel 3: Loss curve (if history provided) + if history is not None: + plt.subplot(2, 2, 3) + hist = history.history + plt.plot(hist.get("loss", []), label="train") + plt.plot(hist.get("val_loss", []), label="val") + plt.xlabel("epoch") + plt.ylabel("loss") + plt.title("BCE Loss") + plt.legend() + plt.grid(True) + + # Panel 4: Accuracy curve (if available in history) + plt.subplot(2, 2, 4) + if "binary_accuracy" in hist and "val_binary_accuracy" in hist: + plt.plot(hist["binary_accuracy"], label="train acc") + plt.plot(hist["val_binary_accuracy"], label="val acc") + elif "accuracy" in hist and "val_accuracy" in hist: + plt.plot(hist["accuracy"], label="train acc") + plt.plot(hist["val_accuracy"], label="val acc") + plt.xlabel("epoch") + plt.ylabel("accuracy") + plt.title("Accuracy") + plt.legend() + plt.grid(True) + else: + # Panel 3: Test metrics when history not available + plt.subplot(2, 2, 3) + from sklearn.metrics import precision_score, recall_score, f1_score, accuracy_score + + accuracy = accuracy_score(y_true, y_pred) + precision = precision_score(y_true, y_pred, zero_division=0) + recall = recall_score(y_true, y_pred, zero_division=0) + f1 = f1_score(y_true, y_pred, zero_division=0) + + metrics = { + 'Accuracy': accuracy, + 'Precision': precision, + 'Recall': recall, + 'F1 Score': f1, + 'AUC': roc_auc + } + + # Create a bar chart for metrics + plt.bar(range(len(metrics)), list(metrics.values()), align='center') + plt.xticks(range(len(metrics)), list(metrics.keys()), rotation=45) + plt.ylim(0, 1.0) + plt.title('Test Set Evaluation Metrics') + + # Add values on top of bars + for i, v in enumerate(metrics.values()): + plt.text(i, v + 0.02, f'{v:.4f}', ha='center') + + plt.tight_layout() + out_png = os.path.join(run_dir, f"test_metrics{'_fold' + str(fold_id) if fold_id is not None else ''}.png") + plt.savefig(out_png) + plt.show() + print(f"✓ Test metrics visualization saved to {out_png}") + + # Return evaluation metrics as dictionary for possible further use + return { + 'roc_auc': roc_auc, + 'accuracy': accuracy_score(y_true, y_pred), + 'precision': precision_score(y_true, y_pred, zero_division=0), + 'recall': recall_score(y_true, y_pred, zero_division=0), + 'f1': f1_score(y_true, y_pred, zero_division=0) + } + # --------------------------------------------------------------------------- # TF‑data helper # --------------------------------------------------------------------------- -def make_tf_dataset(peps, lats, labels, batch=128, shuffle=True): - ds = tf.data.Dataset.from_tensor_slices(((peps, lats), labels)) - if shuffle: - ds = ds.shuffle(buffer_size=len(labels), seed=42) - return ds.batch(batch).prefetch(tf.data.AUTOTUNE) - +def make_tf_dataset(source, longest_peptide_seq_length, batch: int = 128, shuffle: bool = True): + if isinstance(source, (str, os.PathLike)): + def gen(): + # Pass longest_peptide_seq_length as target_seq_len + # The generator now yields 3 items + for peps, lats, labs in load_dataset_in_batches(str(source), + target_seq_len=longest_peptide_seq_length, + batch_size=batch): + yield (peps, lats), labs + output_signature = ( + (tf.TensorSpec(shape=(None, longest_peptide_seq_length, 21), dtype=tf.float32), + tf.TensorSpec(shape=(None, 36, 1152), dtype=tf.float32)), + tf.TensorSpec(shape=(None, 1), dtype=tf.float32) + ) + ds = tf.data.Dataset.from_generator(gen, output_signature=output_signature) + if shuffle: + # Consider increasing buffer_size for better shuffling if dataset is large + # e.g., buffer_size=num_batches_in_epoch or a sufficiently large number + ds = ds.shuffle(buffer_size=max(10, len(pd.read_parquet(str(source))) // batch // 2 ), seed=42) + return ds.prefetch(tf.data.AUTOTUNE) + else: # This part for in-memory dataframes seems correct as it uses longest_peptide_seq_length + peps = peptides_to_onehot(source["long_mer"].tolist(), longest_peptide_seq_length) + labels = source["assigned_label"].values.astype("float32")[:, None] + + if "mhc_embedding" in source.columns: + lats = np.stack(source["mhc_embedding"].values).astype("float32") + elif "mhc_embedding_path" in source.columns: + lats = np.stack([_read_embedding_file(p) for p in source["mhc_embedding_path"]]).astype("float32") + else: + raise ValueError("Need 'mhc_embedding' or 'mhc_embedding_path' column") + + ds = tf.data.Dataset.from_tensor_slices(((peps, lats), labels)) + if shuffle: + ds = ds.shuffle(buffer_size=len(labels), seed=42) + return ds.batch(batch).prefetch(tf.data.AUTOTUNE) + + # peps = source["long_mer"] + # labels = source["assigned_label"] + # lats = np.stack([np.load(p) for p in source["mhc_embedding_path"]]).astype("float32") + # ds = tf.data.Dataset.from_tensor_slices(((peps, lats), labels)) + # if shuffle: + # ds = ds.shuffle(buffer_size=len(labels), seed=42) + # return ds.batch(batch).prefetch(tf.data.AUTOTUNE) + + +# def _collect_batches(loader, max_batch_size: int = 3_000): +# ''' +# Concatenate a lazy *loader* (yielding pep, latent, label, seq_len) +# into single large NumPy arrays **with just one final copy**. +# +# On each iteration we append references to the individual batch arrays; +# only at the very end do we *concatenate* along axis0. This strategy is +# RAM‑friendly because the intermediate lists only hold *views* of the +# already‑allocated batch memory while the batches are alive, and we avoid +# the O(N²) cost of repeated `np.concatenate` calls inside the loop. +# +# If the total number of samples reaches *max_batch_size*, stop loading more. +# ''' +# pep_chunks, lat_chunks, lab_chunks = [], [], [] +# seq_len = None +# total = 0 +# +# for peps, lats, labels, seq_len in loader: +# n = len(peps) +# if total + n > max_batch_size: +# # Only take up to the limit +# take = max_batch_size - total +# if take <= 0: +# break +# pep_chunks.append(peps[:take]) +# lat_chunks.append(lats[:take]) +# labels = labels[:take] +# labels = labels.reshape(-1, 1) if labels.ndim == 1 else labels +# lab_chunks.append(labels) +# total += take +# break +# pep_chunks.append(peps) +# lat_chunks.append(lats) +# labels = labels.reshape(-1, 1) if labels.ndim == 1 else labels +# lab_chunks.append(labels) +# total += n +# if total >= max_batch_size: +# break +# +# # single allocation per tensor ↓ +# peps = np.concatenate(pep_chunks, axis=0, dtype=np.float32) +# lats = np.concatenate(lat_chunks, axis=0, dtype=np.float32) +# labels = np.concatenate(lab_chunks, axis=0, dtype=np.float32) +# +# # explicitly free the now‑unneeded small arrays +# del pep_chunks, lat_chunks, lab_chunks +# return peps, lats, labels, seq_len + +# convenience wrappers ------------------------------------------------------- + +# def collect_parquet(parquet_path: str, batch_size: int = 30_000): +# '''Load **all** samples in *parquet_path* using streaming batches.''' +# loader = load_dataset_in_batches(parquet_path, batch_size=batch_size) +# return _collect_batches(loader) +# +# +# def collect_fold(fold_path: str, batch_size: int = 3_000): +# return collect_parquet(fold_path, batch_size=batch_size) # --------------------------------------------------------------------------- # Training script @@ -223,8 +491,7 @@ def main(argv=None): # ----------------------- Load & split ---------------------------------- if args.parquet: # peps, lats, labels, seq_len = load_dataset(args.parquet) - batch_loader = load_dataset_in_batches(args.parquet, batch_size=30000) - peps, lats, labels, seq_len = next(batch_loader) + peps, lats, labels, longest_peptide_seq_length = load_dataset(args.parquet) print(f"✓ loaded {len(peps):,} samples" f" ({peps.shape[1]} residues, {lats.shape[1]} latent features)") @@ -235,32 +502,58 @@ def main(argv=None): random_state=42, stratify=labels) - train_ds = make_tf_dataset(X_train_p, X_train_l, y_train, batch=args.batch) - val_ds = make_tf_dataset(X_val_p, X_val_l, y_val, batch=args.batch, - shuffle=False) + train_loader = make_tf_dataset((X_train_p, X_train_l, y_train), longest_peptide_seq_length=longest_peptide_seq_length, batch=args.batch, shuffle=True) + val_loader = make_tf_dataset((X_val_p, X_val_l, y_val), longest_peptide_seq_length=longest_peptide_seq_length ,batch=args.batch, shuffle=False) + elif args.dataset_path: - # load test sets + # Load test sets test1 = pd.read_parquet(args.dataset_path + "/test1.parquet") test2 = pd.read_parquet(args.dataset_path + "/test2.parquet") - num_fold = os.listdir(args.dataset_path + "/folds") + fold_files = sorted([f for f in os.listdir(os.path.join(args.dataset_path, 'folds')) if f.endswith('.parquet')]) + n_folds = len(fold_files) // 2 + + # Find the longest peptide sequence across all datasets + longest_peptide_seq_length = 0 + + # Check test datasets + if "long_mer" in test1.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(test1["long_mer"].str.len().max())) + if "long_mer" in test2.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(test2["long_mer"].str.len().max())) + + # Check all fold files + for i in range(1, n_folds + 1): + train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') + val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') + + train_df = pd.read_parquet(train_path) + val_df = pd.read_parquet(val_path) + + if "long_mer" in train_df.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(train_df["long_mer"].str.len().max())) + if "long_mer" in val_df.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(val_df["long_mer"].str.len().max())) + + print(f"✓ Longest peptide sequence length across all datasets: {longest_peptide_seq_length}") + + # Create fold datasets with consistent sequence length folds = [] - for i in range(1, len(num_fold) // 2 + 1): - train_path = args.dataset_path + f"/folds/fold_{i}_train.parquet" - val_path = args.dataset_path + f"/folds/fold_{i}_val.parquet" - train_loader = load_dataset_in_batches(train_path, batch_size=3000) - val_loader = load_dataset_in_batches(val_path, batch_size=3000) - - X_train_p, X_train_l, y_train, seq_len = next(train_loader) - X_val_p, X_val_l, y_val, _ = next(val_loader) - train_ds = make_tf_dataset(X_train_p, X_train_l, y_train, batch=args.batch) - val_ds = make_tf_dataset(X_val_p, X_val_l, y_val, batch=args.batch, shuffle=False) - folds.append((train_ds, val_ds)) + for i in range(1, n_folds + 1): + train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') + val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') + + train_loader = make_tf_dataset(train_path, longest_peptide_seq_length=longest_peptide_seq_length, batch=args.batch) + val_loader = make_tf_dataset(val_path, longest_peptide_seq_length=longest_peptide_seq_length, batch=args.batch, shuffle=False) + + folds.append((train_loader, val_loader)) + + # Create test loaders with the same sequence length + test1_loader = make_tf_dataset(test1, longest_peptide_seq_length=longest_peptide_seq_length, batch=args.batch, shuffle=False) + test2_loader = make_tf_dataset(test2, longest_peptide_seq_length=longest_peptide_seq_length, batch=args.batch, shuffle=False) print(f"✓ loaded {len(test1):,} test1 samples, " f"{len(test2):,} test2 samples, " f"{len(folds)} folds") - - else: raise ValueError("Need either --parquet or --dataset_path argument") @@ -270,68 +563,119 @@ def main(argv=None): # set random seeds for reproducibility os.environ["PYTHONHASHSEED"] = "42" os.environ["TF_DETERMINISTIC_OPS"] = "1" - - tf.random.set_seed(42); + tf.random.set_seed(42) np.random.seed(42) - model = build_classifier(seq_len) - model.summary() + # # Verify and explicitly pad/trim to match training seq_len + # if test1_seq_len != seq_len or test2_seq_len != seq_len: + # print(f"Adjusting test datasets to match training seq_len: {seq_len}") + # X_test1_p = X_test1_p[:, :seq_len, :] + # X_test2_p = X_test2_p[:, :seq_len, :] + # + # # Pad or trim test peptides to match seq_len + # X_test1_p = X_test1_p[:, :seq_len, :] + # X_test2_p = X_test2_p[:, :seq_len, :] + # test1_ds = make_tf_dataset(X_test1_p, X_test1_l, y_test1, batch=args.batch, shuffle=False) + # test2_ds = make_tf_dataset(X_test2_p, X_test2_l, y_test2, batch=args.batch, shuffle=False) + + # print(f'✓ loaded {len(test1):,} test1 samples, ' + # f'{len(test2):,} test2 samples, ' + # f'{len(folds)} folds') + # + # print("★ Done.") + # # TODO think about ensembling folds later + # + # else: + # raise ValueError("Need either --parquet or --dataset_path argument") + + # ------------------------- TRAIN -------------------------------------- ckpt_cb = tf.keras.callbacks.ModelCheckpoint( - filepath=os.path.join(run_dir, "best_weights.h5"), - monitor="val_loss", save_best_only=True, mode="min") + filepath=os.path.join(run_dir, 'best_weights.h5'), + monitor='val_loss', save_best_only=True, mode='min') early_cb = tf.keras.callbacks.EarlyStopping( - monitor="val_loss", patience=10, restore_best_weights=True) + monitor='val_loss', patience=10, restore_best_weights=True) if args.parquet: - history = model.fit(train_ds, - validation_data=val_ds, + tf.keras.backend.clear_session() + os.environ['PYTHONHASHSEED'] = '42' + os.environ['TF_DETERMINISTIC_OPS'] = '1' + model = build_classifier(longest_peptide_seq_length) + model.summary() + + + history = model.fit(train_loader, + validation_data=val_loader, epochs=args.epochs, callbacks=[ckpt_cb, early_cb]) - # ----------------------- Plot curve ------------------------------------ - plot_training_curve(history, run_dir) - # ----------------------- Save model & metadata ------------------------ - meta = dict(parquet=args.parquet, - epochs=len(history["loss"]), - batch=args.batch, - seq_len=seq_len, - model_params=dict(embed_dim=256, num_heads=8, ff_dim=512)) - json.dump(meta, open(os.path.join(run_dir, "run_config.json"), "w"), indent=2) - print("★ Done.") + + # plot + plot_training_curve(history, run_dir, fold_id=None, model=model, val_dataset=val_loader) + + # save model and metadata + model.save(os.path.join(run_dir, 'model.h5')) + metadata = { + "epochs": args.epochs, + "batch_size": args.batch, + "longest_peptide_seq_length": longest_peptide_seq_length, + "run_dir": run_dir + } + with open(os.path.join(run_dir, 'metadata.json'), 'w') as f: + json.dump(metadata, f, indent=4) + elif args.dataset_path: - # Train on folds - for i, (train_ds, val_ds) in enumerate(folds): - print(f"Training on fold {i + 1}/{len(folds)}") - # clear GPU memory + for fold_id, (train_loader, val_loader) in enumerate(folds, start=1): + print(f'Training on fold {fold_id}/{len(folds)}') tf.keras.backend.clear_session() - # set random seeds for reproducibility - tf.random.set_seed(42); + tf.random.set_seed(42) np.random.seed(42) - model = build_classifier(seq_len) # Rebuild model for each fold + print("########################### seq length: ", longest_peptide_seq_length) + model = build_classifier(longest_peptide_seq_length) + model.summary() + + # print one sample + # print("Sample input shape:", next(iter(train_loader))[0][0].shape) + # print("Sample latent shape:", next(iter(train_loader))[0][1].shape) + # print("Sample label shape:", next(iter(train_loader))[1].shape) - history = model.fit(train_ds, - validation_data=val_ds, + history = model.fit(train_loader, + validation_data=val_loader, epochs=args.epochs, callbacks=[ckpt_cb, early_cb]) - # Save fold metadata - fold_meta = dict(fold_id=i + 1, epochs=len(history.history["loss"]), - batch=args.batch, seq_len=seq_len) - json.dump(fold_meta, open(os.path.join(run_dir, f"fold_{i + 1}_config.json"), "w"), indent=2) - - # ----------------------- Plot training curve --------------------------- - plot_training_curve(history, run_dir) - - print("★ Done.") - # TODO think about ensembling folds later - - else: - raise ValueError("Need either --parquet or --dataset_path argument") + # plot + plot_training_curve(history, run_dir, fold_id, model, val_loader) + + # save model and metadata + model.save(os.path.join(run_dir, f'model_fold_{fold_id}.h5')) + metadata = { + "fold_id": fold_id, + "epochs": args.epochs, + "batch_size": args.batch, + "seq_len": longest_peptide_seq_length, + "run_dir": run_dir + } + with open(os.path.join(run_dir, f'metadata_fold_{fold_id}.json'), 'w') as f: + json.dump(metadata, f, indent=4) + print(f"✓ Fold {fold_id} model saved to {run_dir}") + + # Evaluate on test sets + print("Evaluating on test1 set...") + test1_results = model.evaluate(test1_loader, verbose=1) + print(f"Test1 results: {test1_results}") + print("Evaluating on test2 set...") + test2_results = model.evaluate(test2_loader, verbose=1) + print(f"Test2 results: {test2_results}") + + # Plot ROC curve for test1 + plot_test_metrics(model, test1_loader, run_dir, fold_id) + # Plot ROC curve for test2 + plot_test_metrics(model, test2_loader, run_dir, fold_id) if __name__ == "__main__": main([ # "--parquet", "../data/Custom_dataset/NetMHCpan_dataset/mhc2_with_esm_embeddings.parquet", "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_1", - "--epochs", "100", "--batch", "128" + "--epochs", "3", "--batch", "1024" ]) \ No newline at end of file diff --git a/utils/create_ESM_dataset.py b/utils/create_ESM_dataset.py index 7b2509fc5..e81046a03 100644 --- a/utils/create_ESM_dataset.py +++ b/utils/create_ESM_dataset.py @@ -15,7 +15,7 @@ import pandas as pd from tqdm import tqdm # progress bars from typing import Dict -from processing_functions import create_progressive_k_fold_cross_validation +from processing_functions import create_progressive_k_fold_cross_validation, create_k_fold_leave_one_out_stratified_cv # --------------------------------------------------------------------- # 1. CONFIGURATION – adjust if your paths change @@ -168,11 +168,17 @@ def create_test_set(df: pd.DataFrame, samples_per_label: int=10000) -> dict[str, # test2: remove lowest-frequency allele from train to form test2 allele_counts = datasets['train']['allele'].value_counts() - lowest_allele = allele_counts.idxmin() - test2 = datasets['train'][datasets['train']['allele'] == lowest_allele].copy() + n_test2_samples = 0 + i = 1 + while n_test2_samples < 1000: + i += 1 + lowest_alleles = allele_counts.nsmallest(n=i).index.tolist() + test2 = datasets['train'][datasets['train']['allele'].isin(lowest_alleles)].copy() + n_test2_samples = test2.shape[0] + datasets['train'] = ( datasets['train'] - [datasets['train']['allele'] != lowest_allele] + [datasets['train']['allele'].isin(lowest_alleles) == False] .reset_index(drop=True) ) datasets['test2'] = test2 @@ -190,6 +196,9 @@ def main() -> None: # filter out df = df[df["mhc_class"] == mhc_class] + # drop mhc_class column + df = df.drop(columns=["mhc_class"]) + print(f"→ Loading MHC class {mhc_class} embeddings") emb_dict = load_mhc1_embeddings(NPZ_PATH) @@ -200,6 +209,11 @@ def main() -> None: df = df.drop_duplicates(subset=["long_mer", "allele"]) df = df.dropna(subset=["long_mer"]) + # move the label column to the end + label_col = "assigned_label" + cols = [col for col in df.columns if col != label_col] + [label_col] + df = df[cols] + print(f"→ Writing parquet to {OUT_PARQUET}") df.to_parquet(OUT_PARQUET, engine="pyarrow", index=False, compression="zstd") @@ -214,11 +228,12 @@ def main() -> None: print("→ Creating cross-validation folds") - folds = create_progressive_k_fold_cross_validation( + folds = create_k_fold_leave_one_out_stratified_cv( datasets['train'], target_col="assigned_label", k=5, id_col="allele", + balance_method="down_sampling", ) print("→ Saving folds to CSV") @@ -235,7 +250,10 @@ def main() -> None: val_df.to_parquet(val_path, index=False, engine="pyarrow", compression="zstd") print(f"Saved fold {fold_id} train to {train_path}") print(f"Saved fold {fold_id} val to {val_path}") - ids_str = ", ".join(map(str, validation_ids)) + if isinstance(validation_ids, list): + ids_str = ", ".join(map(str, validation_ids)) + else: + ids_str = str(validation_ids) with open(held_out_ids_path, "a") as f: f.write(f"Fold {fold_id}: {ids_str}\n") diff --git a/utils/processing_functions.py b/utils/processing_functions.py index 0e25e07a5..3cbce3b67 100644 --- a/utils/processing_functions.py +++ b/utils/processing_functions.py @@ -17,6 +17,8 @@ sys.path.append(os.path.abspath(os.path.join(os.path.dirname(__file__), '..'))) from user_setting import netmhcipan_path, netmhciipan_path, pmgen_abs_dir from sklearn.model_selection import train_test_split +from sklearn.model_selection import GroupShuffleSplit, StratifiedShuffleSplit +from sklearn.utils import resample def process_dataframe(df): # Step 1: Sort IDs with 2 or 5 parts @@ -1147,101 +1149,235 @@ def create_progressive_k_fold_cross_validation(df, k=5, target_col="Label", id_c # write a function that produces 5 fold cross validation from the df, each fold must have one allele to be left out completely and produce a stratified train and validation based on the label. # take into account the subset proportion. -def create_k_fold_leave_one_out_stratified_cross_validation(df, k=5, target_col="label", id_col="allele", - subset_prop=1.0, train_size=0.8, random_state=42): +# def create_k_fold_leave_one_out_stratified_cross_validation(df, k=5, target_col="label", id_col="allele", +# subset_prop=1.0, train_size=0.8, random_state=42): +# """ +# Creates k folds for cross-validation where each fold: +# 1. Leaves one unique ID out completely +# 2. Has a validation set with at least one unique allele not present in the training set +# 3. Splits the remaining data into stratified train/validation sets +# 4. Balances both train and validation sets based on target labels +# +# Args: +# df (pd.DataFrame): The input dataframe. +# k (int): The number of folds. +# target_col (str): The name of the column containing the target labels for stratification. +# id_col (str): The name of the column containing the IDs (alleles) to leave out. +# subset_prop (float): The proportion of the remaining data to use. +# train_size (float): The proportion of the non-held-out data to use for training. +# random_state (int): Random state for reproducibility. +# +# Returns: +# list: A list of tuples, where each tuple contains (train_df, val_df, left_out_id) for a fold. +# """ +# # Take a subset of the dataframe +# df = df.sample(frac=subset_prop, random_state=random_state) +# +# # Get unique IDs (alleles) +# unique_ids = df[id_col].unique() +# +# # Check if k is larger than the number of unique IDs +# if k > len(unique_ids): +# raise ValueError(f"k must be less than or equal to the number of unique IDs ({len(unique_ids)}).") +# +# # Set random seed for reproducibility +# np.random.seed(random_state) +# +# # Randomly select k IDs to leave out (one per fold) +# selected_ids = np.random.choice(unique_ids, k, replace=False) +# +# folds = [] +# for leave_out_id in selected_ids: +# print("leave out ID:", leave_out_id) +# # Create a mask for the ID to leave out +# leave_out_mask = df[id_col] == leave_out_id +# +# # Get remaining data (exclude the left out ID) +# remaining_df = df[~leave_out_mask].copy() +# +# # Get remaining unique IDs +# remaining_unique_ids = remaining_df[id_col].unique() +# +# # Select a validation-only ID (will only appear in validation set) +# val_only_id = np.random.choice(remaining_unique_ids, 1)[0] +# +# # Split data for unique validation ID and the rest +# val_only_mask = remaining_df[id_col] == val_only_id +# val_only_df = remaining_df[val_only_mask].copy() +# train_eligible_df = remaining_df[~val_only_mask].copy() +# +# # Create stratified split on the training-eligible data +# train_df, extra_val_df = train_test_split( +# train_eligible_df, +# train_size=train_size, +# stratify=train_eligible_df[target_col], +# random_state=random_state +# ) +# +# # Combine validation-only data with extra validation data +# val_df = pd.concat([val_only_df, extra_val_df], ignore_index=True) +# +# # Balance training set +# train_class_counts = train_df[target_col].value_counts() +# min_train_count = train_class_counts.min() +# balanced_train_dfs = [] +# +# for label in train_class_counts.index: +# label_df = train_df[train_df[target_col] == label] +# # Downsample to the minority class count +# balanced_label_df = label_df.sample(min_train_count, random_state=random_state) +# balanced_train_dfs.append(balanced_label_df) +# +# balanced_train_df = pd.concat(balanced_train_dfs, ignore_index=True) +# +# # Balance validation set +# val_class_counts = val_df[target_col].value_counts() +# min_val_count = val_class_counts.min() +# balanced_val_dfs = [] +# +# for label in val_class_counts.index: +# label_df = val_df[val_df[target_col] == label] +# # Downsample to the minority class count +# balanced_label_df = label_df.sample(min_val_count, random_state=random_state) +# balanced_val_dfs.append(balanced_label_df) +# +# balanced_val_df = pd.concat(balanced_val_dfs, ignore_index=True) +# +# # Include the left_out_id in the tuple +# folds.append((balanced_train_df, balanced_val_df, leave_out_id)) +# +# return folds + + +def create_k_fold_leave_one_out_stratified_cv( + df: pd.DataFrame, + k: int = 5, + target_col: str = "label", + id_col: str = "allele", + subset_prop: float = 1.0, + train_size: float = 0.8, + random_state: int = 42, + balance_method: str = "down_sampling" # "down_sampling" or "GNUSS" +): """ - Creates k folds for cross-validation where each fold: - 1. Leaves one unique ID out completely - 2. Has a validation set with at least one unique allele not present in the training set - 3. Splits the remaining data into stratified train/validation sets - 4. Balances both train and validation sets based on target labels - - Args: - df (pd.DataFrame): The input dataframe. - k (int): The number of folds. - target_col (str): The name of the column containing the target labels for stratification. - id_col (str): The name of the column containing the IDs (alleles) to leave out. - subset_prop (float): The proportion of the remaining data to use. - train_size (float): The proportion of the non-held-out data to use for training. - random_state (int): Random state for reproducibility. - - Returns: - list: A list of tuples, where each tuple contains (train_df, val_df, left_out_id) for a fold. + Build *k* folds such that + + 1. **One whole ID (group) is left out of both train & val** (`left_out_id`). + 2. **Validation contains exactly one additional ID** (`val_only_id`) + that never appears in train. + 3. Remaining rows are split *stratified* on `target_col` + (`train_size` fraction for training). + 4. Train & val are **down-sampled** to perfectly balanced label counts. + + Returns + ------- + list[tuple[pd.DataFrame, pd.DataFrame, Hashable]] + Each tuple = (train_df, val_df, left_out_id). """ - # Take a subset of the dataframe - df = df.sample(frac=subset_prop, random_state=random_state) + rng = np.random.RandomState(random_state) + df = df.sample(frac=subset_prop, random_state=random_state).reset_index(drop=True) - # Get unique IDs (alleles) + # --- pick the k IDs that will be held out completely ------------------- unique_ids = df[id_col].unique() - - # Check if k is larger than the number of unique IDs if k > len(unique_ids): - raise ValueError(f"k must be less than or equal to the number of unique IDs ({len(unique_ids)}).") - - # Set random seed for reproducibility - np.random.seed(random_state) - - # Randomly select k IDs to leave out (one per fold) - selected_ids = np.random.choice(unique_ids, k, replace=False) + raise ValueError(f"k={k} > unique {id_col} count ({len(unique_ids)})") + left_out_ids = rng.choice(unique_ids, size=k, replace=False) folds = [] - for leave_out_id in selected_ids: - print("leave out ID:", leave_out_id) - # Create a mask for the ID to leave out - leave_out_mask = df[id_col] == leave_out_id - - # Get remaining data (exclude the left out ID) - remaining_df = df[~leave_out_mask].copy() - - # Get remaining unique IDs - remaining_unique_ids = remaining_df[id_col].unique() - - # Select a validation-only ID (will only appear in validation set) - val_only_id = np.random.choice(remaining_unique_ids, 1)[0] - - # Split data for unique validation ID and the rest - val_only_mask = remaining_df[id_col] == val_only_id - val_only_df = remaining_df[val_only_mask].copy() - train_eligible_df = remaining_df[~val_only_mask].copy() - - # Create stratified split on the training-eligible data - train_df, extra_val_df = train_test_split( - train_eligible_df, - train_size=train_size, - stratify=train_eligible_df[target_col], - random_state=random_state + for fold_idx, left_out_id in enumerate(left_out_ids, 1): + mask_left_out = df[id_col] == left_out_id + working_df = df.loc[~mask_left_out].copy() + + # --------------------------------------------------------------- + # 1) choose ONE id that will appear *only* in validation + # (GroupShuffleSplit with test_size=1 group) + # --------------------------------------------------------------- + gss = GroupShuffleSplit( + n_splits=1, test_size=1, random_state=rng.randint(1_000_000) ) + (train_groups_idx, val_only_groups_idx), = gss.split( + X=np.zeros(len(working_df)), y=None, groups=working_df[id_col] + ) + val_only_group_id = working_df.iloc[val_only_groups_idx][id_col].unique()[0] - # Combine validation-only data with extra validation data - val_df = pd.concat([val_only_df, extra_val_df], ignore_index=True) - - # Balance training set - train_class_counts = train_df[target_col].value_counts() - min_train_count = train_class_counts.min() - balanced_train_dfs = [] - - for label in train_class_counts.index: - label_df = train_df[train_df[target_col] == label] - # Downsample to the minority class count - balanced_label_df = label_df.sample(min_train_count, random_state=random_state) - balanced_train_dfs.append(balanced_label_df) - - balanced_train_df = pd.concat(balanced_train_dfs, ignore_index=True) - - # Balance validation set - val_class_counts = val_df[target_col].value_counts() - min_val_count = val_class_counts.min() - balanced_val_dfs = [] - - for label in val_class_counts.index: - label_df = val_df[val_df[target_col] == label] - # Downsample to the minority class count - balanced_label_df = label_df.sample(min_val_count, random_state=random_state) - balanced_val_dfs.append(balanced_label_df) + mask_val_only = working_df[id_col] == val_only_group_id + df_val_only = working_df[mask_val_only] + df_eligible = working_df[~mask_val_only] - balanced_val_df = pd.concat(balanced_val_dfs, ignore_index=True) + # --------------------------------------------------------------- + # 2) stratified split of *eligible* rows + # --------------------------------------------------------------- + sss = StratifiedShuffleSplit( + n_splits=1, train_size=train_size, random_state=rng.randint(1_000_000) + ) + train_idx, extra_val_idx = next( + sss.split(df_eligible, df_eligible[target_col]) + ) + df_train = df_eligible.iloc[train_idx] + df_val = pd.concat( + [df_val_only, df_eligible.iloc[extra_val_idx]], ignore_index=True + ) - # Include the left_out_id in the tuple - folds.append((balanced_train_df, balanced_val_df, leave_out_id)) + # --------------------------------------------------------------- + # 3) balance train and val via down-sampling + # --------------------------------------------------------------- + def _balance_down_sampling(frame: pd.DataFrame) -> pd.DataFrame: + min_count = frame[target_col].value_counts().min() + balanced_parts = [ + resample( + frame[frame[target_col] == lbl], + replace=False, + n_samples=min_count, + random_state=rng, + ) + for lbl in frame[target_col].unique() + ] + return pd.concat(balanced_parts, ignore_index=True) + + def _balance_GNUSS(frame: pd.DataFrame) -> pd.DataFrame: + """ + Balance the DataFrame by upsampling the minority class with Gaussian noise. + """ + # Determine label counts and the maximum class size + counts = frame[target_col].value_counts() + max_count = counts.max() + + # Identify numeric columns for noise injection + numeric_cols = frame.select_dtypes(include="number").columns + + balanced_parts = [] + for label, count in counts.items(): + df_label = frame[frame[target_col] == label] + balanced_parts.append(df_label) + if count < max_count: + # Upsample with replacement + n_needed = max_count - count + sampled = df_label.sample(n=n_needed, replace=True, random_state=rng) + # Add Gaussian noise to numeric features + noise = pd.DataFrame( + rng.normal(loc=0, scale=1e-6, size=(n_needed, len(numeric_cols))), + columns=numeric_cols, + index=sampled.index + ) + sampled[numeric_cols] = sampled[numeric_cols] + noise + balanced_parts.append(sampled) + + # Combine and return + return pd.concat(balanced_parts).reset_index(drop=True) + + if balance_method == "GNUSS": + df_train_bal = _balance_GNUSS(df_train) + df_val_bal = _balance_GNUSS(df_val) + else: # default to down-sampling + df_train_bal = _balance_down_sampling(df_train) + df_val_bal = _balance_down_sampling(df_val) + + folds.append((df_train_bal, df_val_bal, left_out_id)) + + print( + f"[fold {fold_idx}/{k}] left-out={left_out_id} | " + f"val-only={val_only_group_id} | " + f"train={len(df_train_bal)}, val={len(df_val_bal)}" + ) return folds From 1b369925aa2193b760d2c3f30cf905304b5407e6 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 27 May 2025 18:47:51 +0200 Subject: [PATCH 47/83] Refactor cross-attention mechanism in model.py: update parameter names for clarity, adjust attention mask dimensions, and modify dropout rate for improved performance --- utils/model.py | 16 +++++++++------- 1 file changed, 9 insertions(+), 7 deletions(-) diff --git a/utils/model.py b/utils/model.py index 050935dc4..00d1193b0 100644 --- a/utils/model.py +++ b/utils/model.py @@ -1688,14 +1688,16 @@ def __init__(self, embed_dim, num_heads, ff_dim, rate=0.1, **kwargs): self.drop1 = layers.Dropout(rate) self.drop2 = layers.Dropout(rate) - def call(self, latent_q, pep_kv, pep_mask, training=False): + def call(self, latent_kv, pep_q, pep_mask, training=False): + # latent_kv: (B, 36, D) => keys/values + # pep_q: (B, S, D) => queries # Cross-attention: latent as queries, peptide as keys/values - # pep_mask: (B,S) => broadcast to (B, L, S) - attn_mask = tf.cast(pep_mask, dtype=tf.float32)[:, tf.newaxis, :] # (B, 1, S) + # pep_mask: (B,S) => broadcast to (B, S, L) where L=36 + pep_mask = tf.expand_dims(pep_mask, axis=-1) # (B, S, 1) - z = self.attn(query=latent_q, key=pep_kv, value=pep_kv, attention_mask=attn_mask) + z = self.attn(pep_q, latent_kv, attention_mask=pep_mask, training=True) # (B, S, D) z = self.drop1(z, training=training) - x = self.norm1(latent_q + z) # residual + norm + x = self.norm1(pep_q + z) # residual + norm f = self.ffn(x) f = self.drop2(f, training=training) @@ -1709,7 +1711,7 @@ def build_classifier(seq_len, embed_dim = 256, num_heads = 8, ff_dim = 512, - dropout_rate = 0.1): + dropout_rate = 0.01): # --- Inputs ------------------------------------------------------------- peptide_in = layers.Input(shape=(seq_len, 21), name="peptide") # (B, S, 21) latent_in = layers.Input(shape=(36, 1152), name="latent_raw") # (B, 36, 1152) @@ -1737,7 +1739,7 @@ def build_classifier(seq_len, model.compile(optimizer="adam", loss="binary_crossentropy", metrics=[tf.keras.metrics.AUC(name="auc"), - tf.keras.metrics.BinaryAccuracy(name="acc")]) + tf.keras.metrics.BinaryAccuracy(name="binary_acc")]) return model From 4298315f9f7ea89125014b4e26b674be53af460e Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 29 May 2025 15:00:53 +0200 Subject: [PATCH 48/83] Refactor ESM dataset creation script: update import path for processing functions and adjust output directory type hint --- utils/create_ESM_dataset.py | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/utils/create_ESM_dataset.py b/utils/create_ESM_dataset.py index e81046a03..ae0ad63ea 100644 --- a/utils/create_ESM_dataset.py +++ b/utils/create_ESM_dataset.py @@ -15,7 +15,7 @@ import pandas as pd from tqdm import tqdm # progress bars from typing import Dict -from processing_functions import create_progressive_k_fold_cross_validation, create_k_fold_leave_one_out_stratified_cv +from utils.processing_functions import create_progressive_k_fold_cross_validation, create_k_fold_leave_one_out_stratified_cv # --------------------------------------------------------------------- # 1. CONFIGURATION – adjust if your paths change @@ -87,7 +87,7 @@ def normalise_allele(a: str) -> str: def attach_embeddings( df: pd.DataFrame, emb_dict: Dict[str, np.ndarray], - out_dir: pathlib.Path | None = None, + out_dir: pathlib.Path = None, ) -> pd.DataFrame: """ Add either: From b0720ca0b9229a43d691f6b5ab57e98f6093d2c2 Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 29 May 2025 15:00:57 +0200 Subject: [PATCH 49/83] Refactor model architecture: rename layers for clarity, enhance positional embedding handling, and improve attention mechanisms --- utils/model.py | 494 ++++++++++++++++++++++++++++++++++++++++++------- 1 file changed, 431 insertions(+), 63 deletions(-) diff --git a/utils/model.py b/utils/model.py index 00d1193b0..8a660c99a 100644 --- a/utils/model.py +++ b/utils/model.py @@ -1641,107 +1641,475 @@ def test_step(self, data): import tensorflow as tf from tensorflow.keras import layers, Model, Sequential + # --------------------------------------------------------------------------- # -# 1. Positional + projection layer for the peptide (21-dim per residue) # +# 1.1 Positional + projection layer for the peptide (21-dim per residue) # # --------------------------------------------------------------------------- # -class PeptideEmbedding(layers.Layer): +class PeptideProj(layers.Layer): """ Projects peptide vectors (one-hot or 21-dim physicochemical) to embed_dim and adds a learned positional embedding. """ - def __init__(self, seq_len, embed_dim, **kwargs): + + def __init__(self, max_seq_len, embed_dim, **kwargs): super().__init__(**kwargs) - self.embed_dim = embed_dim - self.seq_len = seq_len - self.proj = layers.Dense(embed_dim, use_bias=False, - name="peptide_proj") - self.pos_emb = layers.Embedding(input_dim=seq_len, - output_dim=embed_dim, - name="peptide_pos") + self.embed_dim = embed_dim + self.max_seq_len = max_seq_len + self.proj = layers.Dense(embed_dim, use_bias=False, name="peptide_proj") + self.pos_emb = layers.Embedding( + input_dim=max_seq_len, + output_dim=embed_dim, + name="peptide_pos" + ) def call(self, x): # x: (batch, S, 21) - h = self.proj(x) # (batch, S, embed_dim) - pos = tf.range(self.seq_len) - pos = self.pos_emb(pos)[tf.newaxis, ...] # (1, S, embed_dim) - return h + pos # broadcast add + batch_size = tf.shape(x)[0] + seq_len = tf.shape(x)[1] + + # Project input features + h = self.proj(x) # (batch, S, embed_dim) + + # Create position indices + pos_indices = tf.range(seq_len) # (S,) + pos_embeddings = self.pos_emb(pos_indices) # (S, embed_dim) + + # Add positional embeddings (broadcasting) + pos_embeddings = tf.expand_dims(pos_embeddings, 0) # (1, S, embed_dim) + return h + pos_embeddings # (batch, S, embed_dim) + + def get_config(self): + config = super().get_config() + config.update({ + "max_seq_len": self.max_seq_len, + "embed_dim": self.embed_dim + }) + return config # --------------------------------------------------------------------------- # -# 2. Cross-attention transformer block # +# 1.2 Positional + projection layer for the latent (1152-dim per residue) # # --------------------------------------------------------------------------- # -class CrossAttentionBlock(layers.Layer): +class LatentProj(layers.Layer): """ - Latent queries attend over peptide keys/values, followed by FFN + residuals. + Projects latent vectors (1152-dim) to embed_dim and adds a learned positional + embedding. """ - def __init__(self, embed_dim, num_heads, ff_dim, rate=0.1, **kwargs): + + def __init__(self, max_n_residues, embed_dim, **kwargs): super().__init__(**kwargs) - self.attn = layers.MultiHeadAttention(num_heads=num_heads, - key_dim=embed_dim, - name="cross_attn") - self.ffn = Sequential([ + self.embed_dim = embed_dim + self.max_n_residues = max_n_residues + self.proj = layers.Dense(embed_dim, use_bias=False, name="latent_proj") + self.pos_emb = layers.Embedding( + input_dim=max_n_residues, + output_dim=embed_dim, + name="latent_pos" + ) + + def call(self, x): + # x: (batch, R, 1152) + batch_size = tf.shape(x)[0] + n_residues = tf.shape(x)[1] + + # Project input features + h = self.proj(x) # (batch, R, embed_dim) + + # Create position indices + pos_indices = tf.range(n_residues) # (R,) + pos_embeddings = self.pos_emb(pos_indices) # (R, embed_dim) + + # Add positional embeddings (broadcasting) + pos_embeddings = tf.expand_dims(pos_embeddings, 0) # (1, R, embed_dim) + return h + pos_embeddings # (batch, R, embed_dim) + + def get_config(self): + config = super().get_config() + config.update({ + "max_n_residues": self.max_n_residues, + "embed_dim": self.embed_dim + }) + return config + + +# --------------------------------------------------------------------------- # +# 2.1 Self-attention transformer block # +# --------------------------------------------------------------------------- # +class SelfAttentionBlock(layers.Layer): + """ + Self-attention block for sequences, followed by FFN + residuals. + """ + + def __init__(self, embed_dim, num_heads, ff_dim, dropout_rate=0.1, **kwargs): + super().__init__(**kwargs) + self.embed_dim = embed_dim + self.num_heads = num_heads + self.ff_dim = ff_dim + self.dropout_rate = dropout_rate + + self.attn = layers.MultiHeadAttention( + num_heads=num_heads, + key_dim=embed_dim // num_heads, + name="self_attn" + ) + self.ffn = Sequential([ layers.Dense(ff_dim, activation="relu"), layers.Dense(embed_dim) ], name="ffn") self.norm1 = layers.LayerNormalization(epsilon=1e-6) self.norm2 = layers.LayerNormalization(epsilon=1e-6) - self.drop1 = layers.Dropout(rate) - self.drop2 = layers.Dropout(rate) + self.drop1 = layers.Dropout(dropout_rate) + self.drop2 = layers.Dropout(dropout_rate) + + def call(self, x, mask=None, training=False): + # x: (B, L, D) + # Convert mask to proper format for attention if provided + attention_mask = None + if mask is not None: + # mask: (B, L) -> need (B, 1, 1, L) for self-attention + attention_mask = mask[:, tf.newaxis, tf.newaxis, :] # (B, 1, 1, L) + + # Self-attention + attn_out = self.attn( + query=x, key=x, value=x, + attention_mask=attention_mask, + training=training + ) + attn_out = self.drop1(attn_out, training=training) + x = self.norm1(x + attn_out) # residual + norm - def call(self, latent_kv, pep_q, pep_mask, training=False): - # latent_kv: (B, 36, D) => keys/values - # pep_q: (B, S, D) => queries - # Cross-attention: latent as queries, peptide as keys/values - # pep_mask: (B,S) => broadcast to (B, S, L) where L=36 - pep_mask = tf.expand_dims(pep_mask, axis=-1) # (B, S, 1) + # Feed-forward + ff_out = self.ffn(x) + ff_out = self.drop2(ff_out, training=training) + return self.norm2(x + ff_out) # residual + norm - z = self.attn(pep_q, latent_kv, attention_mask=pep_mask, training=True) # (B, S, D) - z = self.drop1(z, training=training) - x = self.norm1(pep_q + z) # residual + norm + def get_config(self): + config = super().get_config() + config.update({ + "embed_dim": self.embed_dim, + "num_heads": self.num_heads, + "ff_dim": self.ff_dim, + "dropout_rate": self.dropout_rate + }) + return config - f = self.ffn(x) - f = self.drop2(f, training=training) - return self.norm2(x + f) # residual + norm + +# --------------------------------------------------------------------------- # +# 2.2 Cross-attention transformer block # +# --------------------------------------------------------------------------- # +class CrossAttentionBlock(layers.Layer): + """ + Cross-attention block with self-attention on queries first, then cross-attention. + First applies self-attention to queries, then cross-attention with keys/values. + """ + + def __init__(self, embed_dim, num_heads, ff_dim, dropout_rate=0.1, **kwargs): + super().__init__(**kwargs) + self.embed_dim = embed_dim + self.num_heads = num_heads + self.ff_dim = ff_dim + self.dropout_rate = dropout_rate + + # Self-attention for queries + self.self_attn = layers.MultiHeadAttention( + num_heads=num_heads, + key_dim=embed_dim // num_heads, + name="self_attn" + ) + + # Cross-attention between queries and keys/values + self.cross_attn = layers.MultiHeadAttention( + num_heads=num_heads, + key_dim=embed_dim // num_heads, + name="cross_attn" + ) + + self.ffn = Sequential([ + layers.Dense(ff_dim, activation="relu"), + layers.Dense(embed_dim) + ], name="ffn") + + # Normalization layers + self.norm1 = layers.LayerNormalization(epsilon=1e-6, name="norm1") + self.norm2 = layers.LayerNormalization(epsilon=1e-6, name="norm2") + self.norm3 = layers.LayerNormalization(epsilon=1e-6, name="norm3") + + # Dropout layers + self.drop1 = layers.Dropout(dropout_rate) + self.drop2 = layers.Dropout(dropout_rate) + self.drop3 = layers.Dropout(dropout_rate) + + def call(self, queries, keys_values, query_mask=None, key_mask=None, training=False): + """ + Args: + queries: (B, L_q, D) - query sequences + keys_values: (B, L_kv, D) - key/value sequences + query_mask: (B, L_q) - mask for queries + key_mask: (B, L_kv) - mask for keys/values + training: bool + """ + # Convert masks to proper format for attention if provided + query_attention_mask = None + if query_mask is not None: + # query_mask: (B, L_q) -> need (B, 1, 1, L_q) for self-attention + query_attention_mask = query_mask[:, tf.newaxis, tf.newaxis, :] # (B, 1, 1, L_q) + + key_attention_mask = None + if key_mask is not None: + # key_mask: (B, L_kv) -> need (B, 1, 1, L_kv) for cross-attention + key_attention_mask = key_mask[:, tf.newaxis, tf.newaxis, :] # (B, 1, 1, L_kv) + + # Step 1: Self-attention on queries + self_attn_out = self.self_attn( + query=queries, + key=queries, + value=queries, + attention_mask=query_attention_mask, + training=training + ) + self_attn_out = self.drop1(self_attn_out, training=training) + queries_refined = self.norm1(queries + self_attn_out) # residual + norm + + # Step 2: Cross-attention between refined queries and keys/values + cross_attn_out = self.cross_attn( + query=queries_refined, + key=keys_values, + value=keys_values, + attention_mask=key_attention_mask, + training=training + ) + cross_attn_out = self.drop2(cross_attn_out, training=training) + x = self.norm2(queries_refined + cross_attn_out) # residual connection + + # Step 3: Feed-forward network + ff_out = self.ffn(x) + ff_out = self.drop3(ff_out, training=training) + return self.norm3(x + ff_out) # residual + norm + + def get_config(self): + config = super().get_config() + config.update({ + "embed_dim": self.embed_dim, + "num_heads": self.num_heads, + "ff_dim": self.ff_dim, + "dropout_rate": self.dropout_rate + }) + return config # --------------------------------------------------------------------------- # # 3. Build the complete classifier # # --------------------------------------------------------------------------- # -def build_classifier(seq_len, - embed_dim = 256, - num_heads = 8, - ff_dim = 512, - dropout_rate = 0.01): +def build_classifier(max_seq_len=50, + max_n_residues=500, + n_blocks=4, + embed_dim=256, + num_heads=8, + ff_dim=512, + dropout_rate=0.01): + """ + Build peptide-latent interaction classifier. + + Args: + max_seq_len: Maximum peptide sequence length + max_n_residues: Maximum number of protein residues + n_blocks: Number of transformer blocks + embed_dim: Embedding dimension + num_heads: Number of attention heads + ff_dim: Feed-forward dimension + dropout_rate: Dropout rate + + Returns: + Compiled Keras model + """ + # --- Inputs ------------------------------------------------------------- - peptide_in = layers.Input(shape=(seq_len, 21), name="peptide") # (B, S, 21) - latent_in = layers.Input(shape=(36, 1152), name="latent_raw") # (B, 36, 1152) + peptide_in = layers.Input(shape=(None, 21), name="peptide") # (B, S, 21) + latent_in = layers.Input(shape=(None, 1152), name="latent_raw") # (B, R, 1152) - # --- Projections -------------------------------------------------------- - pep_mask = tf.reduce_any(peptide_in > 0, axis=-1) # bool (B,S) - pep_emb = PeptideEmbedding(seq_len, embed_dim)(peptide_in) # (B, S, D) + # --- Create attention masks --------------------------------------------- + # Peptide mask: True where peptide has content (non-zero vectors) + pep_mask = tf.reduce_any(tf.abs(peptide_in) > 1e-6, axis=-1) # (B, S) - latent_proj = layers.Dense(embed_dim, use_bias=False, - name="latent_proj")(latent_in) # (B, 36, D) + # Latent mask: True where latent has content (non-zero vectors) + latent_mask = tf.reduce_any(tf.abs(latent_in) > 1e-6, axis=-1) # (B, R) - # --- Cross-attention fusion -------------------------------------------- - x = CrossAttentionBlock(embed_dim, num_heads, ff_dim, - rate=dropout_rate)(latent_proj, pep_emb, pep_mask) # (B, 36, D) + # --- Projections -------------------------------------------------------- + pep_proj = PeptideProj(max_seq_len, embed_dim, name="peptide_projection")(peptide_in) + latent_proj = LatentProj(max_n_residues, embed_dim, name="latent_projection")(latent_in) + + # --- Self-attention blocks for latent representation ------------------- + latent_embed = latent_proj + for i in range(n_blocks): + latent_embed = SelfAttentionBlock( + embed_dim=embed_dim, + num_heads=num_heads, + ff_dim=ff_dim, + dropout_rate=dropout_rate, + name=f"latent_self_attn_block_{i + 1}" + )(latent_embed, mask=latent_mask) + + # --- Cross-attention fusion --------------------------------------------- + # Latent queries attend to peptide keys/values + fused = latent_embed + for i in range(n_blocks): + fused = CrossAttentionBlock( + embed_dim=embed_dim, + num_heads=num_heads, + ff_dim=ff_dim, + dropout_rate=dropout_rate, + name=f"cross_attn_block_{i + 1}" + )(queries=fused, keys_values=pep_proj, query_mask=latent_mask, key_mask=pep_mask) + + # --- Aggregation and prediction head ----------------------------------- + # Global average pooling with masking + latent_mask_expanded = tf.expand_dims(tf.cast(latent_mask, tf.float32), -1) # (B, R, 1) + masked_fused = fused * latent_mask_expanded # Zero out padded positions + + # Compute mean only over valid positions + pooled = tf.reduce_sum(masked_fused, axis=1) # (B, D) + valid_lengths = tf.reduce_sum(latent_mask_expanded, axis=1) # (B, 1) + pooled = pooled / (valid_lengths + 1e-8) # Average over valid positions + + # Simpler classification head + output = layers.Dense(1, activation="sigmoid", name="output")(pooled) + # # Final prediction layers + # x = layers.Dense(embed_dim, activation="relu", name="pred_hidden")(pooled) + # x = layers.Dropout(dropout_rate)(x) + # x = layers.Dense(embed_dim // 2, activation="relu", name="pred_hidden2")(x) + # x = layers.Dropout(dropout_rate)(x) + # output = layers.Dense(1, activation="softmax", name="output")(x) + + # --- Build and compile model -------------------------------------------- + model = Model( + inputs=[peptide_in, latent_in], + outputs=output, + name="peptide_latent_classifier" + ) + + model.compile( + optimizer=tf.keras.optimizers.Adam(learning_rate=1e-4), + loss="binary_crossentropy", + metrics=["binary_accuracy", "AUC"] + ) - # --- Pool & prediction head -------------------------------------------- - x = layers.GlobalAveragePooling1D(name="pool")(x) # (B, D) - x = layers.Dropout(dropout_rate)(x) - out = layers.Dense(1, activation="sigmoid", name="output")(x) # (B, 1) + return model - # --- Compile the model ------------------------------------------------- - model = Model(inputs=[peptide_in, latent_in], outputs=out, - name="peptide_latent_classifier") - model.compile(optimizer="adam", - loss="binary_crossentropy", - metrics=[tf.keras.metrics.AUC(name="auc"), - tf.keras.metrics.BinaryAccuracy(name="binary_acc")]) - return model +# ----------------------------------------------------------------------------- # +# # 4. Utility function to test the model # +# # --------------------------------------------------------------------------- # +# def test_model(): +# """Test the model with dummy data to ensure it works.""" +# +# # Create model +# model = build_classifier( +# max_seq_len=20, +# max_n_residues=100, +# n_blocks=2, +# embed_dim=128, +# num_heads=4, +# ff_dim=256, +# dropout_rate=0.1 +# ) +# +# # Print model summary +# print("Model Summary:") +# model.summary() +# +# # Create dummy data +# batch_size = 4 +# seq_len = 15 +# n_residues = 80 +# +# # Dummy peptide data (one-hot encoded) +# peptide_data = tf.random.uniform((batch_size, seq_len, 21), maxval=2, dtype=tf.int32) +# peptide_data = tf.cast(peptide_data, tf.float32) +# +# # Dummy latent data +# latent_data = tf.random.normal((batch_size, n_residues, 1152)) +# +# # Test forward pass +# print("\nTesting forward pass...") +# predictions = model([peptide_data, latent_data]) +# print(f"Output shape: {predictions.shape}") +# print(f"Sample predictions: {predictions[:3].numpy().flatten()}") +# +# # Test with different sequence lengths +# print("\nTesting with variable sequence lengths...") +# peptide_data2 = tf.random.uniform((batch_size, 10, 21), maxval=2, dtype=tf.int32) +# peptide_data2 = tf.cast(peptide_data2, tf.float32) +# latent_data2 = tf.random.normal((batch_size, 60, 1152)) +# +# predictions2 = model([peptide_data2, latent_data2]) +# print(f"Output shape with different lengths: {predictions2.shape}") +# +# print("\nModel test completed successfully!") +# +# return model +# +# +# if __name__ == "__main__": +# # Test the model +# test_model() + +# # --------------------------------------------------------------------------- # +# # 4. Utility function to test the model # +# # --------------------------------------------------------------------------- # +# def test_model(): +# """Test the model with dummy data to ensure it works.""" +# +# # Create model +# model = build_classifier( +# max_seq_len=20, +# max_n_residues=100, +# n_blocks=2, +# embed_dim=128, +# num_heads=4, +# ff_dim=256, +# dropout_rate=0.1 +# ) +# +# # Print model summary +# print("Model Summary:") +# model.summary() +# +# # Create dummy data +# batch_size = 4 +# seq_len = 15 +# n_residues = 80 +# +# # Dummy peptide data (one-hot encoded) +# peptide_data = tf.random.uniform((batch_size, seq_len, 21), maxval=2, dtype=tf.int32) +# peptide_data = tf.cast(peptide_data, tf.float32) +# +# # Dummy latent data +# latent_data = tf.random.normal((batch_size, n_residues, 1152)) +# +# # Test forward pass +# print("\nTesting forward pass...") +# predictions = model([peptide_data, latent_data]) +# print(f"Output shape: {predictions.shape}") +# print(f"Sample predictions: {predictions[:3].numpy().flatten()}") +# +# # Test with different sequence lengths +# print("\nTesting with variable sequence lengths...") +# peptide_data2 = tf.random.uniform((batch_size, 10, 21), maxval=2, dtype=tf.int32) +# peptide_data2 = tf.cast(peptide_data2, tf.float32) +# latent_data2 = tf.random.normal((batch_size, 60, 1152)) +# +# predictions2 = model([peptide_data2, latent_data2]) +# print(f"Output shape with different lengths: {predictions2.shape}") +# +# print("\nModel test completed successfully!") +# +# return model +# +# +# if __name__ == "__main__": +# # Test the model +# test_model() # --------------------------------------------------------------------------- # # 4. Demo: instantiate and inspect # From b4e074cd839bbc8741f13949b700f7b8afd01ad0 Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 29 May 2025 15:01:00 +0200 Subject: [PATCH 50/83] Enhance evaluation metrics visualization: improve confusion matrix handling, add prediction probability distribution, and refine training curve plots --- src/run_pMHC_DL_ESM.py | 270 +++++++++++++++++++++++++---------------- 1 file changed, 165 insertions(+), 105 deletions(-) diff --git a/src/run_pMHC_DL_ESM.py b/src/run_pMHC_DL_ESM.py index 494fe5bc7..4372fc6d0 100644 --- a/src/run_pMHC_DL_ESM.py +++ b/src/run_pMHC_DL_ESM.py @@ -34,10 +34,16 @@ import matplotlib.pyplot as plt from sklearn.model_selection import train_test_split from tqdm import tqdm + +from utils.create_ESM_dataset import mhc_class from utils.model import build_classifier -from sklearn.metrics import confusion_matrix, roc_curve, auc, roc_auc_score +from sklearn.metrics import ( + confusion_matrix, roc_curve, auc, precision_score, + recall_score, f1_score, accuracy_score, roc_auc_score +) import seaborn as sns + # --------------------------------------------------------------------------- # Utility: peptide → one‑hot (seq_len, 21) # --------------------------------------------------------------------------- @@ -96,7 +102,7 @@ def load_dataset(parquet_path: str): print(" peptide one-hot shape:", pep_onehot.shape) # 2) Latent embeddings -------------------------------------------------- - print(" loading MHC-I embeddings") + print(f" loading MHC {mhc_class} embeddings") if "mhc_embedding" in df.columns: latents = np.stack(df["mhc_embedding"].values).astype("float32") elif "mhc_embedding_path" in df.columns: @@ -161,82 +167,95 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ """ hist = history.history plt.figure(figsize=(21, 6)) + plot_name = f"training_curve{'_fold' + str(fold_id) if fold_id is not None else ''}" + + # set plot name above all plots + plt.suptitle(f"Training Curves{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", fontsize=16, fontweight='bold') # Plot 1: Loss curve plt.subplot(1, 4, 1) - plt.plot(hist["loss"], label="train") - plt.plot(hist["val_loss"], label="val") - plt.xlabel("epoch") - plt.ylabel("loss") - plt.title("BCE loss") + plt.plot(hist["loss"], label="train", linewidth=2) + plt.plot(hist["val_loss"], label="val", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Loss") + plt.title("BCE Loss") plt.legend() - plt.grid(True) + plt.grid(True, alpha=0.3) # Plot 2: Accuracy curve if "binary_accuracy" in hist and "val_binary_accuracy" in hist: plt.subplot(1, 4, 2) - plt.plot(hist["binary_accuracy"], label="train acc") - plt.plot(hist["val_binary_accuracy"], label="val acc") - plt.xlabel("epoch") - plt.ylabel("accuracy") + plt.plot(hist["binary_accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_binary_accuracy"], label="val acc", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Accuracy") plt.title("Binary Accuracy") plt.legend() - plt.grid(True) + plt.grid(True, alpha=0.3) + elif "accuracy" in hist and "val_accuracy" in hist: + plt.subplot(1, 4, 2) + plt.plot(hist["accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_accuracy"], label="val acc", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Accuracy") + plt.title("Accuracy") + plt.legend() + plt.grid(True, alpha=0.3) # Plot 3: AUC curve if "auc" in hist and "val_auc" in hist: plt.subplot(1, 4, 3) - plt.plot(hist["auc"], label="train AUC") - plt.plot(hist["val_auc"], label="val AUC") - plt.xlabel("epoch") + plt.plot(hist["auc"], label="train AUC", linewidth=2) + plt.plot(hist["val_auc"], label="val AUC", linewidth=2) + plt.xlabel("Epoch") plt.ylabel("AUC") plt.title("AUC") plt.legend() - plt.grid(True) + plt.grid(True, alpha=0.3) - # Plot 4: Confusion matrix + # Plot 4: Confusion matrix (if model and validation dataset provided) if model is not None and val_dataset is not None: plt.subplot(1, 4, 4) - try: - # Collect validation predictions and true labels simultaneously - y_true_list = [] - y_pred_proba_list = [] - - for features, labels in val_dataset: - y_true_list.append(labels.numpy()) - batch_pred = model(features, training=False).numpy() - y_pred_proba_list.append(batch_pred) - - y_true = np.concatenate(y_true_list, axis=0).flatten() - y_pred_proba = np.concatenate(y_pred_proba_list, axis=0).flatten() - # print min, max, mean of y_pred_proba - print(f"y_pred_proba: min={y_pred_proba.min():.4f}, max={y_pred_proba.max():.4f}, mean={y_pred_proba.mean():.4f}") - y_pred = (y_pred_proba > 0.5).astype(int) - - # Compute confusion matrix - cm = confusion_matrix(y_true, y_pred) - - # Plot confusion matrix - sns.heatmap(cm, annot=True, fmt="d", cmap="Blues", - xticklabels=["Negative", "Positive"], - yticklabels=["Negative", "Positive"]) - plt.xlabel("Predicted") - plt.ylabel("True") - plt.title(f"Confusion Matrix\nAUROC: {roc_auc_score(y_true, y_pred_proba):.4f}") - except Exception as e: - print(f"Warning: could not generate confusion matrix: {e}") + # Get predictions + y_pred_proba = model.predict(val_dataset) + y_pred = (y_pred_proba > 0.5).astype(int) + + # Extract true labels + y_true = [] + for _, labels in val_dataset: + y_true.extend(labels.numpy()) + y_true = np.array(y_true) + + # Create confusion matrix + cm = confusion_matrix(y_true, y_pred) + sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', + xticklabels=['Negative', 'Positive'], + yticklabels=['Negative', 'Positive']) + plt.title('Confusion Matrix') + plt.xlabel('Predicted') + plt.ylabel('Actual') + else: + # If no model/dataset provided, show a placeholder or additional metric + plt.subplot(1, 4, 4) + plt.text(0.5, 0.5, 'Confusion Matrix\n(Requires model + val_dataset)', + ha='center', va='center', transform=plt.gca().transAxes, + bbox=dict(boxstyle="round,pad=0.3", facecolor="lightgray")) + plt.axis('off') # Save main plot - plt.figure(1) plt.tight_layout() - out_png = os.path.join(run_dir, f"training_curve{'_fold' + str(fold_id) if fold_id is not None else ''}.png") - plt.savefig(out_png) + out_png = os.path.join(run_dir, f"{plot_name}.png") + + # Create directory if it doesn't exist + os.makedirs(run_dir, exist_ok=True) + + plt.savefig(out_png, dpi=300, bbox_inches='tight') plt.show() print(f"✓ Training curve saved to {out_png}") -def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, history=None): +def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, history=None, string: str =None): """ Plot comprehensive evaluation metrics for a test dataset using a trained model. @@ -247,79 +266,81 @@ def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, hi fold_id: Optional fold identifier for naming the output file. history: Optional training history object to display loss/accuracy curves. - Returns: None + Returns: Dictionary containing evaluation metrics """ # Collect predictions - y_true_list = [] - y_pred_proba_list = [] - - for features, labels in test_dataset: - y_true_list.append(labels.numpy()) - batch_pred = model(features, training=False).numpy() - y_pred_proba_list.append(batch_pred) - - y_true = np.concatenate(y_true_list, axis=0) - y_pred_proba = np.concatenate(y_pred_proba_list, axis=0) - # print min, max, mean of y_pred_proba - print(f"y_pred_proba: min={y_pred_proba.min():.4f}, max={y_pred_proba.max():.4f}, mean={y_pred_proba.mean():.4f}") - y_pred = (y_pred_proba > 0.5).astype(int) + print("Generating predictions...") + y_pred_proba = model.predict(test_dataset) + y_pred = (y_pred_proba > 0.5).astype(int).flatten() + + # Extract true labels + y_true = [] + for _, labels in test_dataset: + y_true.extend(labels.numpy()) + y_true = np.array(y_true).flatten() + + # Calculate ROC curve + fpr, tpr, _ = roc_curve(y_true, y_pred_proba.flatten()) + roc_auc = auc(fpr, tpr) # Create a multi-panel figure - plt.figure(figsize=(20, 12)) + plt.figure(figsize=(15, 10)) + plt.suptitle(f"{string} Evaluation Metrics{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", + fontsize=16, fontweight='bold') # Panel 1: ROC Curve plt.subplot(2, 2, 1) - fpr, tpr, _ = roc_curve(y_true, y_pred_proba) - roc_auc = auc(fpr, tpr) - plt.plot(fpr, tpr, color='blue', label=f'ROC curve (area = {roc_auc:.4f})') - plt.plot([0, 1], [0, 1], color='red', linestyle='--') + plt.plot(fpr, tpr, color='darkorange', lw=2, + label=f'ROC curve (AUC = {roc_auc:.4f})') + plt.plot([0, 1], [0, 1], color='navy', lw=2, linestyle='--', alpha=0.8) plt.xlim([0.0, 1.0]) plt.ylim([0.0, 1.05]) plt.xlabel('False Positive Rate') plt.ylabel('True Positive Rate') - plt.title('ROC Curve') - plt.legend(loc='lower right') + plt.title('Receiver Operating Characteristic (ROC) Curve') + plt.legend(loc="lower right") + plt.grid(True, alpha=0.3) # Panel 2: Confusion Matrix plt.subplot(2, 2, 2) - cm = confusion_matrix(y_true.flatten(), y_pred.flatten()) - sns.heatmap(cm, annot=True, fmt="d", cmap="Blues", - xticklabels=["Negative", "Positive"], - yticklabels=["Negative", "Positive"]) - plt.xlabel("Predicted") - plt.ylabel("True") - plt.title("Confusion Matrix") + cm = confusion_matrix(y_true, y_pred) + sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', + xticklabels=['Negative', 'Positive'], + yticklabels=['Negative', 'Positive']) + plt.title('Confusion Matrix') + plt.xlabel('Predicted Label') + plt.ylabel('True Label') # Panel 3: Loss curve (if history provided) if history is not None: plt.subplot(2, 2, 3) hist = history.history - plt.plot(hist.get("loss", []), label="train") - plt.plot(hist.get("val_loss", []), label="val") - plt.xlabel("epoch") - plt.ylabel("loss") + plt.plot(hist.get("loss", []), label="train", linewidth=2) + plt.plot(hist.get("val_loss", []), label="val", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Loss") plt.title("BCE Loss") plt.legend() - plt.grid(True) + plt.grid(True, alpha=0.3) # Panel 4: Accuracy curve (if available in history) plt.subplot(2, 2, 4) if "binary_accuracy" in hist and "val_binary_accuracy" in hist: - plt.plot(hist["binary_accuracy"], label="train acc") - plt.plot(hist["val_binary_accuracy"], label="val acc") + plt.plot(hist["binary_accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_binary_accuracy"], label="val acc", linewidth=2) elif "accuracy" in hist and "val_accuracy" in hist: - plt.plot(hist["accuracy"], label="train acc") - plt.plot(hist["val_accuracy"], label="val acc") - plt.xlabel("epoch") - plt.ylabel("accuracy") + plt.plot(hist["accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_accuracy"], label="val acc", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Accuracy") plt.title("Accuracy") plt.legend() - plt.grid(True) + plt.grid(True, alpha=0.3) else: # Panel 3: Test metrics when history not available plt.subplot(2, 2, 3) - from sklearn.metrics import precision_score, recall_score, f1_score, accuracy_score + # Calculate metrics accuracy = accuracy_score(y_true, y_pred) precision = precision_score(y_true, y_pred, zero_division=0) recall = recall_score(y_true, y_pred, zero_division=0) @@ -334,30 +355,69 @@ def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, hi } # Create a bar chart for metrics - plt.bar(range(len(metrics)), list(metrics.values()), align='center') - plt.xticks(range(len(metrics)), list(metrics.keys()), rotation=45) + bars = plt.bar(range(len(metrics)), list(metrics.values()), + color=['skyblue', 'lightcoral', 'lightgreen', 'gold', 'orange'], + alpha=0.8, edgecolor='black', linewidth=1) + plt.xticks(range(len(metrics)), list(metrics.keys()), rotation=45, ha='right') plt.ylim(0, 1.0) plt.title('Test Set Evaluation Metrics') + plt.ylabel('Score') + plt.grid(True, alpha=0.3, axis='y') # Add values on top of bars - for i, v in enumerate(metrics.values()): - plt.text(i, v + 0.02, f'{v:.4f}', ha='center') + for i, (bar, value) in enumerate(zip(bars, metrics.values())): + plt.text(bar.get_x() + bar.get_width() / 2, bar.get_height() + 0.02, + f'{value:.4f}', ha='center', va='bottom', fontweight='bold') + + # Panel 4: Prediction distribution + plt.subplot(2, 2, 4) + plt.hist(y_pred_proba[y_true == 0], bins=30, alpha=0.7, + label='Negative Class', color='red', density=True) + plt.hist(y_pred_proba[y_true == 1], bins=30, alpha=0.7, + label='Positive Class', color='blue', density=True) + plt.axvline(x=0.5, color='black', linestyle='--', linewidth=2, + label='Decision Threshold') + plt.xlabel('Predicted Probability') + plt.ylabel('Density') + plt.title('Prediction Probability Distribution') + plt.legend() + plt.grid(True, alpha=0.3) plt.tight_layout() + + # Create directory if it doesn't exist + os.makedirs(run_dir, exist_ok=True) + out_png = os.path.join(run_dir, f"test_metrics{'_fold' + str(fold_id) if fold_id is not None else ''}.png") - plt.savefig(out_png) + plt.savefig(out_png, dpi=300, bbox_inches='tight') plt.show() print(f"✓ Test metrics visualization saved to {out_png}") - # Return evaluation metrics as dictionary for possible further use - return { + # Calculate and return evaluation metrics + metrics_dict = { 'roc_auc': roc_auc, 'accuracy': accuracy_score(y_true, y_pred), 'precision': precision_score(y_true, y_pred, zero_division=0), 'recall': recall_score(y_true, y_pred, zero_division=0), - 'f1': f1_score(y_true, y_pred, zero_division=0) + 'f1': f1_score(y_true, y_pred, zero_division=0), + 'confusion_matrix': cm.tolist(), + 'fpr': fpr.tolist(), + 'tpr': tpr.tolist() } + # Print summary + print("\n" + "=" * 50) + print("TEST SET EVALUATION SUMMARY") + print("=" * 50) + print(f"Accuracy: {metrics_dict['accuracy']:.4f}") + print(f"Precision: {metrics_dict['precision']:.4f}") + print(f"Recall: {metrics_dict['recall']:.4f}") + print(f"F1 Score: {metrics_dict['f1']:.4f}") + print(f"ROC AUC: {metrics_dict['roc_auc']:.4f}") + print("=" * 50) + + return metrics_dict + # --------------------------------------------------------------------------- # TF‑data helper # --------------------------------------------------------------------------- @@ -664,18 +724,18 @@ def main(argv=None): test1_results = model.evaluate(test1_loader, verbose=1) print(f"Test1 results: {test1_results}") print("Evaluating on test2 set...") - test2_results = model.evaluate(test2_loader, verbose=1) + test2_results = model.evaluate(test2_loader, verbose=1, ) print(f"Test2 results: {test2_results}") # Plot ROC curve for test1 - plot_test_metrics(model, test1_loader, run_dir, fold_id) + plot_test_metrics(model, test1_loader, run_dir, fold_id, "Test1 - balanced alleles") # Plot ROC curve for test2 - plot_test_metrics(model, test2_loader, run_dir, fold_id) + plot_test_metrics(model, test2_loader, run_dir, fold_id, "Test2 - rare alleles") if __name__ == "__main__": main([ - # "--parquet", "../data/Custom_dataset/NetMHCpan_dataset/mhc2_with_esm_embeddings.parquet", - "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_1", - "--epochs", "3", "--batch", "1024" + # "--parquet", "../data/Custom_dataset/NetMHCpan_dataset/mhc_2/mhc2_with_esm_embeddings.parquet", + "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_2", + "--epochs", "5", "--batch", "64" ]) \ No newline at end of file From 61eb56ffcd4d756400b7a3176cf67a9c5e46ba7b Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 29 May 2025 15:01:24 +0200 Subject: [PATCH 51/83] temporary removed samples without data --- data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv | 6 ------ 1 file changed, 6 deletions(-) diff --git a/data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv b/data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv index 04944156e..1aba71d56 100644 --- a/data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv +++ b/data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv @@ -122035,9 +122035,3 @@ 122033,H-2-IAu|P14438-alpha|P06344-beta,mice,2,LSSRFGYFGGNNVNTTHNNVLR/YETNTVYNPCYEVCFYYTYYD,H-2-IAu|P14438-alpha|P06344-beta,DHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNE/HFVVQFQPFCYFTNGTQRIRYVTRYIYNREEYLRFDSDVGEYRAVTELGRPDAEYYNKQYLERTRAELDTVCRYNYEETEVPTSLRR,,mice-H-2-IAu 122034,H-2-IEd|P01904-alpha,mice,2,SASFAFQFGANQENVDVNVM/INIHNSFESYWID,H-2-IEd|P01904-alpha,EEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDAN/RFLEYVTSECHFYNGTQHVRFLERFIYNREENLRFDSDVGEYRAVTELGRPDAENWNSQPEILEDARASVDTYCRHNYEISDKFLVRR,,mice-H-2-IEd 122035,H-2-IEk|1FNE,mice,2,SASEAFQFFGNQENVDVNVM/INIFVHNSLVEVWFKED,H-2-IEk|1FNE,EEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDAN/PWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPR,,mice-H-2-IEk -122036,H-2-Kb,,,,H-2-Kb,CTCCCAGATTGTAAAGTGATGGTTCATGACCCTCATTCTCTAGCGTGA,, -122037,H-2-Dq,,,,H-2-Dq,,, -122038,H-2-Ld,,,,H-2-Ld,,, -122039,H-2-Kq,,,,H-2-Kq,,, -122040,BoLA-T2C,,,,BoLA-T2C,,, -122041,H-2-Lq,,,,H-2-Lq,,, From 1b435458def801109cc74f71dc3bd9051bbe6374 Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 29 May 2025 15:09:47 +0200 Subject: [PATCH 52/83] Fix formatting in evaluation function: remove unnecessary trailing comma in test2_results evaluation --- src/run_pMHC_DL_ESM.py | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/src/run_pMHC_DL_ESM.py b/src/run_pMHC_DL_ESM.py index 4372fc6d0..3f3da9490 100644 --- a/src/run_pMHC_DL_ESM.py +++ b/src/run_pMHC_DL_ESM.py @@ -724,7 +724,7 @@ def main(argv=None): test1_results = model.evaluate(test1_loader, verbose=1) print(f"Test1 results: {test1_results}") print("Evaluating on test2 set...") - test2_results = model.evaluate(test2_loader, verbose=1, ) + test2_results = model.evaluate(test2_loader, verbose=1) print(f"Test2 results: {test2_results}") # Plot ROC curve for test1 From 645a89de23f243a081c264fc4fa61f66a8953136 Mon Sep 17 00:00:00 2001 From: amirreza Date: Fri, 30 May 2025 10:53:49 +0200 Subject: [PATCH 53/83] changed params --- src/run_pMHC_DL_ESM.py | 33 +++++++++++++++++++++------------ 1 file changed, 21 insertions(+), 12 deletions(-) diff --git a/src/run_pMHC_DL_ESM.py b/src/run_pMHC_DL_ESM.py index 3f3da9490..d2daa8911 100644 --- a/src/run_pMHC_DL_ESM.py +++ b/src/run_pMHC_DL_ESM.py @@ -35,7 +35,6 @@ from sklearn.model_selection import train_test_split from tqdm import tqdm -from utils.create_ESM_dataset import mhc_class from utils.model import build_classifier from sklearn.metrics import ( confusion_matrix, roc_curve, auc, precision_score, @@ -102,7 +101,7 @@ def load_dataset(parquet_path: str): print(" peptide one-hot shape:", pep_onehot.shape) # 2) Latent embeddings -------------------------------------------------- - print(f" loading MHC {mhc_class} embeddings") + print(f" loading MHC embeddings") if "mhc_embedding" in df.columns: latents = np.stack(df["mhc_embedding"].values).astype("float32") elif "mhc_embedding_path" in df.columns: @@ -120,9 +119,13 @@ def load_dataset(parquet_path: str): return pep_onehot, latents, labels, pep_seq_len -def load_dataset_in_batches(parquet: str, target_seq_len: int, batch_size: int = 100): +def load_dataset_in_batches(parquet: str, target_seq_len: int, batch_size: int = 100, subset: float = None): print(f"→ reading {parquet} in batches of {batch_size}") - df = pd.read_parquet(parquet) + if subset is not None: + print(f" using subset fraction: {subset}") + df = pd.read_parquet(parquet).sample(frac=subset, random_state=42) + else: + df = pd.read_parquet(parquet) if "long_mer" not in df.columns: raise ValueError("Expected a 'long_mer' column with peptide sequences") # REMOVE or IGNORE: pep_seq_len = int(df["long_mer"].str.len().max()) # This was the problematic line for one-hot encoding @@ -141,7 +144,7 @@ def load_dataset_in_batches(parquet: str, target_seq_len: int, batch_size: int = if latents.shape[1:] != (36, 1152): raise ValueError(f"Unexpected latent shape {latents.shape[1:]}, expected (36,1152)") - labels = df["assigned_label"].values[start:end].astype("float32") + labels = df["assigned_label"].values[start:end].astype("int32") labels = labels[:, None] yield pep_onehot, latents, labels # Removed the local pep_seq_len from yield @@ -227,6 +230,11 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ y_true.extend(labels.numpy()) y_true = np.array(y_true) + # print ranges of y_true and y_pred + print(f"y_true range: {y_true.min()} to {y_true.max()}") + + print(f"y_pred range: {y_pred.min()} to {y_pred.max()}") + # Create confusion matrix cm = confusion_matrix(y_true, y_pred) sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', @@ -388,7 +396,7 @@ def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, hi # Create directory if it doesn't exist os.makedirs(run_dir, exist_ok=True) - out_png = os.path.join(run_dir, f"test_metrics{'_fold' + str(fold_id) if fold_id is not None else ''}.png") + out_png = os.path.join(run_dir, f"{string}_metrics{'_fold' + str(fold_id) if fold_id is not None else ''}.png") plt.savefig(out_png, dpi=300, bbox_inches='tight') plt.show() print(f"✓ Test metrics visualization saved to {out_png}") @@ -422,14 +430,15 @@ def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, hi # TF‑data helper # --------------------------------------------------------------------------- -def make_tf_dataset(source, longest_peptide_seq_length, batch: int = 128, shuffle: bool = True): +def make_tf_dataset(source, longest_peptide_seq_length, batch: int = 128, shuffle: bool = True, subset: float = None): if isinstance(source, (str, os.PathLike)): def gen(): # Pass longest_peptide_seq_length as target_seq_len # The generator now yields 3 items for peps, lats, labs in load_dataset_in_batches(str(source), target_seq_len=longest_peptide_seq_length, - batch_size=batch): + batch_size=batch, + subset=subset): yield (peps, lats), labs output_signature = ( (tf.TensorSpec(shape=(None, longest_peptide_seq_length, 21), dtype=tf.float32), @@ -602,7 +611,7 @@ def main(argv=None): train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') - train_loader = make_tf_dataset(train_path, longest_peptide_seq_length=longest_peptide_seq_length, batch=args.batch) + train_loader = make_tf_dataset(train_path, longest_peptide_seq_length=longest_peptide_seq_length, batch=args.batch, shuffle=True) val_loader = make_tf_dataset(val_path, longest_peptide_seq_length=longest_peptide_seq_length, batch=args.batch, shuffle=False) folds.append((train_loader, val_loader)) @@ -728,14 +737,14 @@ def main(argv=None): print(f"Test2 results: {test2_results}") # Plot ROC curve for test1 - plot_test_metrics(model, test1_loader, run_dir, fold_id, "Test1 - balanced alleles") + plot_test_metrics(model, test1_loader, run_dir, fold_id, string="Test1 - balanced alleles") # Plot ROC curve for test2 - plot_test_metrics(model, test2_loader, run_dir, fold_id, "Test2 - rare alleles") + plot_test_metrics(model, test2_loader, run_dir, fold_id, string="Test2 - rare alleles") if __name__ == "__main__": main([ # "--parquet", "../data/Custom_dataset/NetMHCpan_dataset/mhc_2/mhc2_with_esm_embeddings.parquet", "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_2", - "--epochs", "5", "--batch", "64" + "--epochs", "100", "--batch", "128" ]) \ No newline at end of file From 45df4dfee4b22aa8d1a4e34478745c1de8ae8779 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 3 Jun 2025 18:35:36 +0200 Subject: [PATCH 54/83] =?UTF-8?q?Add=20end-to-end=20trainer=20for=20peptid?= =?UTF-8?q?e=C3=97MHC=20cross-attention=20classifier?= MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit --- utils/run_pMHC_DL_ESM2.py | 916 ++++++++++++++++++++++++++++++++++++++ 1 file changed, 916 insertions(+) create mode 100644 utils/run_pMHC_DL_ESM2.py diff --git a/utils/run_pMHC_DL_ESM2.py b/utils/run_pMHC_DL_ESM2.py new file mode 100644 index 000000000..e7e7f0937 --- /dev/null +++ b/utils/run_pMHC_DL_ESM2.py @@ -0,0 +1,916 @@ +#!/usr/bin/env python +""" +========================= + +End‑to‑end trainer for a **peptide×MHC cross‑attention classifier**. +It loads a NetMHCpan‑style parquet that contains + + long_mer, assigned_label, allele, MHC_class, + mhc_embedding **OR** mhc_embedding_path + +columns. Each row supplies + +* a peptide sequence (long_mer) +* a pre‑computed MHC pseudo‑sequence embedding (36, 1152) +* a binary label (assigned_label) + +The script + +1.Derives the longest peptide length → SEQ_LEN. +2.Converts every peptide into a 21‑dim one‑hot tensor (SEQ_LEN, 21). +3.Feeds the pair + + (one_hot_peptide, mhc_latent) → classifier → P(binding) + +4.Trains with binary‑cross‑entropy and saves the best weights & metadata. + +Author : Amirreza (updated for cross‑attention, 2025‑05‑22) +""" +from __future__ import annotations +import os, sys, argparse, datetime, pathlib, json +from random import random + +print(sys.executable) + +import numpy as np +import pandas as pd +import tensorflow as tf +import matplotlib.pyplot as plt +from sklearn.model_selection import train_test_split +from tqdm import tqdm + +# from utils.model import build_classifier +from model_archive import build_custom_classifier +from sklearn.metrics import ( + confusion_matrix, roc_curve, auc, precision_score, + recall_score, f1_score, accuracy_score, roc_auc_score +) +import seaborn as sns + +import os, gc, warnings +from typing import Generator, Tuple, Union + +import pyarrow.parquet as pq + + +# --------------------------------------------------------------------------- +# Utility: peptide → one‑hot (seq_len, 21) +# --------------------------------------------------------------------------- +AA = "ACDEFGHIKLMNPQRSTVWY" # 20 standard AAs, order fixed +AA_TO_IDX = {aa: i for i, aa in enumerate(AA)} +UNK_IDX = 20 # index for unknown / padding + +AA = tf.constant(list("ACDEFGHIKLMNPQRSTVWY")) +TABLE = tf.lookup.StaticHashTable( + tf.lookup.KeyValueTensorInitializer(AA, + tf.range(20, dtype=tf.int32)), + default_value=20) # UNK_IDX + +# def peptides_to_onehot(seqs: list[str], seq_len: int) -> np.ndarray: +# """Vectorise *seqs* into (N, seq_len, 21) one‑hot with padding.""" +# N = len(seqs) +# arr = np.zeros((N, seq_len, 21), dtype=np.float32) +# for i, s in enumerate(seqs): +# if not s: +# raise "[ERR] empty peptide sequence" +# for j, aa in enumerate(s.upper()[:seq_len]): +# arr[i, j, AA_TO_IDX.get(aa, UNK_IDX)] = 1.0 +# # remaining positions stay zero → acts as padded UNK (index 20) +# return arr + + +# def peptides_to_onehot_kmer_windows(seqs, seq_len, k=9): +# # seqs : tf.Tensor([b'PEPTIDE', ...]) shape=(N,) +# # output: (N, RF, k, 21) where RF = seq_len - k + 1 +# tokens = tf.strings.bytes_split(seqs) # ragged ‹N, L› +# idx = TABLE.lookup(tokens.flat_values) +# ragged = tf.RaggedTensor.from_row_lengths(idx, tokens.row_lengths()) +# idx_pad = ragged.to_tensor(default_value=20, shape=(None, seq_len)) +# onehot = tf.one_hot(idx_pad, 21, dtype=tf.float32) # (N, seq_len, 21) +# +# RF = seq_len - k + 1 +# ta = tf.TensorArray(dtype=tf.float32, size=RF) +# def body(i, ta): +# slice_k = onehot[:, i:i+k, :] # (N, k, 21) +# return i+1, ta.write(i, slice_k) +# _, ta = tf.while_loop(lambda i, _: i < RF, body, [0, ta]) +# patches = ta.stack() # (RF, N, k, 21) +# return tf.transpose(patches, [1, 0, 2, 3]) # (N, RF, k, 21) + + +def kmer_token_frames(seqs: tf.Tensor, # shape=(N,), dtype=string + seq_len: int, + k: int = 9, + unk: int = 20): + """ + Vectorised k-mer framing that returns **integer** tokens. + Result: (N, RF, k) where RF = seq_len - k + 1 + """ + # 1 byte-split → lookup + tokens = tf.strings.bytes_split(seqs) # ragged ‹N,L› + idx = TABLE.lookup(tokens.flat_values) # 1-D ints + ragged = tf.RaggedTensor.from_row_lengths(idx, + tokens.row_lengths()) + idx_pad = ragged.to_tensor(default_value=unk, + shape=(None, seq_len)) # (N,L) + + # 2 slide a window over axis 1 in **one** op + frames = tf.signal.frame(idx_pad, # (N,RF,k) + frame_length=k, + frame_step=1, + axis=1) + return frames + +# --------------------------------------------------------------------------- +# tf.data convenience wrapper ---------------------------------------------- +# --------------------------------------------------------------------------- + +def _parquet_rowcount(parquet_path: str | os.PathLike) -> int: + return pq.ParquetFile(parquet_path).metadata.num_rows + + +def make_tf_dataset(source: Union[str, os.PathLike, tuple, tf.data.Dataset, pd.DataFrame], + *, + longest_peptide_seq_length: int, + max_mhc_seq_length: int, + batch: int = 128, + shuffle: bool = True, + augmentation: str = None, + test_batches: int = None) -> tf.data.Dataset: + """ + Create a memory‑aware ``tf.data.Dataset`` from *source* which can be: + + * **Pathlike** → stream Parquet in mini‑batches (zero‑copy Arrow) + * **pandas.DataFrame** → convert in‑memory table to tensors lazily + * **tuple** of numpy arrays/lists → classic RAM pipeline + * **tf.data.Dataset** → return after optional shuffle/batch tweaks + """ + # ---------------- pathlike -> streaming ----------------------------- + if isinstance(source, (str, os.PathLike)): + parquet_path = str(source) + + # Apply down-sampling augmentation for streaming data + if augmentation == 'down': + print(" applying down-sampling augmentation for streaming data") + + k = 9 + rf = longest_peptide_seq_length - k + 1 + output_signature = ( + ( + tf.TensorSpec(shape=(None, rf, k, 21), dtype=tf.float32), + tf.TensorSpec(shape=(None, max_mhc_seq_length, 1152), dtype=tf.float32), + ), + tf.TensorSpec(shape=(None, 1), dtype=tf.float32), + ) + + ds = tf.data.Dataset.from_generator( + lambda: load_dataset_in_batches_with_augmentation( + parquet_path, + target_seq_len=longest_peptide_seq_length, + batch_size=batch, + augmentation=augmentation, + ), + output_signature=output_signature, + ) + + if shuffle: + est_rows = _parquet_rowcount(parquet_path) + buffer_size = min(max(8, est_rows // batch // 10), 10 * batch) + ds = ds.shuffle(buffer_size=buffer_size, seed=42, reshuffle_each_iteration=True) + if test_batches is not None: + ds = ds.take(test_batches) + return ds + + return ds.prefetch(tf.data.AUTOTUNE) + + # ---------------- DataFrame -> in‑RAM dataset ------------------------ + if isinstance(source, pd.DataFrame): + df: pd.DataFrame = source.copy() # shallow copy to avoid surprises + + # Apply augmentation to DataFrame if specified + if augmentation == 'down': + df = apply_downsampling_augmentation(df) + + # Case A: original raw‑fields DataFrame -------------------------- + if {'long_mer', 'assigned_label'}.issubset(df.columns): + # pep_onehot = peptides_to_onehot_kmer_windows(df['long_mer'].tolist(), longest_peptide_seq_length) + frames = kmer_token_frames( + df['long_mer'].astype(str).values, + seq_len=longest_peptide_seq_length, + k=9 # k-mer framing + ) + pep_onehot = tf.one_hot(frames, depth=21, dtype=tf.float32).numpy() # (N, RF, k, 21) + + if 'mhc_embedding' in df.columns and df['mhc_embedding'].dtype != object: + latents = np.stack(df['mhc_embedding']).astype('float32') + else: + latents = np.stack([ + _read_embedding_file(p) for p in df['mhc_embedding_path'] + ]) + labels = df['assigned_label'].astype('float32').values[:, None] + + ds = tf.data.Dataset.from_tensor_slices(((pep_onehot, latents), labels)) + + # Case B: already‑vectorised columns ----------------------------- + elif len(df.columns) >= 3: + # Attempt heuristic mapping + arrs = [np.stack(df[c].values) if isinstance(df[c].iloc[0], (list, np.ndarray)) else df[c].values for c in + df.columns] + peps, lats, labels = arrs[:3] + ds = tf.data.Dataset.from_tensor_slices(((peps, lats), labels)) + else: + raise ValueError('DataFrame must contain raw fields (long_mer & label) or three array‑like columns.') + + if shuffle: + ds = ds.shuffle(buffer_size=len(df), seed=42) + if test_batches is not None: + ds = ds.take(test_batches) + return ds + return ds.batch(batch).prefetch(tf.data.AUTOTUNE) + + # ---------------- tf.data.Dataset -> return with tweaks -------------- + if isinstance(source, tf.data.Dataset): + ds = source + if shuffle: + ds = ds.shuffle(buffer_size=1000, seed=42) + # add batch op if elements are individual examples (rank>0 check) + if not isinstance(ds.element_spec[0][0].shape[0], tf.TensorShape): + ds = ds.batch(batch) + + if test_batches is not None: + ds = ds.take(test_batches) + return ds + return ds.prefetch(tf.data.AUTOTUNE) + + # ---------------- tuple/ndarray in‑memory ---------------------------- + if isinstance(source, tuple): + if len(source) == 3: + peps, lats, labels = source + elif len(source) == 2: + (peps, lats), labels = source + else: + raise ValueError('Tuple must be (peps,lats,labels) or ((peps,lats),labels).') + + ds = tf.data.Dataset.from_tensor_slices(((peps, lats), labels)) + if shuffle: + ds = ds.shuffle(buffer_size=len(labels), seed=42) + if test_batches is not None: + ds = ds.take(test_batches) + return ds + return ds.batch(batch).prefetch(tf.data.AUTOTUNE) + + raise TypeError(f'Unsupported *source* type {type(source).__name__}.') + + +def load_dataset_in_batches_with_augmentation(parquet_path: str, + target_seq_len: int, + batch_size: int, + augmentation: str = None): + """ + Modified generator that applies augmentation per chunk during streaming. + """ + pq_file = pq.ParquetFile(parquet_path) + + for batch_df in pq_file.iter_batches(batch_size=batch_size): + chunk_df = batch_df.to_pandas() + + # Apply augmentation to each chunk individually + if augmentation == 'down': + chunk_df = apply_downsampling_augmentation(chunk_df) + + # Skip empty chunks after augmentation + if len(chunk_df) == 0: + continue + + # Process the chunk as usual + # pep_onehot = peptides_to_onehot_kmer_windows(chunk_df['long_mer'].tolist(), target_seq_len) + frames = kmer_token_frames( + chunk_df['long_mer'].astype(str).values, + seq_len=target_seq_len, + k=9 + ) + pep_onehot = tf.one_hot(frames, depth=21, dtype=tf.float32).numpy() # (N, RF, k, 21) + + if 'mhc_embedding' in chunk_df.columns and chunk_df['mhc_embedding'].dtype != object: + latents = np.stack(chunk_df['mhc_embedding']).astype('float32') + else: + latents = np.stack([ + _read_embedding_file(p) for p in chunk_df['mhc_embedding_path'] + ]) + + labels = chunk_df['assigned_label'].astype('float32').values[:, None] + + yield (pep_onehot, latents), labels + + +def apply_downsampling_augmentation(df: pd.DataFrame) -> pd.DataFrame: + """ + Apply down-sampling augmentation to balance classes in a DataFrame chunk. + Calculates the sampling ratio for each chunk individually. + """ + if 'assigned_label' not in df.columns: + return df + + # Calculate class distribution for this specific chunk + pos_count = (df['assigned_label'] == 1).sum() + neg_count = (df['assigned_label'] == 0).sum() + + if pos_count == 0 or neg_count == 0: + # If chunk has only one class, return as-is + return df + + # Determine minority class and target count + min_count = min(pos_count, neg_count) + + seed = np.random.randint(1, 10000) + + # Sample equal numbers from each class + pos_samples = df[df['assigned_label'] == 1].sample( + n=min_count, + random_state=seed, + replace=False + ) + neg_samples = df[df['assigned_label'] == 0].sample( + n=min_count, + random_state=seed, + replace=False + ) + + # Combine and shuffle + balanced_df = pd.concat([pos_samples, neg_samples], ignore_index=True) + balanced_df = balanced_df.sample(frac=1, random_state=seed).reset_index(drop=True) + + # print(f" chunk: {pos_count} pos, {neg_count} neg -> {len(balanced_df)} balanced samples") + + return balanced_df +# --------------------------------------------------------------------------- +# Robust loader for latent embeddings (same as before) +# --------------------------------------------------------------------------- + +def _read_embedding_file(path: str | os.PathLike) -> np.ndarray: + # Try fast numeric path first + try: + arr = np.load(path) + if isinstance(arr, np.ndarray) and arr.dtype == np.float32: + return arr + raise ValueError + except ValueError: + obj = np.load(path, allow_pickle=True) + if isinstance(obj, np.ndarray) and obj.dtype == object: + obj = obj.item() + if isinstance(obj, dict) and "embedding" in obj: + return obj["embedding"].astype("float32") + raise ValueError(f"Unrecognised embedding file {path}") + + +# --------------------------------------------------------------------------- +# Dataset loader – returns (peptide_onehot, latent), labels +# --------------------------------------------------------------------------- + +def load_dataset(parquet_path: str): + print(f"→ Reading {parquet_path}") + df = pd.read_parquet(parquet_path) + + # 1) Peptide one‑hot ---------------------------------------------------- + if "long_mer" not in df.columns: + raise ValueError("Expected a 'long_mer' column with peptide sequences") + pep_seq_len = int(df["long_mer"].str.len().max()) + print(f" longest peptide = {pep_seq_len} residues") + # pep_onehot = peptides_to_onehot_kmer_windows(df["long_mer"].tolist(), pep_seq_len) + frames = kmer_token_frames(df["long_mer"].astype(str).values, + seq_len=pep_seq_len, + k=9) # k-mer framing + pep_onehot = tf.one_hot(frames, depth=21, dtype=tf.float32).numpy() # (N, RF, k, 21) + print(" peptide one-hot shape:", pep_onehot.shape) + + # 2) Latent embeddings -------------------------------------------------- + print(f" loading MHC embeddings") + if "mhc_embedding" in df.columns: + latents = np.stack(df["mhc_embedding"].values).astype("float32") + max_mhc_seq_length = latents.shape[1] + elif "mhc_embedding_path" in df.columns: + latents = np.stack([_read_embedding_file(p) for p in df["mhc_embedding_path"]]) + max_mhc_seq_length = latents.shape[1] + else: + raise ValueError("Need 'mhc_embedding' or 'mhc_embedding_path' column") + + print(" latent shape:", latents.shape) + print(" max_mhc_seq_length:", max_mhc_seq_length) + # if latents.shape[1:] != (36, 1152): + # raise ValueError(f"Unexpected latent shape {latents.shape[1:]}, expected (36,1152)") + + # 3) Labels ------------------------------------------------------------- + labels = df["assigned_label"].astype("float32").values[:, None] # (N,1) + + return pep_onehot, latents, labels, pep_seq_len, max_mhc_seq_length + +# --------------------------------------------------------------------------- +# Visualisation utility +# --------------------------------------------------------------------------- +def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_id: int = None, + model=None, val_dataset=None): + """ + Plot training curves and validation metrics from a Keras history object. + + Args: + history: Keras history object containing training metrics. + run_dir: Directory to save the plot. + fold_id: Optional fold identifier for naming the output file. + model: Optional model to compute confusion matrix and ROC curve. + val_dataset: Optional validation dataset to generate predictions. + + Returns: None + """ + hist = history.history + plt.figure(figsize=(21, 6)) + plot_name = f"training_curve{'_fold' + str(fold_id) if fold_id is not None else ''}" + + # set plot name above all plots + plt.suptitle(f"Training Curves{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", fontsize=16, fontweight='bold') + + # Plot 1: Loss curve + plt.subplot(1, 4, 1) + plt.plot(hist["loss"], label="train", linewidth=2) + plt.plot(hist["val_loss"], label="val", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Loss") + plt.title("BCE Loss") + plt.legend() + plt.grid(True, alpha=0.3) + + # Plot 2: Accuracy curve + if "binary_accuracy" in hist and "val_binary_accuracy" in hist: + plt.subplot(1, 4, 2) + plt.plot(hist["binary_accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_binary_accuracy"], label="val acc", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Accuracy") + plt.title("Binary Accuracy") + plt.legend() + plt.grid(True, alpha=0.3) + elif "accuracy" in hist and "val_accuracy" in hist: + plt.subplot(1, 4, 2) + plt.plot(hist["accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_accuracy"], label="val acc", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Accuracy") + plt.title("Accuracy") + plt.legend() + plt.grid(True, alpha=0.3) + + # Plot 3: AUC curve + if "auc" in hist and "val_auc" in hist: + plt.subplot(1, 4, 3) + plt.plot(hist["auc"], label="train AUC", linewidth=2) + plt.plot(hist["val_auc"], label="val AUC", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("AUC") + plt.title("AUC") + plt.legend() + plt.grid(True, alpha=0.3) + + # Plot 4: Confusion matrix (if model and validation dataset provided) + if model is not None and val_dataset is not None: + plt.subplot(1, 4, 4) + + # Get predictions + y_pred_proba = model.predict(val_dataset) + y_pred_proba = np.array(y_pred_proba) + y_pred = (y_pred_proba > 0.5).astype(int) + + # Extract true labels + y_true = [] + for _, labels in val_dataset: + y_true.extend(labels.numpy()) + y_true = np.array(y_true) + + # print ranges of y_true and y_pred + print(f"y_true range: {y_true.min()} to {y_true.max()}") + + print(f"y_pred range: {y_pred.min()} to {y_pred.max()}") + + # Create confusion matrix + cm = confusion_matrix(y_true, y_pred) + sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', + xticklabels=['Negative', 'Positive'], + yticklabels=['Negative', 'Positive']) + plt.title('Confusion Matrix') + plt.xlabel('Predicted') + plt.ylabel('Actual') + else: + # If no model/dataset provided, show a placeholder or additional metric + plt.subplot(1, 4, 4) + plt.text(0.5, 0.5, 'Confusion Matrix\n(Requires model + val_dataset)', + ha='center', va='center', transform=plt.gca().transAxes, + bbox=dict(boxstyle="round,pad=0.3", facecolor="lightgray")) + plt.axis('off') + + # Save main plot + plt.tight_layout() + out_png = os.path.join(run_dir, f"{plot_name}.png") + + # Create directory if it doesn't exist + os.makedirs(run_dir, exist_ok=True) + + plt.savefig(out_png, dpi=300, bbox_inches='tight') + plt.show() + print(f"✓ Training curve saved to {out_png}") + + +def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, history=None, string: str =None): + """ + Plot comprehensive evaluation metrics for a test dataset using a trained model. + + Args: + model: Trained Keras model. + test_dataset: TensorFlow dataset for testing. + run_dir: Directory to save the plot. + fold_id: Optional fold identifier for naming the output file. + history: Optional training history object to display loss/accuracy curves. + + Returns: Dictionary containing evaluation metrics + """ + # Collect predictions + print("Generating predictions...") + y_pred_proba = model.predict(test_dataset) + y_pred_proba = np.array(y_pred_proba) + y_pred = (y_pred_proba > 0.5).astype(int).flatten() + + # Extract true labels + y_true = [] + for _, labels in test_dataset: + y_true.extend(labels.numpy()) + y_true = np.array(y_true).flatten() + + # Calculate ROC curve + fpr, tpr, _ = roc_curve(y_true, y_pred_proba.flatten()) + roc_auc = auc(fpr, tpr) + + # Create a multi-panel figure + plt.figure(figsize=(15, 10)) + plt.suptitle(f"{string} Evaluation Metrics{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", + fontsize=16, fontweight='bold') + + # Panel 1: ROC Curve + plt.subplot(2, 2, 1) + plt.plot(fpr, tpr, color='darkorange', lw=2, + label=f'ROC curve (AUC = {roc_auc:.4f})') + plt.plot([0, 1], [0, 1], color='navy', lw=2, linestyle='--', alpha=0.8) + plt.xlim([0.0, 1.0]) + plt.ylim([0.0, 1.05]) + plt.xlabel('False Positive Rate') + plt.ylabel('True Positive Rate') + plt.title('Receiver Operating Characteristic (ROC) Curve') + plt.legend(loc="lower right") + plt.grid(True, alpha=0.3) + + # Panel 2: Confusion Matrix + plt.subplot(2, 2, 2) + cm = confusion_matrix(y_true, y_pred) + sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', + xticklabels=['Negative', 'Positive'], + yticklabels=['Negative', 'Positive']) + plt.title('Confusion Matrix') + plt.xlabel('Predicted Label') + plt.ylabel('True Label') + + # Panel 3: Loss curve (if history provided) + if history is not None: + plt.subplot(2, 2, 3) + hist = history.history + plt.plot(hist.get("loss", []), label="train", linewidth=2) + plt.plot(hist.get("val_loss", []), label="val", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Loss") + plt.title("BCE Loss") + plt.legend() + plt.grid(True, alpha=0.3) + + # Panel 4: Accuracy curve (if available in history) + plt.subplot(2, 2, 4) + if "binary_accuracy" in hist and "val_binary_accuracy" in hist: + plt.plot(hist["binary_accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_binary_accuracy"], label="val acc", linewidth=2) + elif "accuracy" in hist and "val_accuracy" in hist: + plt.plot(hist["accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_accuracy"], label="val acc", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Accuracy") + plt.title("Accuracy") + plt.legend() + plt.grid(True, alpha=0.3) + else: + # Panel 3: Test metrics when history not available + plt.subplot(2, 2, 3) + + # Calculate metrics + accuracy = accuracy_score(y_true, y_pred) + precision = precision_score(y_true, y_pred, zero_division=0) + recall = recall_score(y_true, y_pred, zero_division=0) + f1 = f1_score(y_true, y_pred, zero_division=0) + + metrics = { + 'Accuracy': accuracy, + 'Precision': precision, + 'Recall': recall, + 'F1 Score': f1, + 'AUC': roc_auc + } + + # Create a bar chart for metrics + bars = plt.bar(range(len(metrics)), list(metrics.values()), + color=['skyblue', 'lightcoral', 'lightgreen', 'gold', 'orange'], + alpha=0.8, edgecolor='black', linewidth=1) + plt.xticks(range(len(metrics)), list(metrics.keys()), rotation=45, ha='right') + plt.ylim(0, 1.0) + plt.title('Test Set Evaluation Metrics') + plt.ylabel('Score') + plt.grid(True, alpha=0.3, axis='y') + + # Add values on top of bars + for i, (bar, value) in enumerate(zip(bars, metrics.values())): + plt.text(bar.get_x() + bar.get_width() / 2, bar.get_height() + 0.02, + f'{value:.4f}', ha='center', va='bottom', fontweight='bold') + + # Panel 4: Prediction distribution + plt.subplot(2, 2, 4) + plt.hist(y_pred_proba[y_true == 0], bins=30, alpha=0.7, + label='Negative Class', color='red', density=True) + plt.hist(y_pred_proba[y_true == 1], bins=30, alpha=0.7, + label='Positive Class', color='blue', density=True) + plt.axvline(x=0.5, color='black', linestyle='--', linewidth=2, + label='Decision Threshold') + plt.xlabel('Predicted Probability') + plt.ylabel('Density') + plt.title('Prediction Probability Distribution') + plt.legend() + plt.grid(True, alpha=0.3) + + plt.tight_layout() + + # Create directory if it doesn't exist + os.makedirs(run_dir, exist_ok=True) + + out_png = os.path.join(run_dir, f"{string}_metrics{'_fold' + str(fold_id) if fold_id is not None else ''}.png") + plt.savefig(out_png, dpi=300, bbox_inches='tight') + plt.show() + print(f"✓ Test metrics visualization saved to {out_png}") + + # Calculate and return evaluation metrics + metrics_dict = { + 'roc_auc': roc_auc, + 'accuracy': accuracy_score(y_true, y_pred), + 'precision': precision_score(y_true, y_pred, zero_division=0), + 'recall': recall_score(y_true, y_pred, zero_division=0), + 'f1': f1_score(y_true, y_pred, zero_division=0), + 'confusion_matrix': cm.tolist(), + 'fpr': fpr.tolist(), + 'tpr': tpr.tolist() + } + + # Print summary + print("\n" + "=" * 50) + print("TEST SET EVALUATION SUMMARY") + print("=" * 50) + print(f"Accuracy: {metrics_dict['accuracy']:.4f}") + print(f"Precision: {metrics_dict['precision']:.4f}") + print(f"Recall: {metrics_dict['recall']:.4f}") + print(f"F1 Score: {metrics_dict['f1']:.4f}") + print(f"ROC AUC: {metrics_dict['roc_auc']:.4f}") + print("=" * 50) + + return metrics_dict + +# --------------------------------------------------------------------------- +# Training script +# --------------------------------------------------------------------------- + +def main(argv=None): + p = argparse.ArgumentParser() + p.add_argument("--parquet", required=False, + help="Input parquet with peptide, latent, label") + p.add_argument("--dataset_path", default=None, + help="Path to a custom dataset (not parquet)") + p.add_argument("--epochs", type=int, default=30) + p.add_argument("--batch", type=int, default=128) + p.add_argument("--outdir", default=None, + help="Output dir (default: runs/run_YYYYmmdd-HHMMSS)") + p.add_argument("--val_fraction", type=float, default=0.2, + help="Fraction for train/val split") + p.add_argument("--augmentation", default=None, # GNUSS, down + help="Augmentation method for dataset (default: None)") + p.add_argument("--test_batches", type=int, default=None, + help="Limit to N batches for testing (default: None = use all data)") + + args = p.parse_args(argv) + + run_dir = args.outdir or f"runs/run_{datetime.datetime.now():%Y%m%d-%H%M%S}" + pathlib.Path(run_dir).mkdir(parents=True, exist_ok=True) + print(f"★ Outputs → {run_dir}\n") + + # ----------------------- Load & split ---------------------------------- + if args.parquet: + # peps, lats, labels, seq_len = load_dataset(args.parquet) + peps, lats, labels, longest_peptide_seq_length, max_mhc_seq_length = load_dataset(args.parquet) + + print(f"✓ loaded {len(peps):,} samples" + f" ({peps.shape[1]} residues, {lats.shape[1]} latent features)") + + X_train_p, X_val_p, X_train_l, X_val_l, y_train, y_val = train_test_split( + peps, lats, labels, + test_size=args.val_fraction, + random_state=42, + stratify=labels) + + train_loader = make_tf_dataset((X_train_p, X_train_l, y_train), longest_peptide_seq_length=longest_peptide_seq_length, max_mhc_seq_length=max_mhc_seq_length , batch=args.batch, shuffle=True, test_batches=args.test_batches, augmentation=args.augmentation) + val_loader = make_tf_dataset((X_val_p, X_val_l, y_val), longest_peptide_seq_length=longest_peptide_seq_length, max_mhc_seq_length=max_mhc_seq_length ,batch=args.batch, shuffle=False, test_batches=args.test_batches, augmentation=None) + + elif args.dataset_path: + # Load test sets + test1 = pd.read_parquet(args.dataset_path + "/test1.parquet") + test2 = pd.read_parquet(args.dataset_path + "/test2.parquet") + fold_files = sorted([f for f in os.listdir(os.path.join(args.dataset_path, f'folds')) if f.endswith('.parquet')]) + n_folds = len(fold_files) // 2 + + # Find the longest peptide sequence across all datasets + longest_peptide_seq_length = 0 + max_mhc_seq_length = 36 # TODO make dynamic later + + # Check test datasets + if "long_mer" in test1.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(test1["long_mer"].str.len().max())) + + if "long_mer" in test2.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(test2["long_mer"].str.len().max())) + + # Check all fold files + for i in range(1, n_folds + 1): + train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') + val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') + + train_df = pd.read_parquet(train_path) + val_df = pd.read_parquet(val_path) + + if "long_mer" in train_df.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(train_df["long_mer"].str.len().max())) + if "long_mer" in val_df.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(val_df["long_mer"].str.len().max())) + + print(f"✓ Longest peptide sequence length across all datasets: {longest_peptide_seq_length}") + + # Create fold datasets with consistent sequence length + folds = [] + for i in range(1, n_folds + 1): + train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') + val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') + + train_loader = make_tf_dataset(train_path, longest_peptide_seq_length=longest_peptide_seq_length, max_mhc_seq_length=max_mhc_seq_length, batch=args.batch, shuffle=True, augmentation=args.augmentation, test_batches=args.test_batches) + val_loader = make_tf_dataset(val_path, longest_peptide_seq_length=longest_peptide_seq_length, max_mhc_seq_length=max_mhc_seq_length, batch=args.batch, shuffle=False, test_batches=args.test_batches, augmentation=None) + + folds.append((train_loader, val_loader)) + + # Create test loaders with the same sequence length + test1_loader = make_tf_dataset(test1, longest_peptide_seq_length=longest_peptide_seq_length, max_mhc_seq_length=max_mhc_seq_length, batch=128, shuffle=False, augmentation=None, test_batches=args.test_batches) + test2_loader = make_tf_dataset(test2, longest_peptide_seq_length=longest_peptide_seq_length,max_mhc_seq_length=max_mhc_seq_length, batch=128, shuffle=False, augmentation=None, test_batches=args.test_batches) + + print(f"✓ loaded {len(test1):,} test1 samples, " + f"{len(test2):,} test2 samples, " + f"{len(folds)} folds") + else: + raise ValueError("Need either --parquet or --dataset_path argument") + + # ----------------------- Model ----------------------------------------- + # clear GPU memory + tf.keras.backend.clear_session() + # set random seeds for reproducibility + os.environ["PYTHONHASHSEED"] = "42" + os.environ["TF_DETERMINISTIC_OPS"] = "1" + tf.random.set_seed(42) + np.random.seed(42) + + # ------------------------- TRAIN -------------------------------------- + ckpt_cb = tf.keras.callbacks.ModelCheckpoint( + filepath=os.path.join(run_dir, 'best_weights.h5'), + monitor='val_loss', save_best_only=True, mode='min') + early_cb = tf.keras.callbacks.EarlyStopping( + monitor='val_loss', patience=10, restore_best_weights=True) + + if args.parquet: + tf.keras.backend.clear_session() + os.environ['PYTHONHASHSEED'] = '42' + os.environ['TF_DETERMINISTIC_OPS'] = '1' + model = build_custom_classifier(longest_peptide_seq_length, max_mhc_seq_length) + model.summary() + + history = model.fit(train_loader, + validation_data=val_loader, + epochs=args.epochs, + callbacks=[ckpt_cb, early_cb]) + + # plot + plot_training_curve(history, run_dir, fold_id=None, model=model, val_dataset=val_loader) + + # save model and metadata + model.save(os.path.join(run_dir, 'model.h5')) + metadata = { + "epochs": args.epochs, + "batch_size": args.batch, + "longest_peptide_seq_length": longest_peptide_seq_length, + "run_dir": run_dir + } + with open(os.path.join(run_dir, 'metadata.json'), 'w') as f: + json.dump(metadata, f, indent=4) + + + elif args.dataset_path: + for fold_id, (train_loader, val_loader) in enumerate(folds, start=1): + print(f'Training on fold {fold_id}/{len(folds)}') + tf.keras.backend.clear_session() + tf.random.set_seed(42) + np.random.seed(42) + print("########################### seq length: ", longest_peptide_seq_length) + model = build_custom_classifier(longest_peptide_seq_length, max_mhc_seq_length) + model.summary() + + # print one sample + # print("Sample input shape:", next(iter(train_loader))[0][0].shape) + # print("Sample latent shape:", next(iter(train_loader))[0][1].shape) + # print("Sample label shape:", next(iter(train_loader))[1].shape) + + # train one epoch at a time to resample (down-sample) differently each epoch + epoch_histories = [] + for ep in range(1, args.epochs + 1): + print(f'Epoch {ep}/{args.epochs}') + np.random.seed(ep) + tf.random.set_seed(ep) + # rebuild training loader (applies down-sampling & shuffle) with new seed + train_loader = make_tf_dataset( + train_path, + longest_peptide_seq_length=longest_peptide_seq_length, + max_mhc_seq_length=max_mhc_seq_length, + batch=args.batch, + shuffle=True, + augmentation=args.augmentation, + test_batches=args.test_batches + ) + + # Print an example batch shape + for (x_peps, x_mhc), y_labels in train_loader.take(1): + print("Peptide tensor shape:", x_peps.shape) + print("MHC tensor shape:", x_mhc.shape) + print("Labels shape:", y_labels.shape) + break + + + hist = model.fit( + train_loader, + validation_data=val_loader, + epochs=1, + callbacks=[ckpt_cb, early_cb] + ) + epoch_histories.append(hist) + # optionally combine epoch_histories for plotting or analysis + print(f"✓ Fold {fold_id} training completed, {len(epoch_histories)} epochs recorded.") + # Combine histories into a single History object + combined_history = tf.keras.callbacks.History() + combined_history.history = { + key: np.concatenate([h.history[key] for h in epoch_histories]) + for key in epoch_histories[0].history.keys() + } + + # plot + plot_training_curve(combined_history, run_dir, fold_id, model, val_loader) + + # save model and metadata + model.save(os.path.join(run_dir, f'model_fold_{fold_id}.h5')) + metadata = { + "fold_id": fold_id, + "epochs": args.epochs, + "batch_size": args.batch, + "seq_len": longest_peptide_seq_length, + "run_dir": run_dir + } + with open(os.path.join(run_dir, f'metadata_fold_{fold_id}.json'), 'w') as f: + json.dump(metadata, f, indent=4) + print(f"✓ Fold {fold_id} model saved to {run_dir}") + + # Evaluate on test sets + print("Evaluating on test1 set...") + test1_results = model.evaluate(test1_loader, verbose=1) + print(f"Test1 results: {test1_results}") + print("Evaluating on test2 set...") + test2_results = model.evaluate(test2_loader, verbose=1) + print(f"Test2 results: {test2_results}") + + # Plot ROC curve for test1 + plot_test_metrics(model, test1_loader, run_dir, fold_id, string="Test1 - balanced alleles") + # Plot ROC curve for test2 + plot_test_metrics(model, test2_loader, run_dir, fold_id, string="Test2 - rare alleles") + + +if __name__ == "__main__": + main([ + # "--parquet", "../data/Custom_dataset/NetMHCpan_dataset/mhc_2/mhc2_with_esm_embeddings.parquet", + "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_1", + "--epochs", "2", "--batch", "3200", "--augmentation", "down", "--test_batches", "10", + ]) \ No newline at end of file From 6dd70c4c384683e066e48dec2da61612fff683c6 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 3 Jun 2025 18:35:48 +0200 Subject: [PATCH 55/83] =?UTF-8?q?Add=20model=20visualization=20script=20fo?= =?UTF-8?q?r=20peptide=C3=97MHC=20cross-attention=20model?= MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit --- utils/visualize_tensorflow_model.py | 64 +++++++++++++++++++++++++++++ 1 file changed, 64 insertions(+) create mode 100644 utils/visualize_tensorflow_model.py diff --git a/utils/visualize_tensorflow_model.py b/utils/visualize_tensorflow_model.py new file mode 100644 index 000000000..9a32de4e1 --- /dev/null +++ b/utils/visualize_tensorflow_model.py @@ -0,0 +1,64 @@ +import tensorflow as tf +from tensorflow.keras.models import load_model +import os + +# Load the model +# Import the custom layer - adjust the import path as needed +# from utils.model import LatentProj, SelfAttentionBlock, CrossAttentionBlock, PeptideProj # Update this import based on where your LatentProj is defined +# with tf.keras.utils.custom_object_scope({'LatentProj': LatentProj,'PeptideProj': PeptideProj, 'SelfAttentionBlock': SelfAttentionBlock, 'CrossAttentionBlock': CrossAttentionBlock}): +# model = load_model('runs/run_20250603-111633/best_weights.h5') + +from utils.model_archive import AttentionLayer, PositionalEncoding, AnchorPositionExtractor +# Import any additional classes/functions used by Lambda layers +from utils.model_archive import * # Import all potential dependencies + + +import uuid + +def wrap_layer(layer_class): + def fn(**config): + config.pop('trainable', None) + config.pop('dtype', None) + # assign a unique name to avoid duplicates + config['name'] = f"{layer_class.__name__.lower()}_{uuid.uuid4().hex[:8]}" + return layer_class.from_config(config) + return fn + + +# Load the model with wrapped custom objects +model = load_model( + 'model_output/peptide_mhc_cross_attention_model.h5', + custom_objects={ + 'AttentionLayer': wrap_layer(AttentionLayer), + 'RotaryPositionalEncoding': wrap_layer(RotaryPositionalEncoding), + 'AnchorPositionExtractor': wrap_layer(AnchorPositionExtractor), + } +) +# Display and save the model's architecture + +# Display model summary +model.summary() + +# Create better visualization as SVG with cleaner layout +tf.keras.utils.plot_model( + model, + to_file='model_architecture.png', + show_shapes=True, + show_layer_names=True, + rankdir='TB', # Top to bottom layout + dpi=200, # Higher resolution + expand_nested=True, # Expand nested models to show all layers + show_layer_activations=True # Show activation functions +) + +# Create a simplified version showing only main components +tf.keras.utils.plot_model( + model, + to_file='model_architecture_simplified.png', + show_shapes=False, + show_layer_names=True, + rankdir='LR', # Left to right layout for simplified view + dpi=200, + expand_nested=True, # Expand nested models to show all layers + show_dtype=False +) \ No newline at end of file From f9b34af559bd26f43faebf73bfc59779b1686928 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 3 Jun 2025 18:36:01 +0200 Subject: [PATCH 56/83] Refactor k-fold CV function to support data augmentation and improve error handling --- utils/processing_functions.py | 57 +++++++++++++++++++++++------------ 1 file changed, 37 insertions(+), 20 deletions(-) diff --git a/utils/processing_functions.py b/utils/processing_functions.py index 3cbce3b67..148e73c1d 100644 --- a/utils/processing_functions.py +++ b/utils/processing_functions.py @@ -1257,7 +1257,7 @@ def create_k_fold_leave_one_out_stratified_cv( subset_prop: float = 1.0, train_size: float = 0.8, random_state: int = 42, - balance_method: str = "down_sampling" # "down_sampling" or "GNUSS" + augmentation: str = None # "down_sampling" or "GNUSS" ): """ Build *k* folds such that @@ -1275,7 +1275,12 @@ def create_k_fold_leave_one_out_stratified_cv( Each tuple = (train_df, val_df, left_out_id). """ rng = np.random.RandomState(random_state) - df = df.sample(frac=subset_prop, random_state=random_state).reset_index(drop=True) + if subset_prop < 1.0: + if subset_prop <= 0.0 or subset_prop > 1.0: + raise ValueError(f"subset_prop must be in (0, 1], got {subset_prop}") + # Take a random subset of the DataFrame + print(f"Taking {subset_prop * 100:.2f}% of the data for k-fold CV") + df = df.sample(frac=subset_prop, random_state=random_state).reset_index(drop=True) # --- pick the k IDs that will be held out completely ------------------- unique_ids = df[id_col].unique() @@ -1293,7 +1298,7 @@ def create_k_fold_leave_one_out_stratified_cv( # (GroupShuffleSplit with test_size=1 group) # --------------------------------------------------------------- gss = GroupShuffleSplit( - n_splits=1, test_size=1, random_state=rng.randint(1_000_000) + n_splits=1, test_size=1, random_state=42 ) (train_groups_idx, val_only_groups_idx), = gss.split( X=np.zeros(len(working_df)), y=None, groups=working_df[id_col] @@ -1308,7 +1313,7 @@ def create_k_fold_leave_one_out_stratified_cv( # 2) stratified split of *eligible* rows # --------------------------------------------------------------- sss = StratifiedShuffleSplit( - n_splits=1, train_size=train_size, random_state=rng.randint(1_000_000) + n_splits=1, train_size=train_size, random_state=42 ) train_idx, extra_val_idx = next( sss.split(df_eligible, df_eligible[target_col]) @@ -1318,21 +1323,24 @@ def create_k_fold_leave_one_out_stratified_cv( [df_val_only, df_eligible.iloc[extra_val_idx]], ignore_index=True ) + print(f"Fold size: train={len(df_train)}, val={len(df_val)} | ") + # --------------------------------------------------------------- # 3) balance train and val via down-sampling # --------------------------------------------------------------- - def _balance_down_sampling(frame: pd.DataFrame) -> pd.DataFrame: - min_count = frame[target_col].value_counts().min() - balanced_parts = [ - resample( - frame[frame[target_col] == lbl], - replace=False, - n_samples=min_count, - random_state=rng, - ) - for lbl in frame[target_col].unique() - ] - return pd.concat(balanced_parts, ignore_index=True) + # def _balance_down_sampling(frame: pd.DataFrame) -> pd.DataFrame: + # min_count = frame[target_col].value_counts().min() + # print(f"Balancing {len(frame)} rows to {min_count} per class") + # balanced_parts = [ + # resample( + # frame[frame[target_col] == lbl], + # replace=False, + # n_samples=min_count, + # random_state=rng, + # ) + # for lbl in frame[target_col].unique() + # ] + # return pd.concat(balanced_parts, ignore_index=True) def _balance_GNUSS(frame: pd.DataFrame) -> pd.DataFrame: """ @@ -1365,13 +1373,22 @@ def _balance_GNUSS(frame: pd.DataFrame) -> pd.DataFrame: # Combine and return return pd.concat(balanced_parts).reset_index(drop=True) - if balance_method == "GNUSS": + if augmentation == "GNUSS": df_train_bal = _balance_GNUSS(df_train) df_val_bal = _balance_GNUSS(df_val) - else: # default to down-sampling - df_train_bal = _balance_down_sampling(df_train) - df_val_bal = _balance_down_sampling(df_val) + # elif augmentation == "down_sampling": # default to down-sampling + # df_train_bal = _balance_down_sampling(df_train) + # df_val_bal = _balance_down_sampling(df_val) + elif not augmentation: + df_train_bal = df_train.copy() + df_val_bal = df_val.copy() + print("No augmentation applied, using original train and val sets.") + else: + raise ValueError(f"Unknown augmentation method: {augmentation}") + # Shuffle both datasets to avoid any ordering bias + df_train_bal = df_train_bal.sample(frac=1.0, random_state=rng).reset_index(drop=True) + df_val_bal = df_val_bal.sample(frac=1.0, random_state=rng).reset_index(drop=True) folds.append((df_train_bal, df_val_bal, left_out_id)) print( From 9d5efa5e12d851e60d663f94192fbed9f804a77d Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 3 Jun 2025 18:36:06 +0200 Subject: [PATCH 57/83] =?UTF-8?q?Add=20end-to-end=20trainer=20for=20peptid?= =?UTF-8?q?e=C3=97MHC=20cross-attention=20classifier?= MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit --- utils/model_archive.py | 697 +++++++++++++++++++++++++++++++++++++++++ 1 file changed, 697 insertions(+) create mode 100644 utils/model_archive.py diff --git a/utils/model_archive.py b/utils/model_archive.py new file mode 100644 index 000000000..7df71c426 --- /dev/null +++ b/utils/model_archive.py @@ -0,0 +1,697 @@ +#!/usr/bin/env python +""" +========================= + +End‑to‑end trainer for a **peptide×MHC cross‑attention classifier**. +It loads a NetMHCpan‑style parquet that contains + + long_mer, assigned_label, allele, MHC_class, + mhc_embedding **OR** mhc_embedding_path + +columns. Each row supplies + +* a peptide sequence (long_mer) +* a pre‑computed MHC pseudo‑sequence embedding (36, 1152) +* a binary label (assigned_label) + +The script + +1.Derives the longest peptide length → SEQ_LEN. +2.Converts every peptide into a 21‑dim one‑hot tensor (SEQ_LEN, 21). +3.Feeds the pair + + (one_hot_peptide, mhc_latent) → classifier → P(binding) + +4.Trains with binary‑cross‑entropy and saves the best weights & metadata. + +Author : Amirreza (updated for cross‑attention, 2025‑05‑22) +""" +from __future__ import annotations +import os, sys, argparse, datetime, pathlib, json +from random import random + +print(sys.executable) + +import numpy as np +import pandas as pd +import tensorflow as tf +import matplotlib.pyplot as plt +from sklearn.model_selection import train_test_split +from tqdm import tqdm + +from utils.model import build_classifier +from sklearn.metrics import ( + confusion_matrix, roc_curve, auc, precision_score, + recall_score, f1_score, accuracy_score, roc_auc_score +) +import seaborn as sns + +import os, gc, warnings +from typing import Generator, Tuple, Union + +import pyarrow.parquet as pq +from tensorflow import keras +from tensorflow.keras import layers + +# ~8×-40× faster on CPU, zero-copy on GPU +import tensorflow as tf + +AA = tf.constant(list("ACDEFGHIKLMNPQRSTVWY")) +TABLE = tf.lookup.StaticHashTable( + tf.lookup.KeyValueTensorInitializer(AA, + tf.range(20, dtype=tf.int32)), + default_value=20) # UNK_IDX + +def peptides_to_onehot_tf(seqs, seq_len, k=9): + # seqs : tf.Tensor([b'PEPTIDE', ...]) shape=(N,) + # output: (N, RF, k, 21) where RF = seq_len - k + 1 + tokens = tf.strings.bytes_split(seqs) # ragged ‹N, L› + idx = TABLE.lookup(tokens.flat_values) + ragged = tf.RaggedTensor.from_row_lengths(idx, tokens.row_lengths()) + idx_pad = ragged.to_tensor(default_value=20, shape=(None, seq_len)) + onehot = tf.one_hot(idx_pad, 21, dtype=tf.float32) # (N, seq_len, 21) + + RF = seq_len - k + 1 + ta = tf.TensorArray(dtype=tf.float32, size=RF) + def body(i, ta): + slice_k = onehot[:, i:i+k, :] # (N, k, 21) + return i+1, ta.write(i, slice_k) + _, ta = tf.while_loop(lambda i, _: i < RF, body, [0, ta]) + patches = ta.stack() # (RF, N, k, 21) + return tf.transpose(patches, [1, 0, 2, 3]) # (N, RF, k, 21) + + +class AttentionLayer(keras.layers.Layer): + """ + Custom multi-head attention layer supporting self- and cross-attention. + + Args: + input_dim (int): Input feature dimension. + output_dim (int): Output feature dimension per head. + type (str): 'self' or 'cross'. + heads (int): Number of attention heads. + resnet (bool): Whether to use residual connection. + return_att_weights (bool): Whether to return attention weights. + name (str): Name for weight scopes. + epsilon (float): Epsilon for layer normalization. + gate (bool): Whether to use gating mechanism. + """ + + def __init__(self, input_dim, output_dim, type, heads=4, + resnet=True, return_att_weights=False, name='attention', + epsilon=1e-6, gate=True, mask_token=-1., pad_token=-2.): + super().__init__(name=name) + assert isinstance(input_dim, int) and isinstance(output_dim, int) + assert type in ['self', 'cross'] + if resnet: + assert input_dim == output_dim + + self.input_dim = input_dim + self.output_dim = output_dim + self.type = type + self.heads = heads + self.resnet = resnet + self.return_att_weights = return_att_weights + self.epsilon = epsilon + self.gate = gate + self.mask_token = mask_token + self.pad_token = pad_token + + def build(self, x): + self.q = self.add_weight(shape=(self.heads, self.input_dim, self.output_dim), + initializer='random_normal', trainable=True, name=f'q_{self.name}') + self.k = self.add_weight(shape=(self.heads, self.input_dim, self.output_dim), + initializer='random_normal', trainable=True, name=f'k_{self.name}') + self.v = self.add_weight(shape=(self.heads, self.input_dim, self.output_dim), + initializer='random_normal', trainable=True, name=f'v_{self.name}') + if self.gate: + self.g = self.add_weight(shape=(self.heads, self.input_dim, self.output_dim), + initializer='random_uniform', trainable=True, name=f'gate_{self.name}') + self.norm = layers.LayerNormalization(epsilon=self.epsilon, name=f'ln_{self.name}') + if self.type == 'cross': + self.norm_context = layers.LayerNormalization(epsilon=self.epsilon, name=f'ln_context_{self.name}') + self.norm_out = layers.LayerNormalization(epsilon=self.epsilon, name=f'ln_out_{self.name}') + if self.resnet: + self.norm_resnet = layers.LayerNormalization(epsilon=self.epsilon, name=f'ln_resnet_{self.name}') + self.out_w = self.add_weight(shape=(self.output_dim * self.heads, self.output_dim), + initializer='random_normal', trainable=True, name=f'outw_{self.name}') + self.out_b = self.add_weight(shape=(self.output_dim,), initializer='zeros', + trainable=True, name=f'outb_{self.name}') + self.scale = 1.0 / tf.math.sqrt(tf.cast(self.output_dim, tf.float32)) + + def call(self, x, mask, context=None, context_mask=None): + """ + Args: + x: Tensor of shape (B, N, D) + mask: Tensor of shape (B,N) + context: Optional tensor (B, M, D) for cross-attention + """ + # Auto-generate padding mask if not provided (based on all-zero tokens) + mask = tf.cast(mask, tf.float32) # shape: (B, N) + + x_norm = self.norm(x) + if self.type == 'self': + q_input = k_input = v_input = x_norm + mask = tf.where(mask == self.pad_token, 0., + 1.) # all padded ones are 0 and masked ones (for mask learning) and normal ones are 1 + mask_k = mask_q = mask + else: + assert context is not None, "context is required for cross-attention" + assert context_mask is not None, "context_mask is required for cross-attention" + context_norm = self.norm_context(context) + q_input = x_norm + k_input = v_input = context_norm + mask_q = tf.where(mask == self.pad_token, 0., 1.) + mask_k = tf.where(context_mask == self.pad_token, 0., 1.) + + q = tf.einsum('bnd,hde->hbne', q_input, self.q) + k = tf.einsum('bmd,hde->hbme', k_input, self.k) + v = tf.einsum('bmd,hde->hbme', v_input, self.v) + + att = tf.einsum('hbne,hbme->hbnm', q, k) * self.scale + + # Add large negative mask to padded keys + mask_k = tf.expand_dims(mask_k, 1) # (B, 1, M) + mask_q = tf.expand_dims(mask_q, 1) # (B, 1, N) + attention_mask = tf.einsum('bqn,bkm->bnm', mask_q, mask_k) # (B, N, M) + attention_mask = tf.expand_dims(attention_mask, 0) # (1, B, N, M) + att += (1.0 - attention_mask) * -1e9 + + att = tf.nn.softmax(att, axis=-1) * attention_mask + + out = tf.einsum('hbnm,hbme->hbne', att, v) + + if self.gate: + g = tf.einsum('bnd,hde->hbne', x_norm, self.g) + g = tf.nn.sigmoid(g) + out *= g + + if self.resnet: + out += tf.expand_dims(x, axis=0) + out = self.norm_resnet(out) + + out = tf.transpose(out, [1, 2, 3, 0]) # (B, N, E, H) + out = tf.reshape(out, [tf.shape(x)[0], tf.shape(x)[1], self.output_dim * self.heads]) + out = tf.matmul(out, self.out_w) + self.out_b + + if self.resnet: + out += x + out = self.norm_out(out) + # Zero out padded tokens after bias addition + mask_exp = tf.expand_dims(mask, axis=-1) # (B, N, 1) + out *= mask_exp + return (out, att) if self.return_att_weights else out + + +class PositionalEncoding(keras.layers.Layer): + """ + Sinusoidal Positional Encoding layer that applies encodings + only to non-masked tokens. + + Args: + embed_dim (int): Dimension of embeddings (must match input last dim). + max_len (int): Maximum sequence length expected (used to precompute encodings). + """ + + def __init__(self, embed_dim, max_len: int =100, mask_token: float =-1., pad_token: float =-2., name: str ='positional_encoding'): + super().__init__(name=name) + self.embed_dim = embed_dim + self.max_len = max_len + self.mask_token = mask_token + self._name = name + self.pad_token = pad_token + + def build(self, x): + # Create (1, max_len, embed_dim) encoding matrix + pos = tf.range(self.max_len, dtype=tf.float32)[:, tf.newaxis] # (max_len, 1) + i = tf.range(self.embed_dim, dtype=tf.float32)[tf.newaxis, :] # (1, embed_dim) + angle_rates = 1 / tf.pow(300.0, (2 * (i // 2)) / tf.cast(self.embed_dim, tf.float32)) + angle_rads = pos * angle_rates # (max_len, embed_dim) + + # Apply sin to even indices, cos to odd indices + sines = tf.sin(angle_rads[:, 0::2]) + cosines = tf.cos(angle_rads[:, 1::2]) + + pos_encoding = tf.concat([sines, cosines], axis=-1) # (max_len, embed_dim) + pos_encoding = pos_encoding[tf.newaxis, ...] # (1, max_len, embed_dim) + self.pos_encoding = tf.cast(pos_encoding, dtype=tf.float32) + + def call(self, x, mask): + """ + Args: + x: Input tensor of shape (B, N, D) + mask: Tensor of shape (B,N) + Returns: + Tensor with positional encodings added for masked and non padded tokens. + """ + seq_len = tf.shape(x)[1] + pe = self.pos_encoding[:, :seq_len, :] # (1, N, D) + mask = tf.cast(mask[:, :, tf.newaxis], tf.float32) # (B, N, 1) + mask = tf.where(mask == self.pad_token, 0., 1.) + pe = pe * mask # zero out positions where mask is 0 + + return x + pe + + @property + def name(self): + return self._name + + +class RotaryPositionalEncoding(keras.layers.Layer): + """ + Rotary Positional Encoding layer for transformer models. + Applies rotary embeddings to the last two dimensions of the input. + Args: + embed_dim (int): Embedding dimension (must be even). + max_len (int): Maximum sequence length. + """ + + def __init__(self, embed_dim, max_len: int = 100, mask_token: float = -1., pad_token: float = -2., name: str = 'rotary_positional_encoding'): + super().__init__(name=name) + assert embed_dim % 2 == 0, "embed_dim must be even for rotary encoding" + self.embed_dim = embed_dim + self.max_len = max_len + self.mask_token = mask_token + self._name = name + self.pad_token = pad_token + + def build(self, x): + # Precompute rotary frequencies + pos = tf.range(self.max_len, dtype=tf.float32)[:, tf.newaxis] # (max_len, 1) + dim = tf.range(self.embed_dim // 2, dtype=tf.float32)[tf.newaxis, :] # (1, embed_dim//2) + inv_freq = 1.0 / (10000 ** (dim / (self.embed_dim // 2))) + freqs = pos * inv_freq # (max_len, embed_dim//2) + self.cos_cached = tf.cast(tf.cos(freqs), tf.float32) # (max_len, embed_dim//2) + self.sin_cached = tf.cast(tf.sin(freqs), tf.float32) # (max_len, embed_dim//2) + + def call(self, x, mask): + """ + Args: + x: Input tensor of shape (B, N, D) + mask: Tensor of shape (B, N) + Returns: + Tensor with rotary positional encoding applied. + """ + seq_len = tf.shape(x)[1] + cos = self.cos_cached[:seq_len, :] # (N, D//2) + sin = self.sin_cached[:seq_len, :] # (N, D//2) + cos = tf.expand_dims(cos, 0) # (1, N, D//2) + sin = tf.expand_dims(sin, 0) # (1, N, D//2) + + x1, x2 = tf.split(x, 2, axis=-1) # (B, N, D//2), (B, N, D//2) + x_rot = tf.concat([x1 * cos - x2 * sin, x1 * sin + x2 * cos], axis=-1) # (B, N, D) + + mask = tf.cast(mask[:, :, tf.newaxis], tf.float32) # (B, N, 1) + mask = tf.where(mask == self.pad_token, 0., 1.) + x_rot = x_rot * mask # zero out positions where mask is 0 + + return x_rot + + @property + def name(self): + return self._name + + +@tf.function +def select_indices(ind, n, m_range): + """ + Select top-n indices from `ind` (descending sorted) such that: + - First index is always selected. + - Each subsequent index has a distance from all previously selected + indices between m_range[0] and m_range[1], inclusive. + Args: + ind: Tensor of shape (B, N) with descending sorted indices. + n: Number of indices to select. + m_range: List or tuple [min_distance, max_distance] + Returns: + Tensor of shape (B, n) with selected indices per batch. + """ + m_min = tf.constant(m_range[0], dtype=tf.int32) + m_max = tf.constant(m_range[1], dtype=tf.int32) + + def per_batch_select(indices): + top = indices[0] + selected = tf.TensorArray(dtype=tf.int32, size=n) + selected = selected.write(0, top) + count = tf.constant(1) + i = tf.constant(1) + + def cond(i, count, selected): + return tf.logical_and(i < tf.shape(indices)[0], count < n) + + def body(i, count, selected): + candidate = indices[i] + selected_vals = selected.stack()[:count] + distances = tf.abs(selected_vals - candidate) + if_valid = tf.reduce_all( + tf.logical_and(distances >= m_min, distances <= m_max) + ) + selected = tf.cond(if_valid, + lambda: selected.write(count, candidate), + lambda: selected) + count = tf.cond(if_valid, lambda: count + 1, lambda: count) + return i + 1, count, selected + + _, _, selected = tf.while_loop( + cond, body, [i, count, selected], + shape_invariants=[i.get_shape(), count.get_shape(), tf.TensorShape(None)] + ) + return selected.stack() + + return tf.map_fn(per_batch_select, ind, dtype=tf.int32) + + +class AnchorPositionExtractor(keras.layers.Layer): + @property + def name(self): + return self._name + + def __init__(self, num_anchors, dist_thr, name='anchor_extractor', project=True, + mask_token=-1., pad_token=-2., return_att_weights=False): + super().__init__() + assert isinstance(dist_thr, list) and len(dist_thr) == 2 + assert num_anchors > 0 + self.num_anchors = num_anchors + self.dist_thr = dist_thr + self.name = name + self.project = project + self.mask_token = mask_token + self.pad_token = pad_token + self.return_att_weights = return_att_weights + + def build(self, input_shape): # att_out (B,N,E) + b, n, e = input_shape[0], input_shape[1], input_shape[2] + self.barcode = tf.random.uniform(shape=(1, 1, e)) # add as a token to input + self.q = self.add_weight(shape=(e, e), + initializer='random_normal', + trainable=True, name=f'query_{self.name}') + self.k = self.add_weight(shape=(e, e), + initializer='random_normal', + trainable=True, name=f'key_{self.name}') + self.v = self.add_weight(shape=(e, e), + initializer='random_normal', + trainable=True, name=f'value_{self.name}') + self.ln = layers.LayerNormalization(name=f'ln_{self.name}') + if self.project: + self.g = self.add_weight(shape=(self.num_anchors, e, e), + initializer='random_uniform', + trainable=True, name=f'gate_{self.name}') + self.w = self.add_weight(shape=(1, self.num_anchors, e, e), + initializer='random_normal', + trainable=True, name=f'w_{self.name}') + + def call(self, input, mask): # (B,N,E) this is peptide embedding and (B,N) for mask + + mask = tf.cast(mask, tf.float32) # (B, N) + mask = tf.where(mask == self.pad_token, 0., 1.) + + barcode = self.barcode + barcode = tf.broadcast_to(barcode, (tf.shape(input)[0], 1, tf.shape(input)[-1])) # (B,N,E) + q = tf.matmul(barcode, self.q) # (B,1,E)*(E,E)->(B,1,E) + k = tf.matmul(input, self.k) # (B,N,E)*(E,E)->(B,N,E) + v = tf.matmul(input, self.v) # (B,N,E)*(E,E)->(B,N,E) + scale = 1 / tf.math.sqrt(tf.cast(tf.shape(input)[-1], tf.float32)) + barcode_att = tf.matmul(q, k, transpose_b=True) * scale # (B,1,E)*(B,E,N)->(B,1,N) + # mask: (B,N) => (B,1,N) + mask_exp = tf.expand_dims(mask, axis=1) + additive_mask = (1.0 - mask_exp) * -1e9 + barcode_att += additive_mask + barcode_att = tf.nn.softmax(barcode_att) + barcode_att *= mask_exp # to remove the impact of row wise attention of padded tokens. since all are 1e-9 + barcode_out = tf.matmul(barcode_att, v) # (B,1,N)*(B,N,E)->(B,1,E) + # barcode_out represents a vector for all information from peptide + # barcode_att represents the anchor positions which are the tokens with highest weights + inds, weights, outs = self.find_anchor(input, + barcode_att) # (B,num_anchors) (B,num_anchors) (B, num_anchors, E) + if self.project: + pos_encoding = tf.broadcast_to( + tf.expand_dims(inds, axis=-1), + (tf.shape(outs)[0], tf.shape(outs)[1], tf.shape(outs)[2]) + ) + pos_encoding = tf.cast(pos_encoding, tf.float32) + dim = tf.cast(tf.shape(outs)[-1], tf.float32) + ra = tf.range(dim, dtype=tf.float32) / dim + pos_encoding = tf.sin(pos_encoding / tf.pow(40., ra)) + outs += pos_encoding + + weights_bc = tf.expand_dims(weights, axis=-1) + weights_bc = tf.broadcast_to(weights_bc, (tf.shape(weights_bc)[0], + tf.shape(weights_bc)[1], + tf.shape(outs)[-1] + )) # (B,num_anchors, E) + outs = tf.expand_dims(outs, axis=-2) # (B, num_anchors, 1, E) + outs_w = tf.matmul(outs, self.w) # (B,num_anchors,1,E)*(1,num_anchors,E,E)->(B,num_anchors,1,E) + outs_g = tf.nn.sigmoid(tf.matmul(outs, self.g)) + outs_w = tf.squeeze(outs_w, axis=-2) # (B,num_anchors,E) + outs_g = tf.squeeze(outs_g, axis=-2) + # multiply by attention weights from barcode_att to choose best anchors and additional feature gating + outs = outs_w * outs_g * weights_bc # (B, num_anchors, E) + outs = self.ln(outs) + # outs -> anchor info, inds -> anchor indeces, weights -> anchor att weights, barcode_out -> whole peptide features + # (B,num_anchors,E), (B,num_anchors), (B,num_anchors), (B,E) + if self.return_att_weights: + return outs, inds, weights, tf.squeeze(barcode_out, axis=1), barcode_att + else: + return outs, inds, weights, tf.squeeze(barcode_out, axis=1) + + def find_anchor(self, input, barcode_att): # (B,N,E), (B,1,N) + inds = tf.argsort(barcode_att, axis=-1, direction='DESCENDING', stable=False) # (B,1,N) + inds = tf.squeeze(inds, axis=1) # (B,N) + selected_inds = select_indices(inds, n=self.num_anchors, m_range=self.dist_thr) # (B,num_anchors) + sorted_selected_inds = tf.sort(selected_inds) + sorted_selected_weights = tf.gather(tf.squeeze(barcode_att, axis=1), + sorted_selected_inds, + axis=1, + batch_dims=1) # (B,num_anchors) + sorted_selected_output = tf.gather(input, sorted_selected_inds, axis=1, batch_dims=1) # (B,num_anchors,E) + return sorted_selected_inds, sorted_selected_weights, sorted_selected_output + + @name.setter + def name(self, value): + self._name = value + + +def generate_mhc(samples=1024, min_len=5, max_len=15, dim=16): + X_list = [] + mask_list = [] + + for _ in range(samples): + l = np.random.randint(min_len, max_len + 1) + x = np.random.rand(l, dim).astype(np.float32) + X_list.append(x) + mask = np.ones((l,), dtype=bool) + mask_list.append(mask) + + # Pad sequences + X_padded = tf.keras.preprocessing.sequence.pad_sequences( + X_list, maxlen=max_len, dtype='float32', padding='post' + ) # shape: (samples, max_len, dim) + + mask_padded = tf.keras.preprocessing.sequence.pad_sequences( + mask_list, maxlen=max_len, dtype=bool, padding='post' + ) # shape: (samples, max_len) + + # Compute masked mean (only over valid tokens) + mask_exp = np.expand_dims(mask_padded, axis=-1).astype(np.float32) # (samples, max_len, 1) + y = np.sum(X_padded * mask_exp, axis=1) / np.maximum(np.sum(mask_exp, axis=1), 1e-8) # (samples, dim) + mean_of_all = tf.reduce_mean(y) + y = tf.reduce_mean(y, axis=-1, keepdims=True) + y = np.where(y > mean_of_all, 1., 0.) + mask_padded = np.where(mask_padded == False, -2., 0.) + + return X_padded, y, mask_padded + +def generate_peptide(samples=1024, min_len=5, max_len=15, k=9): + """ + Generate random peptide one-hot tensors of shape (N, RF, k, 21) + where RF = max_len - k + 1. + """ + peptides = [] + for _ in range(samples): + l = np.random.randint(min_len, max_len + 1) + seq = np.random.choice(list("ACDEFGHIKLMNPQRSTVWY"), l) + seq_str = ''.join(seq) + peptides.append(seq_str) + # Convert to tf.Tensor + seqs = tf.constant(peptides) + RF = max_len - k + 1 + onehot = peptides_to_onehot_tf(seqs, max_len, k) # (N, RF, k, 21) + return onehot.numpy() + + + +# --------------------------------------------------------------------------- +# Constants & helpers +# --------------------------------------------------------------------------- +MASK_TOKEN = -1 +PAD_TOKEN = -2. + +def make_rf_mask(pep_batch: tf.Tensor) -> tf.Tensor: + """Return (B, RF) float mask for a peptide batch of shape *(B, RF,K,21)*. + + A slot is **1** when any (K,21) element is non‑zero, else **PAD_TOKEN**. + """ + # True where *any* channel is non‑zero → valid RF window + non_zero = tf.math.reduce_any(tf.not_equal(pep_batch, 0.), axis=[2, 3]) # (B, RF) + return tf.where(non_zero, 1., PAD_TOKEN) # float32 + + +#### define model +# input layers +def build_custom_classifier(max_len_peptide: int, + max_len_mhc: int, + k: int = 9, + embed_dim_pep: int = 64, + embed_dim_mhc: int = 128, + mask_token: float = MASK_TOKEN, + pad_token: float = PAD_TOKEN): + """Return a compiled Keras model that consumes + + pep_input : (RF_max, k, 21) + mhc_input : (max_len_mhc, 1152) + + RF_max is ``max_len_peptide − k + 1``. + """ + RF_max = max_len_peptide - k + 1 + + # ----- inputs ---------------------------------------------------------- + pep_input = keras.Input(shape=(RF_max, k, 21), name="pep_input") + mhc_input = keras.Input(shape=(max_len_mhc, 1152), name="mhc_input") + + # ----- peptide branch -------------------------------------------------- + pep_mask = layers.Lambda(make_rf_mask, name="pep_mask")(pep_input) # (B, RF) + + pep_flat = layers.Reshape((RF_max, k * 21), name="pep_flat")(pep_input) # (B, RF, k·21) + + # TODO, check if it make sence to do this before or after positional encoding + pep_proj = layers.Dense(embed_dim_pep, activation="relu", + name="pep_proj1")(pep_flat) # (B, RF, 64) + + pep_pe = RotaryPositionalEncoding(embed_dim_pep, max_len=RF_max, + mask_token=mask_token, pad_token=pad_token, + name="pep_pos_enc")(pep_proj, pep_mask) + + pep_att1 = AttentionLayer(input_dim=embed_dim_pep, output_dim=embed_dim_pep, + type="self", heads=4, name="pep_self_att1", + mask_token=mask_token, pad_token=pad_token)( + pep_pe, mask=pep_mask) + + # ----- MHC branch ------------------------------------------------------ + mhc_mask_bool = tf.math.reduce_any(tf.not_equal(mhc_input, 0.), axis=-1) + mhc_mask = layers.Lambda(lambda x: tf.where(x, 1., pad_token), + name="mhc_mask")(mhc_mask_bool) + + mhc_pe = RotaryPositionalEncoding(embed_dim=1152, max_len=max_len_mhc, + mask_token=mask_token, pad_token=pad_token, + name="mhc_pos_enc")(mhc_input, mhc_mask) + + mhc_proj1 = layers.Dense(embed_dim_mhc, activation="relu", + name="mhc_proj1")(mhc_pe) # (B, L_mhc,D_mhc) + + mhc_att1 = AttentionLayer(input_dim=embed_dim_mhc, output_dim=embed_dim_mhc, + type="self", heads=4, name="mhc_self_att1", + mask_token=mask_token, pad_token=pad_token)( + mhc_proj1, mask=mhc_mask) + mhc_att2, att_w1 = AttentionLayer(input_dim=embed_dim_mhc, output_dim=embed_dim_mhc, + type="self", heads=4, name="mhc_self_att2", + resnet=False, mask_token=mask_token, pad_token=pad_token, + return_att_weights=True)( + mhc_att1, mask=mhc_mask) # (B, L_mhc, D_mhc), att_weights + + + # NEW: project MHC tokens → pep embed‑dim (64) so Q/K/V dims align + mhc_to_D_pep = layers.Dense(embed_dim_pep, activation="relu", + name="mhc_to_D_pep")(mhc_att2) # (B, L_mhc, D_pep) + + # ----- cross‑attention ------------------------------------------------- + cross_att = AttentionLayer(input_dim=embed_dim_pep, output_dim=embed_dim_pep, + type="cross", heads=8, name="cross_att", + mask_token=mask_token, pad_token=pad_token)( + pep_att1, mask=pep_mask, + context=mhc_to_D_pep, context_mask=mhc_mask) + + cross_proj = layers.Dense(128, activation="relu", name="cross_proj")(cross_att) + + final_att = AttentionLayer(input_dim=128, output_dim=128, type="self", + heads=2, name="final_pep_self_att", + return_att_weights=True, + mask_token=mask_token, pad_token=pad_token)( + cross_proj, mask=pep_mask) + + final_features = AnchorPositionExtractor(num_anchors=2, dist_thr=[8, 15], # outs, inds, weights, barcode_out, barcode_att + name="anchor_extractor", # (B,num_anchors,E), (B,num_anchors), (B,num_anchors), (B,E), (B,N,N) + project=True, + return_att_weights=True, + mask_token=mask_token, pad_token=pad_token)( + final_att[0], mask=pep_mask) + + # ---------------------------------------------------------------------- + # Three heads (barcode, anchors, pooled) — unchanged + # ---------------------------------------------------------------------- + barcode_vec = final_features[-2] + x_bc = layers.Dense(32, activation="relu", name="barcodout1_dense")(barcode_vec) + x_bc = layers.Dropout(0.3, name="barcodout1_dropout")(x_bc) + out_bc = layers.Dense(1, activation="sigmoid", name="barcode_cls")(x_bc) + + anchor_feat = final_features[0] + x_an = layers.Flatten(name="anchorout_flatten")(anchor_feat) + x_an = layers.Dense(64, activation="relu", name="anchorout1_dense")(x_an) + x_an = layers.Dropout(0.3, name="anchorout1_dropout")(x_an) + x_an = layers.Dense(16, activation="relu", name="anchorout2_dense")(x_an) + x_an = layers.Dropout(0.3, name="anchorout2_dropout")(x_an) + out_an = layers.Dense(1, activation="sigmoid", name="anchor_cls")(x_an) + + pooled = layers.GlobalAveragePooling1D(name="attout_gap")(final_att[0]) + x_po = layers.Dense(32, activation="relu", name="attout1_dense")(pooled) + x_po = layers.Dropout(0.3, name="attout1_dropout")(x_po) + out_po = layers.Dense(1, activation="sigmoid", name="attn_cls")(x_po) + + model = keras.Model(inputs=[pep_input, mhc_input], + outputs=[out_bc, out_an, out_po], + name="PeptideMHC_CrossAtt") + + model.compile( + loss="binary_crossentropy", + optimizer="adam", + metrics={ + "barcode_cls": ["binary_accuracy", keras.metrics.AUC(name="auroc")], + "anchor_cls": ["binary_accuracy", keras.metrics.AUC(name="auroc")], + "attn_cls": ["binary_accuracy", keras.metrics.AUC(name="auroc")], + }, + ) + return model + +def main(): + max_len_peptide = 15 + k = 9 + max_len_mhc = 40 + RF_max = max_len_peptide - k + 1 + + model = build_custom_classifier(max_len_peptide, max_len_mhc, k=k) + model.summary(line_length=110) + + batch = 8 + # pep_dummy = np.zeros((batch, RF_max, k, 21), dtype=np.float32) + # pep_dummy[:, :3] = np.random.rand(batch, 3, k, 21) + # + # mhc_dummy = np.zeros((batch, max_len_mhc, 1152), dtype=np.float32) + # mhc_dummy[:, :25] = np.random.rand(batch, 25, 1152) + + pep_syn = generate_peptide(samples=1000, min_len=9, max_len=max_len_peptide, k=k) + mhc_syn, _, mhc_mask = generate_mhc(samples=1000, min_len=25, max_len=max_len_mhc, dim=1152) + + y = np.random.randint(0, 2, size=(1000, 1)).astype(np.float32) + + model.fit(x=[pep_syn, mhc_syn], y=[y, y, y], epochs=10, batch_size=batch) + + # save model + model_dir = pathlib.Path("model_output") + model_dir.mkdir(parents=True, exist_ok=True) + model_path = model_dir / "peptide_mhc_cross_attention_model.h5" + model.save(model_path) + print(f"Model saved to {model_path}") + + print("Sanity‑check complete — no dimension errors.") + +if __name__ == "__main__": + main() From db7061baa235afeb4fae1b11a7f64f6c12725d21 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 3 Jun 2025 18:36:14 +0200 Subject: [PATCH 58/83] Update MHC class and data processing in run_netmhcpan_script --- run_netmhcpan_script.py | 19 +++++++++++++------ 1 file changed, 13 insertions(+), 6 deletions(-) diff --git a/run_netmhcpan_script.py b/run_netmhcpan_script.py index 4f33c3016..1421f939e 100644 --- a/run_netmhcpan_script.py +++ b/run_netmhcpan_script.py @@ -717,13 +717,14 @@ def combine_datasets_(results_dir, include_dropped=False): # # task.result() def run_(arg1, arg2): - # mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/" + mhcII_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/" # mhcI_path = "data/NetMHCpan_dataset/NetMHCpan_train/" - # tmp_path = "data/NetMHCpan_dataset/tmp/" - tmp_path = "data/NetMHCpan_dataset/tmp_I/" - results_dir = "data/NetMHCpan_dataset/results_I/" + tmp_path = "data/NetMHCpan_dataset/tmp_II/" + # tmp_path = "data/NetMHCpan_dataset/tmp_I/" + # results_dir = "data/NetMHCpan_dataset/results_I/" + results_dir = "data/NetMHCpan_dataset/results_II/" - mhc_class = 1 + mhc_class = 2 # make tmp directory if not os.path.isdir(tmp_path): @@ -828,10 +829,16 @@ def run_(arg1, arg2): elif 'MHC' in df.columns and 'allele' in df.columns: df['allele'] = df['allele'].fillna(df['MHC']) df.drop(columns=['MHC'], inplace=True) + if "peptide" in df.columns: + if "long_mer" in df.columns: + df["peptide"] = df["peptide"].fillna(df["long_mer"]) + df.drop(columns=["long_mer"], inplace=True) + # rename the peptide to long_mer + df.rename(columns={"peptide": "long_mer"}, inplace=True) # drop duplicates print(f"Before dropping duplicates: {df.shape}") - df = df.drop_duplicates(subset=["allele", "peptide"], keep="first") + df = df.drop_duplicates(subset=["allele", "long_mer"], keep="first") print(f"After dropping duplicates: {df.shape}") # add mhc_sequence column From b0cda3a5b6f1da7d5d9f70230a5abfaef1c045e1 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 3 Jun 2025 18:36:19 +0200 Subject: [PATCH 59/83] Enhance dataset creation by integrating benchmark filtering and down-sampling augmentation --- utils/create_ESM_dataset.py | 169 ++++++++++++++++++++++++++---------- 1 file changed, 121 insertions(+), 48 deletions(-) diff --git a/utils/create_ESM_dataset.py b/utils/create_ESM_dataset.py index ae0ad63ea..34ef1944e 100644 --- a/utils/create_ESM_dataset.py +++ b/utils/create_ESM_dataset.py @@ -35,6 +35,8 @@ EMB_OUT_DIR = pathlib.Path( f"../data/Custom_dataset/{dataset_name}/mhc_{mhc_class}/mhc{mhc_class}_encodings" ) # or `None` to embed directly + +AUGMENTATION = "down_sampling" # "down_sampling" # "GNUSS", None # --------------------------------------------------------------------- @@ -144,7 +146,7 @@ def attach_embeddings( return df -def create_test_set(df: pd.DataFrame, samples_per_label: int=10000) -> dict[str, pd.DataFrame]: +def create_test_set(df: pd.DataFrame, bench_df= pd.DataFrame, samples_per_label: int=10000) -> dict[str, pd.DataFrame]: """ Create two test sets: - test1: equally sample samples_per_label from each assigned_label @@ -163,69 +165,140 @@ def create_test_set(df: pd.DataFrame, samples_per_label: int=10000) -> dict[str, train_mask = ~train_df_.index.isin(test1.index) train_updated = train_df_.loc[train_mask].reset_index(drop=True) - datasets['train'] = train_updated - datasets['test1'] = test1 + # remove alleles that are in the benchmark dataset from the train set + if not bench_df.empty: + # ensure the allele column is of type string + bench_df['allele'] = bench_df['allele'].astype(str) + # filter out alleles that are in the benchmark dataset + train_updated = train_updated[ + ~train_updated['allele'].isin(bench_df['allele']) + ].reset_index(drop=True) + + # drop the rows with nan assigned_label, allele and long_mer from the benchmark dataset + bench_df = bench_df.dropna(subset=['assigned_label', 'allele', 'long_mer']) + # ensure the assigned_label is of type int + bench_df['assigned_label'] = bench_df['assigned_label'].astype(int) + # ensure the long_mer is of type string + bench_df['long_mer'] = bench_df['long_mer'].astype(str) + # ensure the allele is of type string + bench_df['allele'] = bench_df['allele'].astype(str) + # ensure the mhc_class is of type int + bench_df['mhc_class'] = bench_df['mhc_class'].astype(int) + datasets["benchmark_dataset"] = bench_df + # test2: remove lowest-frequency allele from train to form test2 - allele_counts = datasets['train']['allele'].value_counts() + allele_counts = train_updated['allele'].value_counts() n_test2_samples = 0 i = 1 while n_test2_samples < 1000: i += 1 lowest_alleles = allele_counts.nsmallest(n=i).index.tolist() - test2 = datasets['train'][datasets['train']['allele'].isin(lowest_alleles)].copy() + test2 = train_updated[train_updated['allele'].isin(lowest_alleles)].copy() n_test2_samples = test2.shape[0] - datasets['train'] = ( - datasets['train'] - [datasets['train']['allele'].isin(lowest_alleles) == False] + train_updated = ( + train_updated + [train_updated['allele'].isin(lowest_alleles) == False] .reset_index(drop=True) ) + + datasets['train'] = train_updated + datasets['test1'] = test1 datasets['test2'] = test2 return datasets def main() -> None: - print("→ Loading cleaned NetMHCpan CSV") - df = pd.read_csv( - CSV_PATH, - usecols=["long_mer", "assigned_label", "allele", "mhc_class"], - ) - - # filter out - df = df[df["mhc_class"] == mhc_class] - - # drop mhc_class column - df = df.drop(columns=["mhc_class"]) - - print(f"→ Loading MHC class {mhc_class} embeddings") - emb_dict = load_mhc1_embeddings(NPZ_PATH) - - print("→ Merging") - df = attach_embeddings(df, emb_dict, EMB_OUT_DIR) - - # print("→ Dropping duplicates and nones") - df = df.drop_duplicates(subset=["long_mer", "allele"]) - df = df.dropna(subset=["long_mer"]) - - # move the label column to the end - label_col = "assigned_label" - cols = [col for col in df.columns if col != label_col] + [label_col] - df = df[cols] - - print(f"→ Writing parquet to {OUT_PARQUET}") - df.to_parquet(OUT_PARQUET, engine="pyarrow", index=False, compression="zstd") - - print(f"→ Dataset shape: {df.shape}") - - print("→ Create and save test sets") - datasets = create_test_set(df) - for name, subset in datasets.items(): - print(f"{name.capitalize()} set shape: {subset.shape}") - if name != "train": - subset.to_parquet(OUT_PARQUET.parent / f"{name}.parquet", index=False, engine="pyarrow", compression="zstd") - + # print("→ Loading cleaned NetMHCpan CSV") + # df = pd.read_csv( + # CSV_PATH, + # usecols=["long_mer", "assigned_label", "allele", "mhc_class"], + # ) + # + # # filter out + # df = df[df["mhc_class"] == mhc_class] + # + # print(len(df), "rows in the dataset after filtering for MHC class", mhc_class) + # + # # drop mhc_class column + # df = df.drop(columns=["mhc_class"]) + # + # print(f"→ Loading MHC class {mhc_class} embeddings") + # emb_dict = load_mhc1_embeddings(NPZ_PATH) + # + # print("→ Merging") + # df = attach_embeddings(df, emb_dict, EMB_OUT_DIR) + # + # print(len(df), "rows in the dataset after filtering for Mer") + # + # # print("→ Dropping duplicates and nones") + # df = df.drop_duplicates(subset=["long_mer", "allele"]) + # df = df.dropna(subset=["long_mer"]) + # + # print(len(df), "rows in the dataset after dropping duplicates and Nones") + # + # # move the label column to the end + # label_col = "assigned_label" + # cols = [col for col in df.columns if col != label_col] + [label_col] + # df = df[cols] + # + # print(len(df), "rows in the dataset after dropping duplicates and Nones") + # + # print(f"→ Writing parquet to {OUT_PARQUET}") + # df.to_parquet(OUT_PARQUET, engine="pyarrow", index=False, compression="zstd") + # + # print(f"→ Dataset shape: {df.shape}") + # + # + # # load benchmark datasets + # # bench_df1 = pd.read_csv( + # # "../data/Custom_dataset/benchmark_Conbot.csv", + # # usecols=["long_mer", "binding_label", "allele", "mhc_class"], + # # # rename columns to match the main dataset + # # dtype={"binding_label": "int8", "allele": "string", "mhc_class": "int8"}, + # # names=["long_mer", "assigned_label", "allele", "mhc_class"], + # # # convert binding_label to assigned_label + # # converters={"assigned_label": lambda x: 1 if x == "1" else 0}, + # # ) + # bench_df1 = pd.read_csv( + # "../data/Custom_dataset/benchmark_Conbot.csv") + # # rename columns to match the main dataset + # bench_df1 = bench_df1.rename(columns={ + # "binding_label": "assigned_label", + # }) + # # ensure the assigned_label is of type int + # bench_df1['assigned_label'] = bench_df1['assigned_label'].astype(int) + # # ensure the allele is of type string + # bench_df1['allele'] = bench_df1['allele'].astype(str) + # # convert II to 2 # and I to 1 + # bench_df1['mhc_class'] = bench_df1['mhc_class'].replace({"II": 2, "I": 1}) + # + # print(bench_df1.columns) + # # TODO process later + # bench_df2 = pd.read_csv( + # "../data/Custom_dataset/benchmark_ConvNeXT.csv", + # usecols=["allele"], + # + # ) + # + # # combine benchmark datasets + # bench_df = pd.concat([bench_df1, bench_df2], ignore_index=True) + # + # print("→ Create and save test sets") + # datasets = create_test_set(df, bench_df) + # for name, subset in datasets.items(): + # print(f"{name.capitalize()} set shape: {subset.shape}") + # if name != "train": + # subset.to_parquet(OUT_PARQUET.parent / f"{name}.parquet", index=False, engine="pyarrow", compression="zstd") + + ### + # TODO remove later + print("→ Loading existing dataset from parquet") + datasets = {} + datasets['train'] = pd.read_parquet(OUT_PARQUET, engine="pyarrow") + ### print("→ Creating cross-validation folds") folds = create_k_fold_leave_one_out_stratified_cv( @@ -233,7 +306,7 @@ def main() -> None: target_col="assigned_label", k=5, id_col="allele", - balance_method="down_sampling", + augmentation=AUGMENTATION, ) print("→ Saving folds to CSV") From 3e233fa25dec8adc3832f71519c20160fe7cc9c6 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 3 Jun 2025 18:36:22 +0200 Subject: [PATCH 60/83] Add print statement to display Python executable path --- src/run_pMHC_DL_ESM.py | 2 ++ 1 file changed, 2 insertions(+) diff --git a/src/run_pMHC_DL_ESM.py b/src/run_pMHC_DL_ESM.py index d2daa8911..2c959c9b3 100644 --- a/src/run_pMHC_DL_ESM.py +++ b/src/run_pMHC_DL_ESM.py @@ -28,6 +28,8 @@ """ from __future__ import annotations import os, sys, argparse, datetime, pathlib, json +print(sys.executable) + import numpy as np import pandas as pd import tensorflow as tf From dbf228f67407e0ae5a95e3f2a4541df0db408c87 Mon Sep 17 00:00:00 2001 From: amirreza Date: Tue, 3 Jun 2025 18:36:27 +0200 Subject: [PATCH 61/83] Add custom attention and positional encoding layers for enhanced model performance --- utils/model.py | 173 +++++++++++++++++++++++++++++++++++++++++++++++++ 1 file changed, 173 insertions(+) diff --git a/utils/model.py b/utils/model.py index 8a660c99a..b82459ba7 100644 --- a/utils/model.py +++ b/utils/model.py @@ -1638,6 +1638,175 @@ def test_step(self, data): # output = model((feat, cluster_prob), training=False) # print("Single sample prediction:", output.numpy()[0], "True label:", label.numpy()) + +# ------------------------------------------------------------------------------- # +# manual implementations +# ----------------------------------------------------------------------------- # +class AttentionLayer(keras.layers.Layer): + """ + Custom multi-head attention layer supporting self- and cross-attention. + + Args: + input_dim (int): Input feature dimension. + output_dim (int): Output feature dimension per head. + type (str): 'self' or 'cross'. + heads (int): Number of attention heads. + resnet (bool): Whether to use residual connection. + return_att_weights (bool): Whether to return attention weights. + name (str): Name for weight scopes. + epsilon (float): Epsilon for layer normalization. + gate (bool): Whether to use gating mechanism. + """ + + def __init__(self, input_dim, output_dim, type, heads=4, + resnet=True, return_att_weights=False, name='attention', + epsilon=1e-6, gate=True): + super().__init__(name=name) + assert isinstance(input_dim, int) and isinstance(output_dim, int) + assert type in ['self', 'cross'] + if resnet: + assert input_dim == output_dim + + self.input_dim = input_dim + self.output_dim = output_dim + self.type = type + self.heads = heads + self.resnet = resnet + self.return_att_weights = return_att_weights + self.epsilon = epsilon + self.gate = gate + + self.q = self.add_weight(shape=(heads, input_dim, output_dim), + initializer='random_normal', trainable=True, name=f'q_{name}') + self.k = self.add_weight(shape=(heads, input_dim, output_dim), + initializer='random_normal', trainable=True, name=f'k_{name}') + self.v = self.add_weight(shape=(heads, input_dim, output_dim), + initializer='random_normal', trainable=True, name=f'v_{name}') + if gate: + self.g = self.add_weight(shape=(heads, input_dim, output_dim), + initializer='random_uniform', trainable=True, name=f'gate_{name}') + self.norm = layers.LayerNormalization(epsilon=epsilon, name=f'ln_{name}') + self.norm_out = layers.LayerNormalization(epsilon=epsilon, name=f'ln_out_{name}') + if resnet: + self.norm_resnet = layers.LayerNormalization(epsilon=epsilon, name=f'ln_resnet_{name}') + self.out_w = self.add_weight(shape=(output_dim * heads, output_dim), + initializer='random_normal', trainable=True, name=f'outw_{name}') + self.out_b = self.add_weight(shape=(output_dim,), initializer='zeros', + trainable=True, name=f'outb_{name}') + self.scale = 1.0 / tf.math.sqrt(tf.cast(output_dim, tf.float32)) + + def call(self, x, context=None, mask=None): + """ + Args: + x: Tensor of shape (B, N, D) + context: Optional tensor (B, M, D) for cross-attention + mask: Optional boolean mask of shape (B, N) or (B, N, 1) + """ + # Auto-generate padding mask if not provided (based on all-zero tokens) + if mask is None: + mask = tf.reduce_sum(tf.abs(x), axis=-1) > 0 # shape: (B, N) + mask = tf.cast(mask, tf.float32) # shape: (B, N) + + x_norm = self.norm(x) + if self.type == 'self': + q_input = k_input = v_input = x_norm + mask_k = mask_q = mask + else: + assert context is not None, "context is required for cross-attention" + context_norm = self.norm(context) + q_input = x_norm + k_input = v_input = context_norm + mask_q = tf.cast(tf.reduce_sum(tf.abs(x), axis=-1) > 0, tf.float32) + mask_k = tf.cast(tf.reduce_sum(tf.abs(context), axis=-1) > 0, tf.float32) + + q = tf.einsum('bnd,hde->hbne', q_input, self.q) + k = tf.einsum('bmd,hde->hbme', k_input, self.k) + v = tf.einsum('bmd,hde->hbme', v_input, self.v) + + att = tf.einsum('hbne,hbme->hbnm', q, k) * self.scale + + # Add large negative mask to padded keys + mask_k = tf.expand_dims(mask_k, 1) # (B, 1, M) + mask_q = tf.expand_dims(mask_q, 1) # (B, 1, N) + attention_mask = tf.einsum('bqn,bkm->bnm', mask_q, mask_k) # (B, N, M) + attention_mask = tf.expand_dims(attention_mask, 0) # (1, B, N, M) + att += (1.0 - attention_mask) * -1e9 + + att = tf.nn.softmax(att, axis=-1) * attention_mask + + out = tf.einsum('hbnm,hbme->hbne', att, v) + + if self.gate: + g = tf.einsum('bnd,hde->hbne', x_norm, self.g) + g = tf.nn.sigmoid(g) + out *= g + + if self.resnet: + out += tf.expand_dims(x, axis=0) + out = self.norm_resnet(out) + + out = tf.transpose(out, [1, 2, 3, 0]) # (B, N, E, H) + out = tf.reshape(out, [tf.shape(x)[0], tf.shape(x)[1], self.output_dim * self.heads]) + out = tf.matmul(out, self.out_w) + self.out_b + + if self.resnet: + out += x + out = self.norm_out(out) + # Zero out padded tokens after bias addition + mask_exp = tf.expand_dims(mask, axis=-1) # (B, N, 1) + out *= mask_exp + return (out, att) if self.return_att_weights else out + + +class PositionalEncoding(keras.layers.Layer): + """ + Sinusoidal Positional Encoding layer that applies encodings + only to non-masked tokens. + + Args: + embed_dim (int): Dimension of embeddings (must match input last dim). + max_len (int): Maximum sequence length expected (used to precompute encodings). + """ + + def __init__(self, embed_dim, max_len=100): + super().__init__() + self.embed_dim = embed_dim + self.max_len = max_len + + # Create (1, max_len, embed_dim) encoding matrix + pos = tf.range(max_len, dtype=tf.float32)[:, tf.newaxis] # (max_len, 1) + i = tf.range(embed_dim, dtype=tf.float32)[tf.newaxis, :] # (1, embed_dim) + angle_rates = 1 / tf.pow(1000.0, (2 * (i // 2)) / tf.cast(embed_dim, tf.float32)) + angle_rads = pos * angle_rates # (max_len, embed_dim) + + # Apply sin to even indices, cos to odd indices + sines = tf.sin(angle_rads[:, 0::2]) + cosines = tf.cos(angle_rads[:, 1::2]) + + pos_encoding = tf.concat([sines, cosines], axis=-1) # (max_len, embed_dim) + pos_encoding = pos_encoding[tf.newaxis, ...] # (1, max_len, embed_dim) + self.pos_encoding = tf.cast(pos_encoding, dtype=tf.float32) + + def call(self, x, mask=None): + """ + Args: + x: Input tensor of shape (B, N, D) + mask: Optional boolean mask of shape (B, N). True = valid, False = padding + Returns: + Tensor with positional encodings added where mask is True. + """ + seq_len = tf.shape(x)[1] + pe = self.pos_encoding[:, :seq_len, :] # (1, N, D) + + if mask is not None: + mask = tf.cast(mask[:, :, tf.newaxis], tf.float32) # (B, N, 1) + pe = pe * mask # zero out positions where mask is 0 (# TODO: check if this is correct) + + return x + pe + +# --------------------------------------------------------------------------- # + + import tensorflow as tf from tensorflow.keras import layers, Model, Sequential @@ -1961,6 +2130,7 @@ def build_classifier(max_seq_len=50, name=f"cross_attn_block_{i + 1}" )(queries=fused, keys_values=pep_proj, query_mask=latent_mask, key_mask=pep_mask) + # --- Aggregation and prediction head ----------------------------------- # Global average pooling with masking latent_mask_expanded = tf.expand_dims(tf.cast(latent_mask, tf.float32), -1) # (B, R, 1) @@ -2126,3 +2296,6 @@ def build_classifier(max_seq_len=50, # labels = tf.random.uniform((320, 1), maxval=2, dtype=tf.int32) # model.fit([peptide_batch, latent_batch], labels, epochs=100) + +## Barcode peptides ## +# a model that creates a barcode for peptides by taking 9mer windows and returning a 1D vector that represents \ No newline at end of file From acef2d5341562ca0579ba70e64f0272722b1a93b Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 4 Jun 2025 16:13:53 +0200 Subject: [PATCH 62/83] cleanup --- utils/model.py | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/utils/model.py b/utils/model.py index b82459ba7..de81229ab 100644 --- a/utils/model.py +++ b/utils/model.py @@ -2287,7 +2287,7 @@ def build_classifier(max_seq_len=50, # if __name__ == "__main__": # SEQ_LEN = 15 # typical peptide length (adjust to your data) # -# model = build_classifier(seq_len=SEQ_LEN) +# model = build_classifier(max_seq_len=SEQ_LEN) # model.summary() # # # Training example (dummy): From a201d5631048b35554cb427309ad0c612655c30c Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 4 Jun 2025 16:13:58 +0200 Subject: [PATCH 63/83] cleanup --- utils/run_pMHC_DL_ESM2.py | 685 +++++++++++--------------------------- 1 file changed, 193 insertions(+), 492 deletions(-) diff --git a/utils/run_pMHC_DL_ESM2.py b/utils/run_pMHC_DL_ESM2.py index e7e7f0937..52580713b 100644 --- a/utils/run_pMHC_DL_ESM2.py +++ b/utils/run_pMHC_DL_ESM2.py @@ -27,6 +27,8 @@ Author : Amirreza (updated for cross‑attention, 2025‑05‑22) """ from __future__ import annotations + +import math import os, sys, argparse, datetime, pathlib, json from random import random @@ -39,87 +41,33 @@ from sklearn.model_selection import train_test_split from tqdm import tqdm -# from utils.model import build_classifier from model_archive import build_custom_classifier from sklearn.metrics import ( confusion_matrix, roc_curve, auc, precision_score, recall_score, f1_score, accuracy_score, roc_auc_score ) import seaborn as sns - -import os, gc, warnings -from typing import Generator, Tuple, Union - +import os import pyarrow.parquet as pq - -# --------------------------------------------------------------------------- -# Utility: peptide → one‑hot (seq_len, 21) -# --------------------------------------------------------------------------- -AA = "ACDEFGHIKLMNPQRSTVWY" # 20 standard AAs, order fixed -AA_TO_IDX = {aa: i for i, aa in enumerate(AA)} -UNK_IDX = 20 # index for unknown / padding - +# ---------------------------------------------------------------------------- +# 1) Peptide → k‑mer one‑hot *inside* TF graph (GPU/TPU friendly) +# ---------------------------------------------------------------------------- +pad_token = 20 AA = tf.constant(list("ACDEFGHIKLMNPQRSTVWY")) TABLE = tf.lookup.StaticHashTable( - tf.lookup.KeyValueTensorInitializer(AA, - tf.range(20, dtype=tf.int32)), - default_value=20) # UNK_IDX - -# def peptides_to_onehot(seqs: list[str], seq_len: int) -> np.ndarray: -# """Vectorise *seqs* into (N, seq_len, 21) one‑hot with padding.""" -# N = len(seqs) -# arr = np.zeros((N, seq_len, 21), dtype=np.float32) -# for i, s in enumerate(seqs): -# if not s: -# raise "[ERR] empty peptide sequence" -# for j, aa in enumerate(s.upper()[:seq_len]): -# arr[i, j, AA_TO_IDX.get(aa, UNK_IDX)] = 1.0 -# # remaining positions stay zero → acts as padded UNK (index 20) -# return arr - - -# def peptides_to_onehot_kmer_windows(seqs, seq_len, k=9): -# # seqs : tf.Tensor([b'PEPTIDE', ...]) shape=(N,) -# # output: (N, RF, k, 21) where RF = seq_len - k + 1 -# tokens = tf.strings.bytes_split(seqs) # ragged ‹N, L› -# idx = TABLE.lookup(tokens.flat_values) -# ragged = tf.RaggedTensor.from_row_lengths(idx, tokens.row_lengths()) -# idx_pad = ragged.to_tensor(default_value=20, shape=(None, seq_len)) -# onehot = tf.one_hot(idx_pad, 21, dtype=tf.float32) # (N, seq_len, 21) -# -# RF = seq_len - k + 1 -# ta = tf.TensorArray(dtype=tf.float32, size=RF) -# def body(i, ta): -# slice_k = onehot[:, i:i+k, :] # (N, k, 21) -# return i+1, ta.write(i, slice_k) -# _, ta = tf.while_loop(lambda i, _: i < RF, body, [0, ta]) -# patches = ta.stack() # (RF, N, k, 21) -# return tf.transpose(patches, [1, 0, 2, 3]) # (N, RF, k, 21) - - -def kmer_token_frames(seqs: tf.Tensor, # shape=(N,), dtype=string - seq_len: int, - k: int = 9, - unk: int = 20): - """ - Vectorised k-mer framing that returns **integer** tokens. - Result: (N, RF, k) where RF = seq_len - k + 1 - """ - # 1 byte-split → lookup + tf.lookup.KeyValueTensorInitializer(AA, tf.range(20, dtype=tf.int32)), + default_value=tf.constant(pad_token, dtype=tf.int32), # UNK / padding +) + +def kmer_onehot_tensor(seqs: tf.Tensor, seq_len: int, k: int = 9) -> tf.Tensor: + """Vectorised k‑mer framing + one‑hot with no Python loops.""" tokens = tf.strings.bytes_split(seqs) # ragged ‹N,L› - idx = TABLE.lookup(tokens.flat_values) # 1-D ints - ragged = tf.RaggedTensor.from_row_lengths(idx, - tokens.row_lengths()) - idx_pad = ragged.to_tensor(default_value=unk, - shape=(None, seq_len)) # (N,L) - - # 2 slide a window over axis 1 in **one** op - frames = tf.signal.frame(idx_pad, # (N,RF,k) - frame_length=k, - frame_step=1, - axis=1) - return frames + idx = TABLE.lookup(tokens.flat_values) + ragged = tf.RaggedTensor.from_row_lengths(idx, tokens.row_lengths()) + idx_pad = ragged.to_tensor(default_value=pad_token, shape=(None, seq_len)) # (N,L) + frames = tf.signal.frame(idx_pad, frame_length=k, frame_step=1, axis=1) # (N,RF,k) + return tf.one_hot(frames, depth=21, dtype=tf.float32) # (N,RF,k,21) # --------------------------------------------------------------------------- # tf.data convenience wrapper ---------------------------------------------- @@ -128,221 +76,6 @@ def kmer_token_frames(seqs: tf.Tensor, # shape=(N,), dtype=string def _parquet_rowcount(parquet_path: str | os.PathLike) -> int: return pq.ParquetFile(parquet_path).metadata.num_rows - -def make_tf_dataset(source: Union[str, os.PathLike, tuple, tf.data.Dataset, pd.DataFrame], - *, - longest_peptide_seq_length: int, - max_mhc_seq_length: int, - batch: int = 128, - shuffle: bool = True, - augmentation: str = None, - test_batches: int = None) -> tf.data.Dataset: - """ - Create a memory‑aware ``tf.data.Dataset`` from *source* which can be: - - * **Pathlike** → stream Parquet in mini‑batches (zero‑copy Arrow) - * **pandas.DataFrame** → convert in‑memory table to tensors lazily - * **tuple** of numpy arrays/lists → classic RAM pipeline - * **tf.data.Dataset** → return after optional shuffle/batch tweaks - """ - # ---------------- pathlike -> streaming ----------------------------- - if isinstance(source, (str, os.PathLike)): - parquet_path = str(source) - - # Apply down-sampling augmentation for streaming data - if augmentation == 'down': - print(" applying down-sampling augmentation for streaming data") - - k = 9 - rf = longest_peptide_seq_length - k + 1 - output_signature = ( - ( - tf.TensorSpec(shape=(None, rf, k, 21), dtype=tf.float32), - tf.TensorSpec(shape=(None, max_mhc_seq_length, 1152), dtype=tf.float32), - ), - tf.TensorSpec(shape=(None, 1), dtype=tf.float32), - ) - - ds = tf.data.Dataset.from_generator( - lambda: load_dataset_in_batches_with_augmentation( - parquet_path, - target_seq_len=longest_peptide_seq_length, - batch_size=batch, - augmentation=augmentation, - ), - output_signature=output_signature, - ) - - if shuffle: - est_rows = _parquet_rowcount(parquet_path) - buffer_size = min(max(8, est_rows // batch // 10), 10 * batch) - ds = ds.shuffle(buffer_size=buffer_size, seed=42, reshuffle_each_iteration=True) - if test_batches is not None: - ds = ds.take(test_batches) - return ds - - return ds.prefetch(tf.data.AUTOTUNE) - - # ---------------- DataFrame -> in‑RAM dataset ------------------------ - if isinstance(source, pd.DataFrame): - df: pd.DataFrame = source.copy() # shallow copy to avoid surprises - - # Apply augmentation to DataFrame if specified - if augmentation == 'down': - df = apply_downsampling_augmentation(df) - - # Case A: original raw‑fields DataFrame -------------------------- - if {'long_mer', 'assigned_label'}.issubset(df.columns): - # pep_onehot = peptides_to_onehot_kmer_windows(df['long_mer'].tolist(), longest_peptide_seq_length) - frames = kmer_token_frames( - df['long_mer'].astype(str).values, - seq_len=longest_peptide_seq_length, - k=9 # k-mer framing - ) - pep_onehot = tf.one_hot(frames, depth=21, dtype=tf.float32).numpy() # (N, RF, k, 21) - - if 'mhc_embedding' in df.columns and df['mhc_embedding'].dtype != object: - latents = np.stack(df['mhc_embedding']).astype('float32') - else: - latents = np.stack([ - _read_embedding_file(p) for p in df['mhc_embedding_path'] - ]) - labels = df['assigned_label'].astype('float32').values[:, None] - - ds = tf.data.Dataset.from_tensor_slices(((pep_onehot, latents), labels)) - - # Case B: already‑vectorised columns ----------------------------- - elif len(df.columns) >= 3: - # Attempt heuristic mapping - arrs = [np.stack(df[c].values) if isinstance(df[c].iloc[0], (list, np.ndarray)) else df[c].values for c in - df.columns] - peps, lats, labels = arrs[:3] - ds = tf.data.Dataset.from_tensor_slices(((peps, lats), labels)) - else: - raise ValueError('DataFrame must contain raw fields (long_mer & label) or three array‑like columns.') - - if shuffle: - ds = ds.shuffle(buffer_size=len(df), seed=42) - if test_batches is not None: - ds = ds.take(test_batches) - return ds - return ds.batch(batch).prefetch(tf.data.AUTOTUNE) - - # ---------------- tf.data.Dataset -> return with tweaks -------------- - if isinstance(source, tf.data.Dataset): - ds = source - if shuffle: - ds = ds.shuffle(buffer_size=1000, seed=42) - # add batch op if elements are individual examples (rank>0 check) - if not isinstance(ds.element_spec[0][0].shape[0], tf.TensorShape): - ds = ds.batch(batch) - - if test_batches is not None: - ds = ds.take(test_batches) - return ds - return ds.prefetch(tf.data.AUTOTUNE) - - # ---------------- tuple/ndarray in‑memory ---------------------------- - if isinstance(source, tuple): - if len(source) == 3: - peps, lats, labels = source - elif len(source) == 2: - (peps, lats), labels = source - else: - raise ValueError('Tuple must be (peps,lats,labels) or ((peps,lats),labels).') - - ds = tf.data.Dataset.from_tensor_slices(((peps, lats), labels)) - if shuffle: - ds = ds.shuffle(buffer_size=len(labels), seed=42) - if test_batches is not None: - ds = ds.take(test_batches) - return ds - return ds.batch(batch).prefetch(tf.data.AUTOTUNE) - - raise TypeError(f'Unsupported *source* type {type(source).__name__}.') - - -def load_dataset_in_batches_with_augmentation(parquet_path: str, - target_seq_len: int, - batch_size: int, - augmentation: str = None): - """ - Modified generator that applies augmentation per chunk during streaming. - """ - pq_file = pq.ParquetFile(parquet_path) - - for batch_df in pq_file.iter_batches(batch_size=batch_size): - chunk_df = batch_df.to_pandas() - - # Apply augmentation to each chunk individually - if augmentation == 'down': - chunk_df = apply_downsampling_augmentation(chunk_df) - - # Skip empty chunks after augmentation - if len(chunk_df) == 0: - continue - - # Process the chunk as usual - # pep_onehot = peptides_to_onehot_kmer_windows(chunk_df['long_mer'].tolist(), target_seq_len) - frames = kmer_token_frames( - chunk_df['long_mer'].astype(str).values, - seq_len=target_seq_len, - k=9 - ) - pep_onehot = tf.one_hot(frames, depth=21, dtype=tf.float32).numpy() # (N, RF, k, 21) - - if 'mhc_embedding' in chunk_df.columns and chunk_df['mhc_embedding'].dtype != object: - latents = np.stack(chunk_df['mhc_embedding']).astype('float32') - else: - latents = np.stack([ - _read_embedding_file(p) for p in chunk_df['mhc_embedding_path'] - ]) - - labels = chunk_df['assigned_label'].astype('float32').values[:, None] - - yield (pep_onehot, latents), labels - - -def apply_downsampling_augmentation(df: pd.DataFrame) -> pd.DataFrame: - """ - Apply down-sampling augmentation to balance classes in a DataFrame chunk. - Calculates the sampling ratio for each chunk individually. - """ - if 'assigned_label' not in df.columns: - return df - - # Calculate class distribution for this specific chunk - pos_count = (df['assigned_label'] == 1).sum() - neg_count = (df['assigned_label'] == 0).sum() - - if pos_count == 0 or neg_count == 0: - # If chunk has only one class, return as-is - return df - - # Determine minority class and target count - min_count = min(pos_count, neg_count) - - seed = np.random.randint(1, 10000) - - # Sample equal numbers from each class - pos_samples = df[df['assigned_label'] == 1].sample( - n=min_count, - random_state=seed, - replace=False - ) - neg_samples = df[df['assigned_label'] == 0].sample( - n=min_count, - random_state=seed, - replace=False - ) - - # Combine and shuffle - balanced_df = pd.concat([pos_samples, neg_samples], ignore_index=True) - balanced_df = balanced_df.sample(frac=1, random_state=seed).reset_index(drop=True) - - # print(f" chunk: {pos_count} pos, {neg_count} neg -> {len(balanced_df)} balanced samples") - - return balanced_df # --------------------------------------------------------------------------- # Robust loader for latent embeddings (same as before) # --------------------------------------------------------------------------- @@ -363,50 +96,82 @@ def _read_embedding_file(path: str | os.PathLike) -> np.ndarray: raise ValueError(f"Unrecognised embedding file {path}") -# --------------------------------------------------------------------------- -# Dataset loader – returns (peptide_onehot, latent), labels -# --------------------------------------------------------------------------- +# ---------------------------------------------------------------------------- +# 3) Streaming Parquet → tf.data.Dataset (stays in TF tensors the whole time) +# ---------------------------------------------------------------------------- -def load_dataset(parquet_path: str): - print(f"→ Reading {parquet_path}") - df = pd.read_parquet(parquet_path) - - # 1) Peptide one‑hot ---------------------------------------------------- - if "long_mer" not in df.columns: - raise ValueError("Expected a 'long_mer' column with peptide sequences") - pep_seq_len = int(df["long_mer"].str.len().max()) - print(f" longest peptide = {pep_seq_len} residues") - # pep_onehot = peptides_to_onehot_kmer_windows(df["long_mer"].tolist(), pep_seq_len) - frames = kmer_token_frames(df["long_mer"].astype(str).values, - seq_len=pep_seq_len, - k=9) # k-mer framing - pep_onehot = tf.one_hot(frames, depth=21, dtype=tf.float32).numpy() # (N, RF, k, 21) - print(" peptide one-hot shape:", pep_onehot.shape) - - # 2) Latent embeddings -------------------------------------------------- - print(f" loading MHC embeddings") - if "mhc_embedding" in df.columns: - latents = np.stack(df["mhc_embedding"].values).astype("float32") - max_mhc_seq_length = latents.shape[1] - elif "mhc_embedding_path" in df.columns: - latents = np.stack([_read_embedding_file(p) for p in df["mhc_embedding_path"]]) - max_mhc_seq_length = latents.shape[1] - else: - raise ValueError("Need 'mhc_embedding' or 'mhc_embedding_path' column") - print(" latent shape:", latents.shape) - print(" max_mhc_seq_length:", max_mhc_seq_length) - # if latents.shape[1:] != (36, 1152): - # raise ValueError(f"Unexpected latent shape {latents.shape[1:]}, expected (36,1152)") +def _load_parquet_rows(parquet_path, seq_len, k=9, test_batches=None): + pq_file = pq.ParquetFile(parquet_path) + batch_counter = 0 + for batch_df in pq_file.iter_batches(batch_size=2048): + if test_batches is not None and batch_counter >= test_batches: + break + df = batch_df.to_pandas() + + peps = tf.constant(df["long_mer"].astype(str).values, dtype=tf.string) + x_pep = kmer_onehot_tensor(peps, seq_len, k) # tf.Tensor on GPU/CPU + + if "mhc_embedding" in df.columns and df["mhc_embedding"].dtype != object: + latents = tf.constant(np.stack(df["mhc_embedding"]).astype("float32")) + else: + latents = tf.constant(np.stack([_read_embedding_file(p) for p in df["mhc_embedding_path"]])) + + labels = tf.constant(df["assigned_label"].astype("float32").values[:, None]) + batch_counter += 1 + yield (x_pep, latents), labels + + +def make_stream_dataset( + parquet_path: str, + max_pep_seq_len: int, + max_mhc_len: int, + batch: int = 512, + shuffle: bool = True, + k: int = 9, + test_batches: int = None +) -> tf.data.Dataset: + """Replacement for the "path‐like" branch; optimized to avoid caching when using small test_batches.""" + rf = max_pep_seq_len - k + 1 + output_signature = ( + ( + tf.TensorSpec(shape=(None, rf, k, 21), dtype=tf.float32), # one-hot peptide tensor + tf.TensorSpec(shape=(None, max_mhc_len, 1152), dtype=tf.float32), # latent embeddings + ), + tf.TensorSpec(shape=(None, 1), dtype=tf.float32), # labels + ) + + # Pass test_batches into generator to limit batches early + ds = tf.data.Dataset.from_generator( + lambda: _load_parquet_rows(parquet_path, max_pep_seq_len, k, test_batches), + output_signature=output_signature, + ) + + if shuffle: + ds = ds.shuffle(buffer_size=10 * batch, reshuffle_each_iteration=True) - # 3) Labels ------------------------------------------------------------- - labels = df["assigned_label"].astype("float32").values[:, None] # (N,1) + # If test_batches is provided, limit dataset and batch after + if test_batches is not None: + return ds.prefetch(tf.data.AUTOTUNE) + + # Batch *after* shuffle so that every epoch gets fresh mixes + return ds.cache().prefetch(tf.data.AUTOTUNE) + +# ---------------------------------------------------------------------------- +# 4) On‑the‑fly 1:1 class balancing without Pandas down‑sampling +# ---------------------------------------------------------------------------- - return pep_onehot, latents, labels, pep_seq_len, max_mhc_seq_length +def build_balanced_dataset(ds: tf.data.Dataset) -> tf.data.Dataset: + """Wrap a dataset so that every step yields a balanced positive/negative mini‑batch.""" + pos = ds.filter(lambda x, y: tf.reduce_any(tf.equal(y, 1))) + neg = ds.filter(lambda x, y: tf.reduce_any(tf.equal(y, 0))) + balanced = tf.data.experimental.sample_from_datasets([pos, neg], weights=[0.5, 0.5]) + return balanced # --------------------------------------------------------------------------- # Visualisation utility # --------------------------------------------------------------------------- + def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_id: int = None, model=None, val_dataset=None): """ @@ -475,7 +240,6 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ # Get predictions y_pred_proba = model.predict(val_dataset) - y_pred_proba = np.array(y_pred_proba) y_pred = (y_pred_proba > 0.5).astype(int) # Extract true labels @@ -533,7 +297,6 @@ def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, hi # Collect predictions print("Generating predictions...") y_pred_proba = model.predict(test_dataset) - y_pred_proba = np.array(y_pred_proba) y_pred = (y_pred_proba > 0.5).astype(int).flatten() # Extract true labels @@ -697,8 +460,6 @@ def main(argv=None): help="Output dir (default: runs/run_YYYYmmdd-HHMMSS)") p.add_argument("--val_fraction", type=float, default=0.2, help="Fraction for train/val split") - p.add_argument("--augmentation", default=None, # GNUSS, down - help="Augmentation method for dataset (default: None)") p.add_argument("--test_batches", type=int, default=None, help="Limit to N batches for testing (default: None = use all data)") @@ -709,75 +470,76 @@ def main(argv=None): print(f"★ Outputs → {run_dir}\n") # ----------------------- Load & split ---------------------------------- - if args.parquet: - # peps, lats, labels, seq_len = load_dataset(args.parquet) - peps, lats, labels, longest_peptide_seq_length, max_mhc_seq_length = load_dataset(args.parquet) - - print(f"✓ loaded {len(peps):,} samples" - f" ({peps.shape[1]} residues, {lats.shape[1]} latent features)") - - X_train_p, X_val_p, X_train_l, X_val_l, y_train, y_val = train_test_split( - peps, lats, labels, - test_size=args.val_fraction, - random_state=42, - stratify=labels) - - train_loader = make_tf_dataset((X_train_p, X_train_l, y_train), longest_peptide_seq_length=longest_peptide_seq_length, max_mhc_seq_length=max_mhc_seq_length , batch=args.batch, shuffle=True, test_batches=args.test_batches, augmentation=args.augmentation) - val_loader = make_tf_dataset((X_val_p, X_val_l, y_val), longest_peptide_seq_length=longest_peptide_seq_length, max_mhc_seq_length=max_mhc_seq_length ,batch=args.batch, shuffle=False, test_batches=args.test_batches, augmentation=None) - - elif args.dataset_path: - # Load test sets - test1 = pd.read_parquet(args.dataset_path + "/test1.parquet") - test2 = pd.read_parquet(args.dataset_path + "/test2.parquet") - fold_files = sorted([f for f in os.listdir(os.path.join(args.dataset_path, f'folds')) if f.endswith('.parquet')]) - n_folds = len(fold_files) // 2 - - # Find the longest peptide sequence across all datasets - longest_peptide_seq_length = 0 - max_mhc_seq_length = 36 # TODO make dynamic later - - # Check test datasets - if "long_mer" in test1.columns: - longest_peptide_seq_length = max(longest_peptide_seq_length, int(test1["long_mer"].str.len().max())) - - if "long_mer" in test2.columns: - longest_peptide_seq_length = max(longest_peptide_seq_length, int(test2["long_mer"].str.len().max())) - - # Check all fold files - for i in range(1, n_folds + 1): - train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') - val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') - - train_df = pd.read_parquet(train_path) - val_df = pd.read_parquet(val_path) - - if "long_mer" in train_df.columns: - longest_peptide_seq_length = max(longest_peptide_seq_length, int(train_df["long_mer"].str.len().max())) - if "long_mer" in val_df.columns: - longest_peptide_seq_length = max(longest_peptide_seq_length, int(val_df["long_mer"].str.len().max())) - - print(f"✓ Longest peptide sequence length across all datasets: {longest_peptide_seq_length}") - - # Create fold datasets with consistent sequence length - folds = [] - for i in range(1, n_folds + 1): - train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') - val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') - - train_loader = make_tf_dataset(train_path, longest_peptide_seq_length=longest_peptide_seq_length, max_mhc_seq_length=max_mhc_seq_length, batch=args.batch, shuffle=True, augmentation=args.augmentation, test_batches=args.test_batches) - val_loader = make_tf_dataset(val_path, longest_peptide_seq_length=longest_peptide_seq_length, max_mhc_seq_length=max_mhc_seq_length, batch=args.batch, shuffle=False, test_batches=args.test_batches, augmentation=None) - - folds.append((train_loader, val_loader)) - - # Create test loaders with the same sequence length - test1_loader = make_tf_dataset(test1, longest_peptide_seq_length=longest_peptide_seq_length, max_mhc_seq_length=max_mhc_seq_length, batch=128, shuffle=False, augmentation=None, test_batches=args.test_batches) - test2_loader = make_tf_dataset(test2, longest_peptide_seq_length=longest_peptide_seq_length,max_mhc_seq_length=max_mhc_seq_length, batch=128, shuffle=False, augmentation=None, test_batches=args.test_batches) - - print(f"✓ loaded {len(test1):,} test1 samples, " - f"{len(test2):,} test2 samples, " - f"{len(folds)} folds") - else: - raise ValueError("Need either --parquet or --dataset_path argument") + # Load test sets + test1 = pd.read_parquet(args.dataset_path + "/test1.parquet") + test2 = pd.read_parquet(args.dataset_path + "/test2.parquet") + esm_files = list(pathlib.Path(args.dataset_path).glob('*esm_embeddings.parquet')) + if not esm_files: + raise FileNotFoundError('No esm embeddings parquet found in dataset_path') + whole_data = pd.read_parquet(str(esm_files[0])) + + fold_files = sorted([f for f in os.listdir(os.path.join(args.dataset_path, f'folds')) if f.endswith('.parquet')]) + n_folds = len(fold_files) // 2 + + # Find the longest peptide sequence across all datasets + longest_peptide_seq_length = 0 + max_mhc_seq_length = 36 # TODO make dynamic later + + # Check test datasets + if "long_mer" in test1.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(test1["long_mer"].str.len().max())) + + if "long_mer" in test2.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(test2["long_mer"].str.len().max())) + # Check whole dataset + if "long_mer" in whole_data.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(whole_data["long_mer"].str.len().max())) + + # Create fold datasets with consistent sequence length + folds = [] + class_weights = [] + # Check all fold files + for i in range(1, n_folds + 1): + train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') + val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') + + train_loader = make_stream_dataset(train_path, max_pep_seq_len=longest_peptide_seq_length, max_mhc_len=max_mhc_seq_length, batch=args.batch, shuffle=True, test_batches=args.test_batches) + val_loader = make_stream_dataset(val_path, max_pep_seq_len=longest_peptide_seq_length, max_mhc_len=max_mhc_seq_length, batch=args.batch, shuffle=False, test_batches=args.test_batches) + + # # 3) Shuffle + cache + repeat + prefetch for infinite, fresh-each-epoch stream + # train_ds = (train_loader + # .shuffle(buffer_size=100_000, reshuffle_each_iteration=True) + # .cache() # or .cache("train.cache") + # .repeat() # infinite + # .prefetch(tf.data.AUTOTUNE)) + # + # # Validation can skip repeat() and caching if you prefer, but prefetch is still good: + # val_ds = (val_loader + # .shuffle(buffer_size=20_000, reshuffle_each_iteration=True) + # .cache() # optional for val + # .prefetch(tf.data.AUTOTUNE)) + + # Calculate class weights for the current fold + train_labels = pd.read_parquet(train_path)["assigned_label"].values.astype(int) + counts = np.bincount(train_labels, minlength=2) + cw = {0: 1.0, 1: 1.0} # Default weights if one class is missing or data is empty + if counts[0] > 0 and counts[1] > 0: # If both classes are present + total = counts.sum() + cw[0] = total / (2 * counts[0]) + cw[1] = total / (2 * counts[1]) + + folds.append((train_loader, val_loader)) + class_weights.append(cw) + + # Create test loaders with the same sequence length + test1_loader = make_stream_dataset(args.dataset_path + "/test1.parquet" + , max_pep_seq_len=longest_peptide_seq_length, max_mhc_len=max_mhc_seq_length, batch=128, shuffle=False) + test2_loader = make_stream_dataset(args.dataset_path + "/test2.parquet" + , max_pep_seq_len=longest_peptide_seq_length,max_mhc_len=max_mhc_seq_length, batch=128, shuffle=False) + + print(f"✓ loaded {len(test1):,} test1 samples, " + f"{len(test2):,} test2 samples, " + f"{len(folds)} folds") # ----------------------- Model ----------------------------------------- # clear GPU memory @@ -795,122 +557,61 @@ def main(argv=None): early_cb = tf.keras.callbacks.EarlyStopping( monitor='val_loss', patience=10, restore_best_weights=True) - if args.parquet: + for fold_id, ((train_loader, val_loader), class_weight) in enumerate(zip(folds, class_weights), start=1): + print(f'Training on fold {fold_id}/{len(folds)}') tf.keras.backend.clear_session() - os.environ['PYTHONHASHSEED'] = '42' - os.environ['TF_DETERMINISTIC_OPS'] = '1' - model = build_custom_classifier(longest_peptide_seq_length, max_mhc_seq_length) + tf.random.set_seed(42) + np.random.seed(42) + print("########################### seq length: ", longest_peptide_seq_length) + model = build_custom_classifier(longest_peptide_seq_length, max_mhc_seq_length, pad_token=pad_token) model.summary() - history = model.fit(train_loader, - validation_data=val_loader, - epochs=args.epochs, - callbacks=[ckpt_cb, early_cb]) + # check dimension of the target + if train_loader.element_spec[1].shape[-1] != 1: + raise ValueError("Expected binary labels (shape should be (None, 1))") + + print("Training model...") + hist = model.fit( + train_loader, + validation_data=val_loader, + epochs= args.epochs, + # class_weight=class_weight, + callbacks=[ckpt_cb, early_cb], + verbose=1, + ) # plot - plot_training_curve(history, run_dir, fold_id=None, model=model, val_dataset=val_loader) + plot_training_curve(hist, run_dir, fold_id, model, val_loader) # save model and metadata - model.save(os.path.join(run_dir, 'model.h5')) + model.save(os.path.join(run_dir, f'model_fold_{fold_id}.h5')) metadata = { + "fold_id": fold_id, "epochs": args.epochs, "batch_size": args.batch, - "longest_peptide_seq_length": longest_peptide_seq_length, + "seq_len": longest_peptide_seq_length, "run_dir": run_dir } - with open(os.path.join(run_dir, 'metadata.json'), 'w') as f: + with open(os.path.join(run_dir, f'metadata_fold_{fold_id}.json'), 'w') as f: json.dump(metadata, f, indent=4) + print(f"✓ Fold {fold_id} model saved to {run_dir}") + # Evaluate on test sets + print("Evaluating on test1 set...") + test1_results = model.evaluate(test1_loader, verbose=1) + print(f"Test1 results: {test1_results}") + print("Evaluating on test2 set...") + test2_results = model.evaluate(test2_loader, verbose=1) + print(f"Test2 results: {test2_results}") - elif args.dataset_path: - for fold_id, (train_loader, val_loader) in enumerate(folds, start=1): - print(f'Training on fold {fold_id}/{len(folds)}') - tf.keras.backend.clear_session() - tf.random.set_seed(42) - np.random.seed(42) - print("########################### seq length: ", longest_peptide_seq_length) - model = build_custom_classifier(longest_peptide_seq_length, max_mhc_seq_length) - model.summary() - - # print one sample - # print("Sample input shape:", next(iter(train_loader))[0][0].shape) - # print("Sample latent shape:", next(iter(train_loader))[0][1].shape) - # print("Sample label shape:", next(iter(train_loader))[1].shape) - - # train one epoch at a time to resample (down-sample) differently each epoch - epoch_histories = [] - for ep in range(1, args.epochs + 1): - print(f'Epoch {ep}/{args.epochs}') - np.random.seed(ep) - tf.random.set_seed(ep) - # rebuild training loader (applies down-sampling & shuffle) with new seed - train_loader = make_tf_dataset( - train_path, - longest_peptide_seq_length=longest_peptide_seq_length, - max_mhc_seq_length=max_mhc_seq_length, - batch=args.batch, - shuffle=True, - augmentation=args.augmentation, - test_batches=args.test_batches - ) - - # Print an example batch shape - for (x_peps, x_mhc), y_labels in train_loader.take(1): - print("Peptide tensor shape:", x_peps.shape) - print("MHC tensor shape:", x_mhc.shape) - print("Labels shape:", y_labels.shape) - break - - - hist = model.fit( - train_loader, - validation_data=val_loader, - epochs=1, - callbacks=[ckpt_cb, early_cb] - ) - epoch_histories.append(hist) - # optionally combine epoch_histories for plotting or analysis - print(f"✓ Fold {fold_id} training completed, {len(epoch_histories)} epochs recorded.") - # Combine histories into a single History object - combined_history = tf.keras.callbacks.History() - combined_history.history = { - key: np.concatenate([h.history[key] for h in epoch_histories]) - for key in epoch_histories[0].history.keys() - } - - # plot - plot_training_curve(combined_history, run_dir, fold_id, model, val_loader) - - # save model and metadata - model.save(os.path.join(run_dir, f'model_fold_{fold_id}.h5')) - metadata = { - "fold_id": fold_id, - "epochs": args.epochs, - "batch_size": args.batch, - "seq_len": longest_peptide_seq_length, - "run_dir": run_dir - } - with open(os.path.join(run_dir, f'metadata_fold_{fold_id}.json'), 'w') as f: - json.dump(metadata, f, indent=4) - print(f"✓ Fold {fold_id} model saved to {run_dir}") - - # Evaluate on test sets - print("Evaluating on test1 set...") - test1_results = model.evaluate(test1_loader, verbose=1) - print(f"Test1 results: {test1_results}") - print("Evaluating on test2 set...") - test2_results = model.evaluate(test2_loader, verbose=1) - print(f"Test2 results: {test2_results}") - - # Plot ROC curve for test1 - plot_test_metrics(model, test1_loader, run_dir, fold_id, string="Test1 - balanced alleles") - # Plot ROC curve for test2 - plot_test_metrics(model, test2_loader, run_dir, fold_id, string="Test2 - rare alleles") + # Plot ROC curve for test1 + plot_test_metrics(model, test1_loader, run_dir, fold_id, string="Test1 - balanced alleles") + # Plot ROC curve for test2 + plot_test_metrics(model, test2_loader, run_dir, fold_id, string="Test2 - rare alleles") if __name__ == "__main__": main([ - # "--parquet", "../data/Custom_dataset/NetMHCpan_dataset/mhc_2/mhc2_with_esm_embeddings.parquet", "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_1", - "--epochs", "2", "--batch", "3200", "--augmentation", "down", "--test_batches", "10", + "--epochs", "3", "--batch", "64", "--test_batches", "20" ]) \ No newline at end of file From b474393379fcb8b3ed5658693a018f5fe2655cae Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 4 Jun 2025 16:14:01 +0200 Subject: [PATCH 64/83] cleanup --- utils/model_archive.py | 170 ++++++++++++++++++++++++----------------- 1 file changed, 101 insertions(+), 69 deletions(-) diff --git a/utils/model_archive.py b/utils/model_archive.py index 7df71c426..c602c3d12 100644 --- a/utils/model_archive.py +++ b/utils/model_archive.py @@ -33,23 +33,6 @@ print(sys.executable) import numpy as np -import pandas as pd -import tensorflow as tf -import matplotlib.pyplot as plt -from sklearn.model_selection import train_test_split -from tqdm import tqdm - -from utils.model import build_classifier -from sklearn.metrics import ( - confusion_matrix, roc_curve, auc, precision_score, - recall_score, f1_score, accuracy_score, roc_auc_score -) -import seaborn as sns - -import os, gc, warnings -from typing import Generator, Tuple, Union - -import pyarrow.parquet as pq from tensorflow import keras from tensorflow.keras import layers @@ -581,17 +564,18 @@ def build_custom_classifier(max_len_peptide: int, mhc_mask = layers.Lambda(lambda x: tf.where(x, 1., pad_token), name="mhc_mask")(mhc_mask_bool) - mhc_pe = RotaryPositionalEncoding(embed_dim=1152, max_len=max_len_mhc, - mask_token=mask_token, pad_token=pad_token, - name="mhc_pos_enc")(mhc_input, mhc_mask) - + # TODO check if it is correct mhc_proj1 = layers.Dense(embed_dim_mhc, activation="relu", - name="mhc_proj1")(mhc_pe) # (B, L_mhc,D_mhc) + name="mhc_proj1")(mhc_input) # (B, L_mhc, D_mhc) + + mhc_pe = RotaryPositionalEncoding(embed_dim=embed_dim_mhc,max_len=max_len_mhc, + mask_token=mask_token,pad_token=pad_token, + name="mhc_pos_enc")(mhc_proj1, mhc_mask) mhc_att1 = AttentionLayer(input_dim=embed_dim_mhc, output_dim=embed_dim_mhc, type="self", heads=4, name="mhc_self_att1", mask_token=mask_token, pad_token=pad_token)( - mhc_proj1, mask=mhc_mask) + mhc_pe, mask=mhc_mask) mhc_att2, att_w1 = AttentionLayer(input_dim=embed_dim_mhc, output_dim=embed_dim_mhc, type="self", heads=4, name="mhc_self_att2", resnet=False, mask_token=mask_token, pad_token=pad_token, @@ -628,10 +612,10 @@ def build_custom_classifier(max_len_peptide: int, # ---------------------------------------------------------------------- # Three heads (barcode, anchors, pooled) — unchanged # ---------------------------------------------------------------------- - barcode_vec = final_features[-2] - x_bc = layers.Dense(32, activation="relu", name="barcodout1_dense")(barcode_vec) - x_bc = layers.Dropout(0.3, name="barcodout1_dropout")(x_bc) - out_bc = layers.Dense(1, activation="sigmoid", name="barcode_cls")(x_bc) + # barcode_vec = final_features[-2] + # x_bc = layers.Dense(32, activation="relu", name="barcodout1_dense")(barcode_vec) + # x_bc = layers.Dropout(0.3, name="barcodout1_dropout")(x_bc) + # out_bc = layers.Dense(1, activation="sigmoid", name="barcode_cls")(x_bc) anchor_feat = final_features[0] x_an = layers.Flatten(name="anchorout_flatten")(anchor_feat) @@ -641,57 +625,105 @@ def build_custom_classifier(max_len_peptide: int, x_an = layers.Dropout(0.3, name="anchorout2_dropout")(x_an) out_an = layers.Dense(1, activation="sigmoid", name="anchor_cls")(x_an) - pooled = layers.GlobalAveragePooling1D(name="attout_gap")(final_att[0]) - x_po = layers.Dense(32, activation="relu", name="attout1_dense")(pooled) - x_po = layers.Dropout(0.3, name="attout1_dropout")(x_po) - out_po = layers.Dense(1, activation="sigmoid", name="attn_cls")(x_po) + # pooled = layers.GlobalAveragePooling1D(name="attout_gap")(final_att[0]) + # x_po = layers.Dense(32, activation="relu", name="attout1_dense")(pooled) + # x_po = layers.Dropout(0.3, name="attout1_dropout")(x_po) + # out_po = layers.Dense(1, activation="sigmoid", name="attn_cls")(x_po) model = keras.Model(inputs=[pep_input, mhc_input], - outputs=[out_bc, out_an, out_po], + outputs=out_an, name="PeptideMHC_CrossAtt") model.compile( loss="binary_crossentropy", optimizer="adam", metrics={ - "barcode_cls": ["binary_accuracy", keras.metrics.AUC(name="auroc")], - "anchor_cls": ["binary_accuracy", keras.metrics.AUC(name="auroc")], - "attn_cls": ["binary_accuracy", keras.metrics.AUC(name="auroc")], + "anchor_cls": ["binary_accuracy", "AUC"], }, ) return model -def main(): - max_len_peptide = 15 - k = 9 - max_len_mhc = 40 - RF_max = max_len_peptide - k + 1 - - model = build_custom_classifier(max_len_peptide, max_len_mhc, k=k) - model.summary(line_length=110) - - batch = 8 - # pep_dummy = np.zeros((batch, RF_max, k, 21), dtype=np.float32) - # pep_dummy[:, :3] = np.random.rand(batch, 3, k, 21) - # - # mhc_dummy = np.zeros((batch, max_len_mhc, 1152), dtype=np.float32) - # mhc_dummy[:, :25] = np.random.rand(batch, 25, 1152) - - pep_syn = generate_peptide(samples=1000, min_len=9, max_len=max_len_peptide, k=k) - mhc_syn, _, mhc_mask = generate_mhc(samples=1000, min_len=25, max_len=max_len_mhc, dim=1152) - - y = np.random.randint(0, 2, size=(1000, 1)).astype(np.float32) - - model.fit(x=[pep_syn, mhc_syn], y=[y, y, y], epochs=10, batch_size=batch) - - # save model - model_dir = pathlib.Path("model_output") - model_dir.mkdir(parents=True, exist_ok=True) - model_path = model_dir / "peptide_mhc_cross_attention_model.h5" - model.save(model_path) - print(f"Model saved to {model_path}") - - print("Sanity‑check complete — no dimension errors.") - -if __name__ == "__main__": - main() +# def main(): +# max_len_peptide = 15 +# k = 9 +# max_len_mhc = 40 +# RF_max = max_len_peptide - k + 1 +# +# model = build_custom_classifier(max_len_peptide, max_len_mhc, k=k) +# model.summary(line_length=110) +# +# batch = 16 +# # pep_dummy = np.zeros((batch, RF_max, k, 21), dtype=np.float32) +# # pep_dummy[:, :3] = np.random.rand(batch, 3, k, 21) +# # +# # mhc_dummy = np.zeros((batch, max_len_mhc, 1152), dtype=np.float32) +# # mhc_dummy[:, :25] = np.random.rand(batch, 25, 1152) +# +# pep_syn = generate_peptide(samples=1000, min_len=9, max_len=max_len_peptide, k=k) +# mhc_syn, _, mhc_mask = generate_mhc(samples=1000, min_len=25, max_len=max_len_mhc, dim=1152) +# +# y = np.random.randint(0, 2, size=(1000, 1)).astype(np.float32) +# +# history = model.fit(x=[pep_syn, mhc_syn], y=y, epochs=10, batch_size=batch) +# +# # save model +# model_dir = pathlib.Path("model_output") +# model_dir.mkdir(parents=True, exist_ok=True) +# model_path = model_dir / "peptide_mhc_cross_attention_model.h5" +# model.save(model_path) +# print(f"Model saved to {model_path}") +# +# print("Sanity‑check complete — no dimension errors.") +# +# # PREDICT +# preds = model.predict([pep_syn[:batch], mhc_syn[:batch]]) +# print("Predictions for first batch:") +# for i, pred in enumerate(preds): +# print(f"Sample {i + 1}: Anchor: {pred[0]:.4f}") +# # Save model metadata +# metadata = { +# "max_len_peptide": max_len_peptide, +# "k": k, +# "max_len_mhc": max_len_mhc, +# "RF_max": RF_max, +# "embed_dim_pep": 64, +# "embed_dim_mhc": 128, +# "mask_token": MASK_TOKEN, +# "pad_token": PAD_TOKEN +# } +# metadata_path = model_dir / "model_metadata.json" +# with open(metadata_path, 'w') as f: +# json.dump(metadata, f, indent=4) +# +# print(f"Model metadata saved to {metadata_path}") +# +# # plot metrics and confusion +# import matplotlib.pyplot as plt +# import seaborn as sns +# import pandas as pd +# history_df = pd.DataFrame(history.history) +# print(f"Keys in history: {list(history_df.columns)}") +# +# ## Plot metrics with error handling and saving to disk +# metrics_dir = model_dir / "metrics" +# metrics_dir.mkdir(parents=True, exist_ok=True) +# +# # Plot binary accuracy +# plt.figure(figsize=(10, 5)) +# sns.lineplot(data=history_df, x=history_df.index, y='binary_accuracy', label='Binary Accuracy') +# plt.title('Binary Accuracy Over Epochs') +# plt.xlabel('Epochs') +# plt.ylabel('Binary Accuracy') +# plt.legend() +# plt.show() +# +# # plot AUC +# plt.figure(figsize=(10, 5)) +# sns.lineplot(data=history_df, x=history_df.index, y='auc', label='AUC') +# plt.title('AUC Over Epochs') +# plt.xlabel('Epochs') +# plt.ylabel('AUC') +# plt.legend() +# plt.show() +# if __name__ == "__main__": +# main() From d102845b800389714c5adc2573c256b748aabf4b Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 4 Jun 2025 16:14:04 +0200 Subject: [PATCH 65/83] cleanup --- utils/create_ESM_dataset.py | 4 ++-- 1 file changed, 2 insertions(+), 2 deletions(-) diff --git a/utils/create_ESM_dataset.py b/utils/create_ESM_dataset.py index 34ef1944e..a39a536df 100644 --- a/utils/create_ESM_dataset.py +++ b/utils/create_ESM_dataset.py @@ -21,7 +21,7 @@ # 1. CONFIGURATION – adjust if your paths change # --------------------------------------------------------------------- dataset_name = "NetMHCpan_dataset" -mhc_class = 1 +mhc_class = 2 CSV_PATH = pathlib.Path(f"../data/{dataset_name}/combined_data_{mhc_class}.csv") NPZ_PATH = pathlib.Path( f"../data/ESM/esmc_600m/NetMHCpan pseudoseqs/mhc{mhc_class}_encodings.npz" @@ -36,7 +36,7 @@ f"../data/Custom_dataset/{dataset_name}/mhc_{mhc_class}/mhc{mhc_class}_encodings" ) # or `None` to embed directly -AUGMENTATION = "down_sampling" # "down_sampling" # "GNUSS", None +AUGMENTATION = None # "GNUSS", None # --------------------------------------------------------------------- From 04a24cf29a7b46eded70ac881b534865d831f970 Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 4 Jun 2025 17:17:16 +0200 Subject: [PATCH 66/83] cleanup --- utils/model_archive.py | 197 +++++++++++++++++++------------------- utils/run_pMHC_DL_ESM2.py | 10 +- 2 files changed, 103 insertions(+), 104 deletions(-) diff --git a/utils/model_archive.py b/utils/model_archive.py index c602c3d12..743becaa5 100644 --- a/utils/model_archive.py +++ b/utils/model_archive.py @@ -255,7 +255,7 @@ def __init__(self, embed_dim, max_len: int = 100, mask_token: float = -1., pad_t self.embed_dim = embed_dim self.max_len = max_len self.mask_token = mask_token - self._name = name + self.name = name self.pad_token = pad_token def build(self, x): @@ -291,7 +291,7 @@ def call(self, x, mask): return x_rot @property - def name(self): + def _name(self): return self._name @@ -560,9 +560,10 @@ def build_custom_classifier(max_len_peptide: int, pep_pe, mask=pep_mask) # ----- MHC branch ------------------------------------------------------ - mhc_mask_bool = tf.math.reduce_any(tf.not_equal(mhc_input, 0.), axis=-1) - mhc_mask = layers.Lambda(lambda x: tf.where(x, 1., pad_token), - name="mhc_mask")(mhc_mask_bool) + mhc_mask = layers.Lambda( + lambda x: tf.where(tf.math.reduce_any(tf.not_equal(x, 0.), axis=-1), 1., pad_token), + name="mhc_mask" + )(mhc_input) # TODO check if it is correct mhc_proj1 = layers.Dense(embed_dim_mhc, activation="relu", @@ -617,13 +618,13 @@ def build_custom_classifier(max_len_peptide: int, # x_bc = layers.Dropout(0.3, name="barcodout1_dropout")(x_bc) # out_bc = layers.Dense(1, activation="sigmoid", name="barcode_cls")(x_bc) - anchor_feat = final_features[0] - x_an = layers.Flatten(name="anchorout_flatten")(anchor_feat) - x_an = layers.Dense(64, activation="relu", name="anchorout1_dense")(x_an) - x_an = layers.Dropout(0.3, name="anchorout1_dropout")(x_an) - x_an = layers.Dense(16, activation="relu", name="anchorout2_dense")(x_an) - x_an = layers.Dropout(0.3, name="anchorout2_dropout")(x_an) - out_an = layers.Dense(1, activation="sigmoid", name="anchor_cls")(x_an) + anchor_feat = final_features[0] # (B, num_anchors, E) + x_an1 = layers.Flatten(name="anchorout_flatten")(anchor_feat) + x_an2 = layers.Dense(64, activation="relu", name="anchorout1_dense")(x_an1) + x_an3 = layers.Dropout(0.3, name="anchorout1_dropout")(x_an2) + x_an4 = layers.Dense(16, activation="relu", name="anchorout2_dense")(x_an3) + x_an5 = layers.Dropout(0.3, name="anchorout2_dropout")(x_an4) + out_an = layers.Dense(1, activation="sigmoid", name="anchor_cls")(x_an5) # pooled = layers.GlobalAveragePooling1D(name="attout_gap")(final_att[0]) # x_po = layers.Dense(32, activation="relu", name="attout1_dense")(pooled) @@ -637,93 +638,91 @@ def build_custom_classifier(max_len_peptide: int, model.compile( loss="binary_crossentropy", optimizer="adam", - metrics={ - "anchor_cls": ["binary_accuracy", "AUC"], - }, + metrics=["binary_accuracy", "AUC"], ) return model -# def main(): -# max_len_peptide = 15 -# k = 9 -# max_len_mhc = 40 -# RF_max = max_len_peptide - k + 1 -# -# model = build_custom_classifier(max_len_peptide, max_len_mhc, k=k) -# model.summary(line_length=110) -# -# batch = 16 -# # pep_dummy = np.zeros((batch, RF_max, k, 21), dtype=np.float32) -# # pep_dummy[:, :3] = np.random.rand(batch, 3, k, 21) -# # -# # mhc_dummy = np.zeros((batch, max_len_mhc, 1152), dtype=np.float32) -# # mhc_dummy[:, :25] = np.random.rand(batch, 25, 1152) -# -# pep_syn = generate_peptide(samples=1000, min_len=9, max_len=max_len_peptide, k=k) -# mhc_syn, _, mhc_mask = generate_mhc(samples=1000, min_len=25, max_len=max_len_mhc, dim=1152) -# -# y = np.random.randint(0, 2, size=(1000, 1)).astype(np.float32) -# -# history = model.fit(x=[pep_syn, mhc_syn], y=y, epochs=10, batch_size=batch) -# -# # save model -# model_dir = pathlib.Path("model_output") -# model_dir.mkdir(parents=True, exist_ok=True) -# model_path = model_dir / "peptide_mhc_cross_attention_model.h5" -# model.save(model_path) -# print(f"Model saved to {model_path}") -# -# print("Sanity‑check complete — no dimension errors.") -# -# # PREDICT -# preds = model.predict([pep_syn[:batch], mhc_syn[:batch]]) -# print("Predictions for first batch:") -# for i, pred in enumerate(preds): -# print(f"Sample {i + 1}: Anchor: {pred[0]:.4f}") -# # Save model metadata -# metadata = { -# "max_len_peptide": max_len_peptide, -# "k": k, -# "max_len_mhc": max_len_mhc, -# "RF_max": RF_max, -# "embed_dim_pep": 64, -# "embed_dim_mhc": 128, -# "mask_token": MASK_TOKEN, -# "pad_token": PAD_TOKEN -# } -# metadata_path = model_dir / "model_metadata.json" -# with open(metadata_path, 'w') as f: -# json.dump(metadata, f, indent=4) -# -# print(f"Model metadata saved to {metadata_path}") -# -# # plot metrics and confusion -# import matplotlib.pyplot as plt -# import seaborn as sns -# import pandas as pd -# history_df = pd.DataFrame(history.history) -# print(f"Keys in history: {list(history_df.columns)}") -# -# ## Plot metrics with error handling and saving to disk -# metrics_dir = model_dir / "metrics" -# metrics_dir.mkdir(parents=True, exist_ok=True) -# -# # Plot binary accuracy -# plt.figure(figsize=(10, 5)) -# sns.lineplot(data=history_df, x=history_df.index, y='binary_accuracy', label='Binary Accuracy') -# plt.title('Binary Accuracy Over Epochs') -# plt.xlabel('Epochs') -# plt.ylabel('Binary Accuracy') -# plt.legend() -# plt.show() -# -# # plot AUC -# plt.figure(figsize=(10, 5)) -# sns.lineplot(data=history_df, x=history_df.index, y='auc', label='AUC') -# plt.title('AUC Over Epochs') -# plt.xlabel('Epochs') -# plt.ylabel('AUC') -# plt.legend() -# plt.show() -# if __name__ == "__main__": -# main() +def main(): + max_len_peptide = 15 + k = 9 + max_len_mhc = 40 + RF_max = max_len_peptide - k + 1 + + model = build_custom_classifier(max_len_peptide, max_len_mhc, k=k) + model.summary(line_length=110) + + batch = 16 + # pep_dummy = np.zeros((batch, RF_max, k, 21), dtype=np.float32) + # pep_dummy[:, :3] = np.random.rand(batch, 3, k, 21) + # + # mhc_dummy = np.zeros((batch, max_len_mhc, 1152), dtype=np.float32) + # mhc_dummy[:, :25] = np.random.rand(batch, 25, 1152) + + pep_syn = generate_peptide(samples=1000, min_len=9, max_len=max_len_peptide, k=k) + mhc_syn, _, mhc_mask = generate_mhc(samples=1000, min_len=25, max_len=max_len_mhc, dim=1152) + + y = np.random.randint(0, 2, size=(1000, 1)).astype(np.float32) + + history = model.fit(x=[pep_syn, mhc_syn], y=y, epochs=10, batch_size=batch) + + # save model + model_dir = pathlib.Path("model_output") + model_dir.mkdir(parents=True, exist_ok=True) + model_path = model_dir / "peptide_mhc_cross_attention_model.h5" + model.save(model_path) + print(f"Model saved to {model_path}") + + print("Sanity‑check complete — no dimension errors.") + + # PREDICT + preds = model.predict([pep_syn[:batch], mhc_syn[:batch]]) + print("Predictions for first batch:") + for i, pred in enumerate(preds): + print(f"Sample {i + 1}: Anchor: {pred[0]:.4f}") + # Save model metadata + metadata = { + "max_len_peptide": max_len_peptide, + "k": k, + "max_len_mhc": max_len_mhc, + "RF_max": RF_max, + "embed_dim_pep": 64, + "embed_dim_mhc": 128, + "mask_token": MASK_TOKEN, + "pad_token": PAD_TOKEN + } + metadata_path = model_dir / "model_metadata.json" + with open(metadata_path, 'w') as f: + json.dump(metadata, f, indent=4) + + print(f"Model metadata saved to {metadata_path}") + + # plot metrics and confusion + import matplotlib.pyplot as plt + import seaborn as sns + import pandas as pd + history_df = pd.DataFrame(history.history) + print(f"Keys in history: {list(history_df.columns)}") + + ## Plot metrics with error handling and saving to disk + metrics_dir = model_dir / "metrics" + metrics_dir.mkdir(parents=True, exist_ok=True) + + # Plot binary accuracy + plt.figure(figsize=(10, 5)) + sns.lineplot(data=history_df, x=history_df.index, y='binary_accuracy', label='Binary Accuracy') + plt.title('Binary Accuracy Over Epochs') + plt.xlabel('Epochs') + plt.ylabel('Binary Accuracy') + plt.legend() + plt.show() + + # plot AUC + plt.figure(figsize=(10, 5)) + sns.lineplot(data=history_df, x=history_df.index, y='AUC', label='AUC') + plt.title('AUC Over Epochs') + plt.xlabel('Epochs') + plt.ylabel('AUC') + plt.legend() + plt.show() +if __name__ == "__main__": + main() diff --git a/utils/run_pMHC_DL_ESM2.py b/utils/run_pMHC_DL_ESM2.py index 52580713b..bb68fccf8 100644 --- a/utils/run_pMHC_DL_ESM2.py +++ b/utils/run_pMHC_DL_ESM2.py @@ -224,10 +224,10 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.grid(True, alpha=0.3) # Plot 3: AUC curve - if "auc" in hist and "val_auc" in hist: + if "AUC" in hist and "val_auc" in hist: plt.subplot(1, 4, 3) - plt.plot(hist["auc"], label="train AUC", linewidth=2) - plt.plot(hist["val_auc"], label="val AUC", linewidth=2) + plt.plot(hist["AUC"], label="train AUC", linewidth=2) + plt.plot(hist["val_AUC"], label="val AUC", linewidth=2) plt.xlabel("Epoch") plt.ylabel("AUC") plt.title("AUC") @@ -575,7 +575,7 @@ def main(argv=None): train_loader, validation_data=val_loader, epochs= args.epochs, - # class_weight=class_weight, + class_weight=class_weight, callbacks=[ckpt_cb, early_cb], verbose=1, ) @@ -613,5 +613,5 @@ def main(argv=None): if __name__ == "__main__": main([ "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_1", - "--epochs", "3", "--batch", "64", "--test_batches", "20" + "--epochs", "15", "--batch", "128", "--test_batches", "30" ]) \ No newline at end of file From b874e972d6b4299a078e747a43032ba093979052 Mon Sep 17 00:00:00 2001 From: amirreza Date: Wed, 4 Jun 2025 17:39:28 +0200 Subject: [PATCH 67/83] cleanup: register Keras serializable and update model visualization output path --- utils/model_archive.py | 2 ++ utils/visualize_tensorflow_model.py | 14 +------------- 2 files changed, 3 insertions(+), 13 deletions(-) diff --git a/utils/model_archive.py b/utils/model_archive.py index 743becaa5..e783e2733 100644 --- a/utils/model_archive.py +++ b/utils/model_archive.py @@ -509,6 +509,7 @@ def generate_peptide(samples=1024, min_len=5, max_len=15, k=9): MASK_TOKEN = -1 PAD_TOKEN = -2. +@tf.keras.utils.register_keras_serializable() def make_rf_mask(pep_batch: tf.Tensor) -> tf.Tensor: """Return (B, RF) float mask for a peptide batch of shape *(B, RF,K,21)*. @@ -562,6 +563,7 @@ def build_custom_classifier(max_len_peptide: int, # ----- MHC branch ------------------------------------------------------ mhc_mask = layers.Lambda( lambda x: tf.where(tf.math.reduce_any(tf.not_equal(x, 0.), axis=-1), 1., pad_token), + output_shape=lambda input_shape: (input_shape[0], input_shape[1]), name="mhc_mask" )(mhc_input) diff --git a/utils/visualize_tensorflow_model.py b/utils/visualize_tensorflow_model.py index 9a32de4e1..d3c7c99c4 100644 --- a/utils/visualize_tensorflow_model.py +++ b/utils/visualize_tensorflow_model.py @@ -42,23 +42,11 @@ def fn(**config): # Create better visualization as SVG with cleaner layout tf.keras.utils.plot_model( model, - to_file='model_architecture.png', + to_file='model_output/model_architecture.png', show_shapes=True, show_layer_names=True, rankdir='TB', # Top to bottom layout dpi=200, # Higher resolution expand_nested=True, # Expand nested models to show all layers show_layer_activations=True # Show activation functions -) - -# Create a simplified version showing only main components -tf.keras.utils.plot_model( - model, - to_file='model_architecture_simplified.png', - show_shapes=False, - show_layer_names=True, - rankdir='LR', # Left to right layout for simplified view - dpi=200, - expand_nested=True, # Expand nested models to show all layers - show_dtype=False ) \ No newline at end of file From 9143f97d31585caa83baded630dc977dcd155c5a Mon Sep 17 00:00:00 2001 From: Amirreza Aleyasin Date: Sun, 8 Jun 2025 13:03:06 +0200 Subject: [PATCH 68/83] fix: update output shape for peptide mask layer in model archive --- utils/model_archive.py | 2 +- 1 file changed, 1 insertion(+), 1 deletion(-) diff --git a/utils/model_archive.py b/utils/model_archive.py index e783e2733..3d1c85bd3 100644 --- a/utils/model_archive.py +++ b/utils/model_archive.py @@ -543,7 +543,7 @@ def build_custom_classifier(max_len_peptide: int, mhc_input = keras.Input(shape=(max_len_mhc, 1152), name="mhc_input") # ----- peptide branch -------------------------------------------------- - pep_mask = layers.Lambda(make_rf_mask, name="pep_mask")(pep_input) # (B, RF) + pep_mask = layers.Lambda(make_rf_mask, output_shape=(None, None), name="pep_mask")(pep_input) # (B, RF) pep_flat = layers.Reshape((RF_max, k * 21), name="pep_flat")(pep_input) # (B, RF, k·21) From 938cb36567147c993c9482b47e3c6b6027be960e Mon Sep 17 00:00:00 2001 From: Amirreza Aleyasin Date: Mon, 9 Jun 2025 15:11:47 +0200 Subject: [PATCH 69/83] a working version --- utils/model_archive.py | 359 +++++++++++++++++++++----------------- utils/run_pMHC_DL_ESM2.py | 356 +++++++++++++++++++++++++------------ 2 files changed, 445 insertions(+), 270 deletions(-) diff --git a/utils/model_archive.py b/utils/model_archive.py index 3d1c85bd3..ef8772218 100644 --- a/utils/model_archive.py +++ b/utils/model_archive.py @@ -185,6 +185,22 @@ def call(self, x, mask, context=None, context_mask=None): out *= mask_exp return (out, att) if self.return_att_weights else out + def get_config(self): + config = super().get_config() + config.update({ + 'input_dim': self.input_dim, + 'output_dim': self.output_dim, + 'type': self.type, + 'heads': self.heads, + 'resnet': self.resnet, + 'return_att_weights': self.return_att_weights, + 'epsilon': self.epsilon, + 'gate': self.gate, + 'mask_token': self.mask_token, + 'pad_token': self.pad_token, + }) + return config + class PositionalEncoding(keras.layers.Layer): """ @@ -201,7 +217,6 @@ def __init__(self, embed_dim, max_len: int =100, mask_token: float =-1., pad_tok self.embed_dim = embed_dim self.max_len = max_len self.mask_token = mask_token - self._name = name self.pad_token = pad_token def build(self, x): @@ -235,64 +250,74 @@ def call(self, x, mask): return x + pe - @property - def name(self): - return self._name - - -class RotaryPositionalEncoding(keras.layers.Layer): - """ - Rotary Positional Encoding layer for transformer models. - Applies rotary embeddings to the last two dimensions of the input. - Args: - embed_dim (int): Embedding dimension (must be even). - max_len (int): Maximum sequence length. - """ - - def __init__(self, embed_dim, max_len: int = 100, mask_token: float = -1., pad_token: float = -2., name: str = 'rotary_positional_encoding'): - super().__init__(name=name) - assert embed_dim % 2 == 0, "embed_dim must be even for rotary encoding" - self.embed_dim = embed_dim - self.max_len = max_len - self.mask_token = mask_token - self.name = name - self.pad_token = pad_token - - def build(self, x): - # Precompute rotary frequencies - pos = tf.range(self.max_len, dtype=tf.float32)[:, tf.newaxis] # (max_len, 1) - dim = tf.range(self.embed_dim // 2, dtype=tf.float32)[tf.newaxis, :] # (1, embed_dim//2) - inv_freq = 1.0 / (10000 ** (dim / (self.embed_dim // 2))) - freqs = pos * inv_freq # (max_len, embed_dim//2) - self.cos_cached = tf.cast(tf.cos(freqs), tf.float32) # (max_len, embed_dim//2) - self.sin_cached = tf.cast(tf.sin(freqs), tf.float32) # (max_len, embed_dim//2) - - def call(self, x, mask): - """ - Args: - x: Input tensor of shape (B, N, D) - mask: Tensor of shape (B, N) - Returns: - Tensor with rotary positional encoding applied. - """ - seq_len = tf.shape(x)[1] - cos = self.cos_cached[:seq_len, :] # (N, D//2) - sin = self.sin_cached[:seq_len, :] # (N, D//2) - cos = tf.expand_dims(cos, 0) # (1, N, D//2) - sin = tf.expand_dims(sin, 0) # (1, N, D//2) - - x1, x2 = tf.split(x, 2, axis=-1) # (B, N, D//2), (B, N, D//2) - x_rot = tf.concat([x1 * cos - x2 * sin, x1 * sin + x2 * cos], axis=-1) # (B, N, D) - - mask = tf.cast(mask[:, :, tf.newaxis], tf.float32) # (B, N, 1) - mask = tf.where(mask == self.pad_token, 0., 1.) - x_rot = x_rot * mask # zero out positions where mask is 0 - - return x_rot - - @property - def _name(self): - return self._name + def get_config(self): + config = super().get_config() + config.update({ + 'embed_dim': self.embed_dim, + 'max_len': self.max_len, + 'mask_token': self.mask_token, + 'pad_token': self.pad_token, + }) + return config + +# class RotaryPositionalEncoding(keras.layers.Layer): +# """ +# Rotary Positional Encoding layer for transformer models. +# Applies rotary embeddings to the last two dimensions of the input. +# Args: +# embed_dim (int): Embedding dimension (must be even). +# max_len (int): Maximum sequence length. +# """ +# +# def __init__(self, embed_dim, max_len: int = 100, mask_token: float = -1., pad_token: float = -2., name: str = 'rotary_positional_encoding'): +# super().__init__(name=name) +# assert embed_dim % 2 == 0, "embed_dim must be even for rotary encoding" +# self.embed_dim = embed_dim +# self.max_len = max_len +# self.mask_token = mask_token +# self.pad_token = pad_token +# +# def build(self, x): +# # Precompute rotary frequencies +# pos = tf.range(self.max_len, dtype=tf.float32)[:, tf.newaxis] # (max_len, 1) +# dim = tf.range(self.embed_dim // 2, dtype=tf.float32)[tf.newaxis, :] # (1, embed_dim//2) +# inv_freq = 1.0 / (10000 ** (dim / (self.embed_dim // 2))) +# freqs = pos * inv_freq # (max_len, embed_dim//2) +# self.cos_cached = tf.cast(tf.cos(freqs), tf.float32) # (max_len, embed_dim//2) +# self.sin_cached = tf.cast(tf.sin(freqs), tf.float32) # (max_len, embed_dim//2) +# +# def call(self, x, mask): +# """ +# Args: +# x: Input tensor of shape (B, N, D) +# mask: Tensor of shape (B, N) +# Returns: +# Tensor with rotary positional encoding applied. +# """ +# seq_len = tf.shape(x)[1] +# cos = self.cos_cached[:seq_len, :] # (N, D//2) +# sin = self.sin_cached[:seq_len, :] # (N, D//2) +# cos = tf.expand_dims(cos, 0) # (1, N, D//2) +# sin = tf.expand_dims(sin, 0) # (1, N, D//2) +# +# x1, x2 = tf.split(x, 2, axis=-1) # (B, N, D//2), (B, N, D//2) +# x_rot = tf.concat([x1 * cos - x2 * sin, x1 * sin + x2 * cos], axis=-1) # (B, N, D) +# +# mask = tf.cast(mask[:, :, tf.newaxis], tf.float32) # (B, N, 1) +# mask = tf.where(mask == self.pad_token, 0., 1.) +# x_rot = x_rot * mask # zero out positions where mask is 0 +# +# return x_rot +# + # def get_config(self): + # config = super().get_config() + # config.update({ + # 'embed_dim': self.embed_dim, + # 'max_len': self.max_len, + # 'mask_token': self.mask_token, + # 'pad_token': self.pad_token, + # }) + # return config @tf.function @@ -345,18 +370,13 @@ def body(i, count, selected): class AnchorPositionExtractor(keras.layers.Layer): - @property - def name(self): - return self._name - def __init__(self, num_anchors, dist_thr, name='anchor_extractor', project=True, mask_token=-1., pad_token=-2., return_att_weights=False): - super().__init__() + super().__init__(name=name) assert isinstance(dist_thr, list) and len(dist_thr) == 2 assert num_anchors > 0 self.num_anchors = num_anchors self.dist_thr = dist_thr - self.name = name self.project = project self.mask_token = mask_token self.pad_token = pad_token @@ -449,9 +469,17 @@ def find_anchor(self, input, barcode_att): # (B,N,E), (B,1,N) sorted_selected_output = tf.gather(input, sorted_selected_inds, axis=1, batch_dims=1) # (B,num_anchors,E) return sorted_selected_inds, sorted_selected_weights, sorted_selected_output - @name.setter - def name(self, value): - self._name = value + def get_config(self): + config = super().get_config() + config.update({ + 'num_anchors': self.num_anchors, + 'dist_thr': self.dist_thr, + 'project': self.project, + 'mask_token': self.mask_token, + 'pad_token': self.pad_token, + 'return_att_weights': self.return_att_weights, + }) + return config def generate_mhc(samples=1024, min_len=5, max_len=15, dim=16): @@ -510,7 +538,7 @@ def generate_peptide(samples=1024, min_len=5, max_len=15, k=9): PAD_TOKEN = -2. @tf.keras.utils.register_keras_serializable() -def make_rf_mask(pep_batch: tf.Tensor) -> tf.Tensor: +def make_rf_mask(pep_batch: tf.Tensor, MASK_TOKEN, PAD_TOKEN) -> tf.Tensor: """Return (B, RF) float mask for a peptide batch of shape *(B, RF,K,21)*. A slot is **1** when any (K,21) element is non‑zero, else **PAD_TOKEN**. @@ -522,8 +550,8 @@ def make_rf_mask(pep_batch: tf.Tensor) -> tf.Tensor: #### define model # input layers -def build_custom_classifier(max_len_peptide: int, - max_len_mhc: int, +def build_custom_classifier(max_len_peptide: int = 50, + max_len_mhc: int = 200, k: int = 9, embed_dim_pep: int = 64, embed_dim_mhc: int = 128, @@ -543,7 +571,9 @@ def build_custom_classifier(max_len_peptide: int, mhc_input = keras.Input(shape=(max_len_mhc, 1152), name="mhc_input") # ----- peptide branch -------------------------------------------------- - pep_mask = layers.Lambda(make_rf_mask, output_shape=(None, None), name="pep_mask")(pep_input) # (B, RF) + pep_mask = layers.Lambda(lambda x: make_rf_mask(x, MASK_TOKEN, PAD_TOKEN), + output_shape=lambda input_shape: (input_shape[0], input_shape[1]), + name="pep_mask")(pep_input) # (B, RF) pep_flat = layers.Reshape((RF_max, k * 21), name="pep_flat")(pep_input) # (B, RF, k·21) @@ -551,7 +581,8 @@ def build_custom_classifier(max_len_peptide: int, pep_proj = layers.Dense(embed_dim_pep, activation="relu", name="pep_proj1")(pep_flat) # (B, RF, 64) - pep_pe = RotaryPositionalEncoding(embed_dim_pep, max_len=RF_max, + # Use Lambda to dynamically determine max_len from input shape + pep_pe = PositionalEncoding(embed_dim_pep, max_len=RF_max, mask_token=mask_token, pad_token=pad_token, name="pep_pos_enc")(pep_proj, pep_mask) @@ -571,7 +602,7 @@ def build_custom_classifier(max_len_peptide: int, mhc_proj1 = layers.Dense(embed_dim_mhc, activation="relu", name="mhc_proj1")(mhc_input) # (B, L_mhc, D_mhc) - mhc_pe = RotaryPositionalEncoding(embed_dim=embed_dim_mhc,max_len=max_len_mhc, + mhc_pe = PositionalEncoding(embed_dim=embed_dim_mhc,max_len=max_len_mhc, mask_token=mask_token,pad_token=pad_token, name="mhc_pos_enc")(mhc_proj1, mhc_mask) @@ -579,10 +610,9 @@ def build_custom_classifier(max_len_peptide: int, type="self", heads=4, name="mhc_self_att1", mask_token=mask_token, pad_token=pad_token)( mhc_pe, mask=mhc_mask) - mhc_att2, att_w1 = AttentionLayer(input_dim=embed_dim_mhc, output_dim=embed_dim_mhc, + mhc_att2 = AttentionLayer(input_dim=embed_dim_mhc, output_dim=embed_dim_mhc, type="self", heads=4, name="mhc_self_att2", - resnet=False, mask_token=mask_token, pad_token=pad_token, - return_att_weights=True)( + resnet=False, mask_token=mask_token, pad_token=pad_token)( mhc_att1, mask=mhc_mask) # (B, L_mhc, D_mhc), att_weights @@ -597,9 +627,9 @@ def build_custom_classifier(max_len_peptide: int, pep_att1, mask=pep_mask, context=mhc_to_D_pep, context_mask=mhc_mask) - cross_proj = layers.Dense(128, activation="relu", name="cross_proj")(cross_att) + cross_proj = layers.Dense(64, activation="relu", name="cross_proj")(cross_att) - final_att = AttentionLayer(input_dim=128, output_dim=128, type="self", + final_att = AttentionLayer(input_dim=64, output_dim=64, type="self", heads=2, name="final_pep_self_att", return_att_weights=True, mask_token=mask_token, pad_token=pad_token)( @@ -644,87 +674,90 @@ def build_custom_classifier(max_len_peptide: int, ) return model -def main(): - max_len_peptide = 15 - k = 9 - max_len_mhc = 40 - RF_max = max_len_peptide - k + 1 - - model = build_custom_classifier(max_len_peptide, max_len_mhc, k=k) - model.summary(line_length=110) - - batch = 16 - # pep_dummy = np.zeros((batch, RF_max, k, 21), dtype=np.float32) - # pep_dummy[:, :3] = np.random.rand(batch, 3, k, 21) - # - # mhc_dummy = np.zeros((batch, max_len_mhc, 1152), dtype=np.float32) - # mhc_dummy[:, :25] = np.random.rand(batch, 25, 1152) - - pep_syn = generate_peptide(samples=1000, min_len=9, max_len=max_len_peptide, k=k) - mhc_syn, _, mhc_mask = generate_mhc(samples=1000, min_len=25, max_len=max_len_mhc, dim=1152) - - y = np.random.randint(0, 2, size=(1000, 1)).astype(np.float32) - - history = model.fit(x=[pep_syn, mhc_syn], y=y, epochs=10, batch_size=batch) - - # save model - model_dir = pathlib.Path("model_output") - model_dir.mkdir(parents=True, exist_ok=True) - model_path = model_dir / "peptide_mhc_cross_attention_model.h5" - model.save(model_path) - print(f"Model saved to {model_path}") - - print("Sanity‑check complete — no dimension errors.") - - # PREDICT - preds = model.predict([pep_syn[:batch], mhc_syn[:batch]]) - print("Predictions for first batch:") - for i, pred in enumerate(preds): - print(f"Sample {i + 1}: Anchor: {pred[0]:.4f}") - # Save model metadata - metadata = { - "max_len_peptide": max_len_peptide, - "k": k, - "max_len_mhc": max_len_mhc, - "RF_max": RF_max, - "embed_dim_pep": 64, - "embed_dim_mhc": 128, - "mask_token": MASK_TOKEN, - "pad_token": PAD_TOKEN - } - metadata_path = model_dir / "model_metadata.json" - with open(metadata_path, 'w') as f: - json.dump(metadata, f, indent=4) - - print(f"Model metadata saved to {metadata_path}") - - # plot metrics and confusion - import matplotlib.pyplot as plt - import seaborn as sns - import pandas as pd - history_df = pd.DataFrame(history.history) - print(f"Keys in history: {list(history_df.columns)}") - - ## Plot metrics with error handling and saving to disk - metrics_dir = model_dir / "metrics" - metrics_dir.mkdir(parents=True, exist_ok=True) - - # Plot binary accuracy - plt.figure(figsize=(10, 5)) - sns.lineplot(data=history_df, x=history_df.index, y='binary_accuracy', label='Binary Accuracy') - plt.title('Binary Accuracy Over Epochs') - plt.xlabel('Epochs') - plt.ylabel('Binary Accuracy') - plt.legend() - plt.show() - - # plot AUC - plt.figure(figsize=(10, 5)) - sns.lineplot(data=history_df, x=history_df.index, y='AUC', label='AUC') - plt.title('AUC Over Epochs') - plt.xlabel('Epochs') - plt.ylabel('AUC') - plt.legend() - plt.show() -if __name__ == "__main__": - main() +# def main(): +# max_len_peptide = 14 +# k = 9 +# max_len_mhc = 36 +# RF_max = max_len_peptide - k + 1 +# +# model = build_custom_classifier(max_len_peptide, max_len_mhc, k=k) +# model.summary(line_length=110) +# +# batch = 16 +# # pep_dummy = np.zeros((batch, RF_max, k, 21), dtype=np.float32) +# # pep_dummy[:, :3] = np.random.rand(batch, 3, k, 21) +# # +# # mhc_dummy = np.zeros((batch, max_len_mhc, 1152), dtype=np.float32) +# # mhc_dummy[:, :25] = np.random.rand(batch, 25, 1152) +# +# pep_syn = generate_peptide(samples=10, min_len=9, max_len=max_len_peptide, k=k) +# mhc_syn, _, mhc_mask = generate_mhc(samples=10, min_len=25, max_len=max_len_mhc, dim=1152) +# +# y = np.random.randint(0, 2, size=(10, 1)).astype(np.float32) +# +# history = model.fit(x=[pep_syn, mhc_syn], y=y, epochs=2, batch_size=batch) +# +# # save model +# model_dir = pathlib.Path("model_output") +# model_dir.mkdir(parents=True, exist_ok=True) +# model_path = model_dir / "peptide_mhc_cross_attention_model.h5" +# model.save(model_path) +# print(f"Model saved to {model_path}") +# +# print("Sanity‑check complete — no dimension errors.") +# +# # PREDICT +# preds = model.predict([pep_syn[:batch], mhc_syn[:batch]]) +# print("Predictions for first batch:") +# for i, pred in enumerate(preds): +# print(f"Sample {i + 1}: Anchor: {pred[0]:.4f}") +# # Save model metadata +# metadata = { +# "max_len_peptide": max_len_peptide, +# "k": k, +# "max_len_mhc": max_len_mhc, +# "RF_max": RF_max, +# "embed_dim_pep": 64, +# "embed_dim_mhc": 128, +# "mask_token": MASK_TOKEN, +# "pad_token": PAD_TOKEN +# } +# metadata_path = model_dir / "model_metadata.json" +# with open(metadata_path, 'w') as f: +# json.dump(metadata, f, indent=4) +# +# print(f"Model metadata saved to {metadata_path}") +# +# # plot metrics and confusion +# import matplotlib.pyplot as plt +# import seaborn as sns +# import pandas as pd +# history_df = pd.DataFrame(history.history) +# print(f"Keys in history: {list(history_df.columns)}") +# +# ## Plot metrics with error handling and saving to disk +# metrics_dir = model_dir / "metrics" +# metrics_dir.mkdir(parents=True, exist_ok=True) +# +# # Plot binary accuracy +# plt.figure(figsize=(10, 5)) +# sns.lineplot(data=history_df, x=history_df.index, y='binary_accuracy', label='Binary Accuracy') +# plt.title('Binary Accuracy Over Epochs') +# plt.xlabel('Epochs') +# plt.ylabel('Binary Accuracy') +# plt.legend() +# # plt.show() +# plt.savefig("model_output/binary_accuracy_plot.png") +# +# # plot AUC +# plt.figure(figsize=(10, 5)) +# sns.lineplot(data=history_df, x=history_df.index, y='AUC', label='AUC') +# plt.title('AUC Over Epochs') +# plt.xlabel('Epochs') +# plt.ylabel('AUC') +# plt.legend() +# # plt.show() +# plt.savefig("model_output/auc_plot.png") +# +# if __name__ == "__main__": +# main() diff --git a/utils/run_pMHC_DL_ESM2.py b/utils/run_pMHC_DL_ESM2.py index bb68fccf8..b93ea79b8 100644 --- a/utils/run_pMHC_DL_ESM2.py +++ b/utils/run_pMHC_DL_ESM2.py @@ -27,20 +27,47 @@ Author : Amirreza (updated for cross‑attention, 2025‑05‑22) """ from __future__ import annotations - -import math -import os, sys, argparse, datetime, pathlib, json -from random import random +import os +import sys print(sys.executable) +# ============================================================================= +# CRITICAL: GPU Memory Configuration - MUST BE FIRST +# ============================================================================= +import tensorflow as tf + +def configure_gpu_memory(): + """Configure TensorFlow to use GPU memory efficiently""" + try: + gpus = tf.config.experimental.list_physical_devices('GPU') + if gpus: + print(f"Found {len(gpus)} GPU(s)") + for gpu in gpus: + tf.config.experimental.set_memory_growth(gpu, True) + print("✓ GPU memory growth enabled") + else: + print("No GPUs found - running on CPU") + except RuntimeError as e: + print(f"GPU configuration error: {e}") + + +# Configure GPU immediately +configure_gpu_memory() + +# Set memory-friendly environment variables +os.environ['TF_GPU_ALLOCATOR'] = 'cuda_malloc_async' +os.environ['TF_FORCE_GPU_ALLOW_GROWTH'] = 'true' +os.environ["PYTHONHASHSEED"] = "42" +os.environ["TF_DETERMINISTIC_OPS"] = "1" + +import math +import argparse, datetime, pathlib, json +import psutil import numpy as np import pandas as pd -import tensorflow as tf import matplotlib.pyplot as plt -from sklearn.model_selection import train_test_split from tqdm import tqdm - from model_archive import build_custom_classifier from sklearn.metrics import ( confusion_matrix, roc_curve, auc, precision_score, @@ -50,6 +77,38 @@ import os import pyarrow.parquet as pq +# ============================================================================= +# Memory monitoring functions +# ============================================================================= +def monitor_memory(): + """Monitor system memory usage""" + memory = psutil.virtual_memory() + print(f"System RAM: {memory.used / 1e9:.1f}GB / {memory.total / 1e9:.1f}GB ({memory.percent:.1f}% used)") + + try: + # Try to get GPU memory info + from pynvml import nvmlInit, nvmlDeviceGetCount, nvmlDeviceGetHandleByIndex, nvmlDeviceGetMemoryInfo + nvmlInit() + deviceCount = nvmlDeviceGetCount() + for i in range(deviceCount): + handle = nvmlDeviceGetHandleByIndex(i) + info = nvmlDeviceGetMemoryInfo(handle) + print( + f"GPU {i}: {info.used / 1e9:.1f}GB / {info.total / 1e9:.1f}GB ({100 * info.used / info.total:.1f}% used)") + except: + print("GPU memory monitoring not available") + + +def check_memory(): + """Check if memory usage is acceptable""" + memory = psutil.virtual_memory() + if memory.percent > 90: + print(f"⚠️ Critical RAM usage: {memory.percent:.1f}%") + return False + elif memory.percent > 80: + print(f"⚠️ High RAM usage: {memory.percent:.1f}%") + return True + # ---------------------------------------------------------------------------- # 1) Peptide → k‑mer one‑hot *inside* TF graph (GPU/TPU friendly) # ---------------------------------------------------------------------------- @@ -101,72 +160,58 @@ def _read_embedding_file(path: str | os.PathLike) -> np.ndarray: # ---------------------------------------------------------------------------- -def _load_parquet_rows(parquet_path, seq_len, k=9, test_batches=None): +def _load_parquet_samples(parquet_path, seq_len, k=9): + """ + FIXED: Generator that yields individual samples, not batches. + This prevents double-batching issues. + """ pq_file = pq.ParquetFile(parquet_path) - batch_counter = 0 - for batch_df in pq_file.iter_batches(batch_size=2048): - if test_batches is not None and batch_counter >= test_batches: - break + total_rows = _parquet_rowcount(parquet_path) + estimated_batches = math.ceil(total_rows / BUFFER) + for batch_df in tqdm(pq_file.iter_batches(batch_size=BUFFER), + total=estimated_batches, + desc="Loading batches", + unit="batch"): df = batch_df.to_pandas() - - peps = tf.constant(df["long_mer"].astype(str).values, dtype=tf.string) - x_pep = kmer_onehot_tensor(peps, seq_len, k) # tf.Tensor on GPU/CPU - - if "mhc_embedding" in df.columns and df["mhc_embedding"].dtype != object: - latents = tf.constant(np.stack(df["mhc_embedding"]).astype("float32")) - else: - latents = tf.constant(np.stack([_read_embedding_file(p) for p in df["mhc_embedding_path"]])) - - labels = tf.constant(df["assigned_label"].astype("float32").values[:, None]) - batch_counter += 1 - yield (x_pep, latents), labels - + # Process each row individually + # Vectorized batch processing + seqs = tf.constant(df["long_mer"].tolist(), dtype=tf.string) # (N,) + labels = tf.constant(df["assigned_label"].values, dtype=tf.float32) # (N,) + # Load and stack all embeddings for the batch + embeddings = [_read_embedding_file(p) for p in df["mhc_embedding_path"]] + latents = tf.constant(np.stack(embeddings), dtype=tf.float32) # (N, 1152) + # One-hot encode all peptides in one go + x_peps = kmer_onehot_tensor(seqs, seq_len=seq_len, k=k) # (N, RF, k, 21) + # Yield individual samples + for x_pep, latent, label in zip(x_peps, latents, labels): + yield (x_pep, latent), tf.expand_dims(label, 0) + # Clean up DataFrame + del df def make_stream_dataset( - parquet_path: str, - max_pep_seq_len: int, - max_mhc_len: int, - batch: int = 512, - shuffle: bool = True, - k: int = 9, - test_batches: int = None + parquet_path: str, + max_pep_seq_len: int, + max_mhc_len: int, + k: int = 9, ) -> tf.data.Dataset: - """Replacement for the "path‐like" branch; optimized to avoid caching when using small test_batches.""" + """ + FIXED: Memory-optimized dataset creation with proper batching. + """ rf = max_pep_seq_len - k + 1 + + # Output signature for individual samples (no batch dimension) output_signature = ( ( - tf.TensorSpec(shape=(None, rf, k, 21), dtype=tf.float32), # one-hot peptide tensor - tf.TensorSpec(shape=(None, max_mhc_len, 1152), dtype=tf.float32), # latent embeddings + tf.TensorSpec(shape=(rf, k, 21), dtype=tf.float32), # No batch dim + tf.TensorSpec(shape=(max_mhc_len, 1152), dtype=tf.float32), # No batch dim ), - tf.TensorSpec(shape=(None, 1), dtype=tf.float32), # labels + tf.TensorSpec(shape=1, dtype=tf.float32), # Scalar label ) - - # Pass test_batches into generator to limit batches early ds = tf.data.Dataset.from_generator( - lambda: _load_parquet_rows(parquet_path, max_pep_seq_len, k, test_batches), + lambda: _load_parquet_samples(parquet_path, max_pep_seq_len, k), output_signature=output_signature, ) - - if shuffle: - ds = ds.shuffle(buffer_size=10 * batch, reshuffle_each_iteration=True) - - # If test_batches is provided, limit dataset and batch after - if test_batches is not None: - return ds.prefetch(tf.data.AUTOTUNE) - - # Batch *after* shuffle so that every epoch gets fresh mixes - return ds.cache().prefetch(tf.data.AUTOTUNE) - -# ---------------------------------------------------------------------------- -# 4) On‑the‑fly 1:1 class balancing without Pandas down‑sampling -# ---------------------------------------------------------------------------- - -def build_balanced_dataset(ds: tf.data.Dataset) -> tf.data.Dataset: - """Wrap a dataset so that every step yields a balanced positive/negative mini‑batch.""" - pos = ds.filter(lambda x, y: tf.reduce_any(tf.equal(y, 1))) - neg = ds.filter(lambda x, y: tf.reduce_any(tf.equal(y, 0))) - balanced = tf.data.experimental.sample_from_datasets([pos, neg], weights=[0.5, 0.5]) - return balanced + return ds # --------------------------------------------------------------------------- # Visualisation utility @@ -203,6 +248,16 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.legend() plt.grid(True, alpha=0.3) + # Plot 2: Precision - Recall curve + # if "Precision" in hist and "Recall" in hist: + # plt.subplot(1, 4, 2) + # plt.plot(hist["Recall"], hist["Precision"], label="PR Curve", linewidth=2) + # plt.xlabel("Recall") + # plt.ylabel("Precision") + # plt.title("Precision-Recall Curve") + # plt.legend() + # plt.grid(True, alpha=0.3) + # Plot 2: Accuracy curve if "binary_accuracy" in hist and "val_binary_accuracy" in hist: plt.subplot(1, 4, 2) @@ -224,7 +279,7 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.grid(True, alpha=0.3) # Plot 3: AUC curve - if "AUC" in hist and "val_auc" in hist: + if "AUC" in hist and "val_AUC" in hist: plt.subplot(1, 4, 3) plt.plot(hist["AUC"], label="train AUC", linewidth=2) plt.plot(hist["val_AUC"], label="val AUC", linewidth=2) @@ -458,8 +513,6 @@ def main(argv=None): p.add_argument("--batch", type=int, default=128) p.add_argument("--outdir", default=None, help="Output dir (default: runs/run_YYYYmmdd-HHMMSS)") - p.add_argument("--val_fraction", type=float, default=0.2, - help="Fraction for train/val split") p.add_argument("--test_batches", type=int, default=None, help="Limit to N batches for testing (default: None = use all data)") @@ -469,7 +522,16 @@ def main(argv=None): pathlib.Path(run_dir).mkdir(parents=True, exist_ok=True) print(f"★ Outputs → {run_dir}\n") + # Set seeds for reproducibility + tf.random.set_seed(42) + np.random.seed(42) + print("Setting random seeds for reproducibility...") + # ----------------------- Load & split ---------------------------------- + # Find the longest peptide sequence across all datasets + longest_peptide_seq_length = 0 + max_mhc_seq_length = 36 # TODO make dynamic later + # Load test sets test1 = pd.read_parquet(args.dataset_path + "/test1.parquet") test2 = pd.read_parquet(args.dataset_path + "/test2.parquet") @@ -481,10 +543,6 @@ def main(argv=None): fold_files = sorted([f for f in os.listdir(os.path.join(args.dataset_path, f'folds')) if f.endswith('.parquet')]) n_folds = len(fold_files) // 2 - # Find the longest peptide sequence across all datasets - longest_peptide_seq_length = 0 - max_mhc_seq_length = 36 # TODO make dynamic later - # Check test datasets if "long_mer" in test1.columns: longest_peptide_seq_length = max(longest_peptide_seq_length, int(test1["long_mer"].str.len().max())) @@ -498,44 +556,46 @@ def main(argv=None): # Create fold datasets with consistent sequence length folds = [] class_weights = [] - # Check all fold files for i in range(1, n_folds + 1): + print(f"processing fold {i}") train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') - train_loader = make_stream_dataset(train_path, max_pep_seq_len=longest_peptide_seq_length, max_mhc_len=max_mhc_seq_length, batch=args.batch, shuffle=True, test_batches=args.test_batches) - val_loader = make_stream_dataset(val_path, max_pep_seq_len=longest_peptide_seq_length, max_mhc_len=max_mhc_seq_length, batch=args.batch, shuffle=False, test_batches=args.test_batches) + train_ds = (make_stream_dataset(train_path, max_pep_seq_len=longest_peptide_seq_length, + max_mhc_len=max_mhc_seq_length) + .shuffle(buffer_size=BUFFER, reshuffle_each_iteration=True) + .batch(args.batch) + .take(args.test_batches) + .prefetch(tf.data.AUTOTUNE)) - # # 3) Shuffle + cache + repeat + prefetch for infinite, fresh-each-epoch stream - # train_ds = (train_loader - # .shuffle(buffer_size=100_000, reshuffle_each_iteration=True) - # .cache() # or .cache("train.cache") - # .repeat() # infinite - # .prefetch(tf.data.AUTOTUNE)) - # - # # Validation can skip repeat() and caching if you prefer, but prefetch is still good: - # val_ds = (val_loader - # .shuffle(buffer_size=20_000, reshuffle_each_iteration=True) - # .cache() # optional for val - # .prefetch(tf.data.AUTOTUNE)) + val_ds = (make_stream_dataset(val_path, max_pep_seq_len=longest_peptide_seq_length, + max_mhc_len=max_mhc_seq_length) + .batch(args.batch) + .take(args.test_batches) + .prefetch(tf.data.AUTOTUNE)) - # Calculate class weights for the current fold + # Calculate class weights (unchanged) train_labels = pd.read_parquet(train_path)["assigned_label"].values.astype(int) counts = np.bincount(train_labels, minlength=2) - cw = {0: 1.0, 1: 1.0} # Default weights if one class is missing or data is empty - if counts[0] > 0 and counts[1] > 0: # If both classes are present + cw = {0: 1.0, 1: 1.0} + if counts[0] > 0 and counts[1] > 0: total = counts.sum() cw[0] = total / (2 * counts[0]) cw[1] = total / (2 * counts[1]) - folds.append((train_loader, val_loader)) + folds.append((train_ds, val_ds)) class_weights.append(cw) - # Create test loaders with the same sequence length - test1_loader = make_stream_dataset(args.dataset_path + "/test1.parquet" - , max_pep_seq_len=longest_peptide_seq_length, max_mhc_len=max_mhc_seq_length, batch=128, shuffle=False) - test2_loader = make_stream_dataset(args.dataset_path + "/test2.parquet" - , max_pep_seq_len=longest_peptide_seq_length,max_mhc_len=max_mhc_seq_length, batch=128, shuffle=False) + # Test loaders + test1_ds = (make_stream_dataset(os.path.join(args.dataset_path, "test1.parquet"), + longest_peptide_seq_length, max_mhc_seq_length) + .batch(args.batch) + .prefetch(tf.data.AUTOTUNE)) + + test2_ds = (make_stream_dataset(os.path.join(args.dataset_path, "test2.parquet"), + longest_peptide_seq_length, max_mhc_seq_length) + .batch(args.batch) + .prefetch(tf.data.AUTOTUNE)) print(f"✓ loaded {len(test1):,} test1 samples, " f"{len(test2):,} test2 samples, " @@ -544,15 +604,11 @@ def main(argv=None): # ----------------------- Model ----------------------------------------- # clear GPU memory tf.keras.backend.clear_session() - # set random seeds for reproducibility - os.environ["PYTHONHASHSEED"] = "42" - os.environ["TF_DETERMINISTIC_OPS"] = "1" - tf.random.set_seed(42) - np.random.seed(42) - + print("Memory before fold processing:") + monitor_memory() # ------------------------- TRAIN -------------------------------------- ckpt_cb = tf.keras.callbacks.ModelCheckpoint( - filepath=os.path.join(run_dir, 'best_weights.h5'), + filepath=os.path.join(run_dir, 'best.weights.h5'), monitor='val_loss', save_best_only=True, mode='min') early_cb = tf.keras.callbacks.EarlyStopping( monitor='val_loss', patience=10, restore_best_weights=True) @@ -563,12 +619,13 @@ def main(argv=None): tf.random.set_seed(42) np.random.seed(42) print("########################### seq length: ", longest_peptide_seq_length) + print(f"redefining the model in each fold") model = build_custom_classifier(longest_peptide_seq_length, max_mhc_seq_length, pad_token=pad_token) model.summary() - # check dimension of the target - if train_loader.element_spec[1].shape[-1] != 1: - raise ValueError("Expected binary labels (shape should be (None, 1))") + # print shapes + for (x_pep, latents), labels in train_loader.take(1): + print(f"Input shapes: x_pep={x_pep.shape}, latents={latents.shape}, labels={labels.shape}") print("Training model...") hist = model.fit( @@ -580,11 +637,84 @@ def main(argv=None): verbose=1, ) + + # Gradient Tape method + # optimizer = tf.keras.optimizers.Adam() + # loss_fn = tf.keras.losses.BinaryCrossentropy( + # from_logits=False) # Use from_logits=False if your model has a sigmoid output + # + # best_val_loss = float('inf') + # patience_counter = 0 + # best_weights = None + # + # for epoch in range(args.epochs): + # print(f"Epoch {epoch + 1}/{args.epochs}") + # + # # Training loop + # train_loss = 0.0 + # train_batches = 0 + # for (x_pep, latents), labels in train_loader: + # with tf.GradientTape() as tape: + # predictions = model([x_pep, latents], training=True) + # # Apply class weights manually + # sample_weights = tf.where(tf.equal(labels, 1), + # class_weight[1], + # class_weight[0]) + # loss_value = loss_fn(labels, predictions, sample_weight=sample_weights) + # + # gradients = tape.gradient(loss_value, model.trainable_variables) + # optimizer.apply_gradients(zip(gradients, model.trainable_variables)) + # + # train_loss += loss_value + # train_batches += 1 + # + # avg_train_loss = train_loss / train_batches + # + # # Validation loop + # val_loss = 0.0 + # val_batches = 0 + # for (x_pep, latents), labels in val_loader: + # predictions = model([x_pep, latents], training=False) + # val_loss += loss_fn(labels, predictions) + # val_batches += 1 + # + # avg_val_loss = val_loss / val_batches + # + # # Print metrics + # print(f"Training loss: {avg_train_loss:.4f}, Validation loss: {avg_val_loss:.4f}") + # + # # Implement early stopping and model checkpoint + # if avg_val_loss < best_val_loss: + # best_val_loss = avg_val_loss + # best_weights = model.get_weights() + # patience_counter = 0 + # # Save checkpoint + # model.save_weights(os.path.join(run_dir, 'best.weights.h5')) + # print(f"✓ Saved best weights (val_loss: {best_val_loss:.4f})") + # else: + # patience_counter += 1 + # if patience_counter >= 10: # Match early_cb patience + # print(f"Early stopping triggered after {epoch + 1} epochs") + # break + # + # # Restore best weights + # if best_weights is not None: + # model.set_weights(best_weights) + # + # # Create history object with metrics for compatibility with other code + # hist = type('obj', (object,), { + # 'history': { + # 'loss': [0], # Placeholder + # 'val_loss': [best_val_loss] + # } + # }) + ###################### + # plot plot_training_curve(hist, run_dir, fold_id, model, val_loader) # save model and metadata - model.save(os.path.join(run_dir, f'model_fold_{fold_id}.h5')) + model.save(os.path.join(run_dir, f'model_fold_{fold_id}.weights.h5')) metadata = { "fold_id": fold_id, "epochs": args.epochs, @@ -598,20 +728,32 @@ def main(argv=None): # Evaluate on test sets print("Evaluating on test1 set...") - test1_results = model.evaluate(test1_loader, verbose=1) + + for (x_pep, latents), labels in test1_ds.take(1): + print(f"Test1 Input shapes: x_pep={x_pep.shape}, latents={latents.shape}, labels={labels.shape}") + + test1_results = model.evaluate(test1_ds, verbose=1) print(f"Test1 results: {test1_results}") print("Evaluating on test2 set...") - test2_results = model.evaluate(test2_loader, verbose=1) + + for (x_pep, latents), labels in test2_ds.take(1): + print(x_pep.shape, latents.shape, labels.shape) + + test2_results = model.evaluate(test2_ds, verbose=1) print(f"Test2 results: {test2_results}") # Plot ROC curve for test1 - plot_test_metrics(model, test1_loader, run_dir, fold_id, string="Test1 - balanced alleles") + plot_test_metrics(model, test1_ds, run_dir, fold_id, string="Test1 - balanced alleles") # Plot ROC curve for test2 - plot_test_metrics(model, test2_loader, run_dir, fold_id, string="Test2 - rare alleles") + plot_test_metrics(model, test2_ds, run_dir, fold_id, string="Test2 - rare alleles") + + # Aggressive cleanup + del model, hist, train_loader, val_loader if __name__ == "__main__": + BUFFER = 512 main([ "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_1", - "--epochs", "15", "--batch", "128", "--test_batches", "30" + "--epochs", "3", "--batch", "128", "--test_batches", "5" ]) \ No newline at end of file From bebfe3e72d6643285fb3afc60c415d3ffcbf4ff7 Mon Sep 17 00:00:00 2001 From: Amirreza Aleyasin Date: Mon, 9 Jun 2025 20:53:58 +0200 Subject: [PATCH 70/83] fall back --- utils/run_pMHC_DL_ESM2.py | 366 ++++++++++++-------------------------- 1 file changed, 113 insertions(+), 253 deletions(-) diff --git a/utils/run_pMHC_DL_ESM2.py b/utils/run_pMHC_DL_ESM2.py index b93ea79b8..a8855ddc0 100644 --- a/utils/run_pMHC_DL_ESM2.py +++ b/utils/run_pMHC_DL_ESM2.py @@ -27,47 +27,20 @@ Author : Amirreza (updated for cross‑attention, 2025‑05‑22) """ from __future__ import annotations -import os -import sys - -print(sys.executable) - -# ============================================================================= -# CRITICAL: GPU Memory Configuration - MUST BE FIRST -# ============================================================================= -import tensorflow as tf -def configure_gpu_memory(): - """Configure TensorFlow to use GPU memory efficiently""" - try: - gpus = tf.config.experimental.list_physical_devices('GPU') - if gpus: - print(f"Found {len(gpus)} GPU(s)") - for gpu in gpus: - tf.config.experimental.set_memory_growth(gpu, True) - print("✓ GPU memory growth enabled") - else: - print("No GPUs found - running on CPU") - except RuntimeError as e: - print(f"GPU configuration error: {e}") - - -# Configure GPU immediately -configure_gpu_memory() +import math +import os, sys, argparse, datetime, pathlib, json +from random import random -# Set memory-friendly environment variables -os.environ['TF_GPU_ALLOCATOR'] = 'cuda_malloc_async' -os.environ['TF_FORCE_GPU_ALLOW_GROWTH'] = 'true' -os.environ["PYTHONHASHSEED"] = "42" -os.environ["TF_DETERMINISTIC_OPS"] = "1" +print(sys.executable) -import math -import argparse, datetime, pathlib, json -import psutil import numpy as np import pandas as pd +import tensorflow as tf import matplotlib.pyplot as plt +from sklearn.model_selection import train_test_split from tqdm import tqdm + from model_archive import build_custom_classifier from sklearn.metrics import ( confusion_matrix, roc_curve, auc, precision_score, @@ -77,38 +50,6 @@ def configure_gpu_memory(): import os import pyarrow.parquet as pq -# ============================================================================= -# Memory monitoring functions -# ============================================================================= -def monitor_memory(): - """Monitor system memory usage""" - memory = psutil.virtual_memory() - print(f"System RAM: {memory.used / 1e9:.1f}GB / {memory.total / 1e9:.1f}GB ({memory.percent:.1f}% used)") - - try: - # Try to get GPU memory info - from pynvml import nvmlInit, nvmlDeviceGetCount, nvmlDeviceGetHandleByIndex, nvmlDeviceGetMemoryInfo - nvmlInit() - deviceCount = nvmlDeviceGetCount() - for i in range(deviceCount): - handle = nvmlDeviceGetHandleByIndex(i) - info = nvmlDeviceGetMemoryInfo(handle) - print( - f"GPU {i}: {info.used / 1e9:.1f}GB / {info.total / 1e9:.1f}GB ({100 * info.used / info.total:.1f}% used)") - except: - print("GPU memory monitoring not available") - - -def check_memory(): - """Check if memory usage is acceptable""" - memory = psutil.virtual_memory() - if memory.percent > 90: - print(f"⚠️ Critical RAM usage: {memory.percent:.1f}%") - return False - elif memory.percent > 80: - print(f"⚠️ High RAM usage: {memory.percent:.1f}%") - return True - # ---------------------------------------------------------------------------- # 1) Peptide → k‑mer one‑hot *inside* TF graph (GPU/TPU friendly) # ---------------------------------------------------------------------------- @@ -160,58 +101,72 @@ def _read_embedding_file(path: str | os.PathLike) -> np.ndarray: # ---------------------------------------------------------------------------- -def _load_parquet_samples(parquet_path, seq_len, k=9): - """ - FIXED: Generator that yields individual samples, not batches. - This prevents double-batching issues. - """ +def _load_parquet_rows(parquet_path, seq_len, k=9, test_batches=None): pq_file = pq.ParquetFile(parquet_path) - total_rows = _parquet_rowcount(parquet_path) - estimated_batches = math.ceil(total_rows / BUFFER) - for batch_df in tqdm(pq_file.iter_batches(batch_size=BUFFER), - total=estimated_batches, - desc="Loading batches", - unit="batch"): + batch_counter = 0 + for batch_df in pq_file.iter_batches(batch_size=2048): + if test_batches is not None and batch_counter >= test_batches: + break df = batch_df.to_pandas() - # Process each row individually - # Vectorized batch processing - seqs = tf.constant(df["long_mer"].tolist(), dtype=tf.string) # (N,) - labels = tf.constant(df["assigned_label"].values, dtype=tf.float32) # (N,) - # Load and stack all embeddings for the batch - embeddings = [_read_embedding_file(p) for p in df["mhc_embedding_path"]] - latents = tf.constant(np.stack(embeddings), dtype=tf.float32) # (N, 1152) - # One-hot encode all peptides in one go - x_peps = kmer_onehot_tensor(seqs, seq_len=seq_len, k=k) # (N, RF, k, 21) - # Yield individual samples - for x_pep, latent, label in zip(x_peps, latents, labels): - yield (x_pep, latent), tf.expand_dims(label, 0) - # Clean up DataFrame - del df + + peps = tf.constant(df["long_mer"].astype(str).values, dtype=tf.string) + x_pep = kmer_onehot_tensor(peps, seq_len, k) # tf.Tensor on GPU/CPU + + if "mhc_embedding" in df.columns and df["mhc_embedding"].dtype != object: + latents = tf.constant(np.stack(df["mhc_embedding"]).astype("float32")) + else: + latents = tf.constant(np.stack([_read_embedding_file(p) for p in df["mhc_embedding_path"]])) + + labels = tf.constant(df["assigned_label"].astype("float32").values[:, None]) + batch_counter += 1 + yield (x_pep, latents), labels + def make_stream_dataset( - parquet_path: str, - max_pep_seq_len: int, - max_mhc_len: int, - k: int = 9, + parquet_path: str, + max_pep_seq_len: int, + max_mhc_len: int, + batch: int = 512, + shuffle: bool = True, + k: int = 9, + test_batches: int = None ) -> tf.data.Dataset: - """ - FIXED: Memory-optimized dataset creation with proper batching. - """ + """Replacement for the "path‐like" branch; optimized to avoid caching when using small test_batches.""" rf = max_pep_seq_len - k + 1 - - # Output signature for individual samples (no batch dimension) output_signature = ( ( - tf.TensorSpec(shape=(rf, k, 21), dtype=tf.float32), # No batch dim - tf.TensorSpec(shape=(max_mhc_len, 1152), dtype=tf.float32), # No batch dim + tf.TensorSpec(shape=(None, rf, k, 21), dtype=tf.float32), # one-hot peptide tensor + tf.TensorSpec(shape=(None, max_mhc_len, 1152), dtype=tf.float32), # latent embeddings ), - tf.TensorSpec(shape=1, dtype=tf.float32), # Scalar label + tf.TensorSpec(shape=(None, 1), dtype=tf.float32), # labels ) + + # Pass test_batches into generator to limit batches early ds = tf.data.Dataset.from_generator( - lambda: _load_parquet_samples(parquet_path, max_pep_seq_len, k), + lambda: _load_parquet_rows(parquet_path, max_pep_seq_len, k, test_batches), output_signature=output_signature, ) - return ds + + if shuffle: + ds = ds.shuffle(buffer_size=10 * batch, reshuffle_each_iteration=True) + + # If test_batches is provided, limit dataset and batch after + if test_batches is not None: + return ds.prefetch(tf.data.AUTOTUNE) + + # Batch *after* shuffle so that every epoch gets fresh mixes + return ds.cache().prefetch(tf.data.AUTOTUNE) + +# ---------------------------------------------------------------------------- +# 4) On‑the‑fly 1:1 class balancing without Pandas down‑sampling +# ---------------------------------------------------------------------------- + +def build_balanced_dataset(ds: tf.data.Dataset) -> tf.data.Dataset: + """Wrap a dataset so that every step yields a balanced positive/negative mini‑batch.""" + pos = ds.filter(lambda x, y: tf.reduce_any(tf.equal(y, 1))) + neg = ds.filter(lambda x, y: tf.reduce_any(tf.equal(y, 0))) + balanced = tf.data.experimental.sample_from_datasets([pos, neg], weights=[0.5, 0.5]) + return balanced # --------------------------------------------------------------------------- # Visualisation utility @@ -248,16 +203,6 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.legend() plt.grid(True, alpha=0.3) - # Plot 2: Precision - Recall curve - # if "Precision" in hist and "Recall" in hist: - # plt.subplot(1, 4, 2) - # plt.plot(hist["Recall"], hist["Precision"], label="PR Curve", linewidth=2) - # plt.xlabel("Recall") - # plt.ylabel("Precision") - # plt.title("Precision-Recall Curve") - # plt.legend() - # plt.grid(True, alpha=0.3) - # Plot 2: Accuracy curve if "binary_accuracy" in hist and "val_binary_accuracy" in hist: plt.subplot(1, 4, 2) @@ -279,7 +224,7 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.grid(True, alpha=0.3) # Plot 3: AUC curve - if "AUC" in hist and "val_AUC" in hist: + if "AUC" in hist and "val_auc" in hist: plt.subplot(1, 4, 3) plt.plot(hist["AUC"], label="train AUC", linewidth=2) plt.plot(hist["val_AUC"], label="val AUC", linewidth=2) @@ -350,16 +295,16 @@ def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, hi Returns: Dictionary containing evaluation metrics """ # Collect predictions - print("Generating predictions...") - y_pred_proba = model.predict(test_dataset) - y_pred = (y_pred_proba > 0.5).astype(int).flatten() - # Extract true labels y_true = [] for _, labels in test_dataset: y_true.extend(labels.numpy()) y_true = np.array(y_true).flatten() + print("Generating predictions...") + y_pred_proba = model.predict(test_dataset) + y_pred = (y_pred_proba > 0.5).astype(int).flatten() + # Calculate ROC curve fpr, tpr, _ = roc_curve(y_true, y_pred_proba.flatten()) roc_auc = auc(fpr, tpr) @@ -513,6 +458,8 @@ def main(argv=None): p.add_argument("--batch", type=int, default=128) p.add_argument("--outdir", default=None, help="Output dir (default: runs/run_YYYYmmdd-HHMMSS)") + p.add_argument("--val_fraction", type=float, default=0.2, + help="Fraction for train/val split") p.add_argument("--test_batches", type=int, default=None, help="Limit to N batches for testing (default: None = use all data)") @@ -522,16 +469,7 @@ def main(argv=None): pathlib.Path(run_dir).mkdir(parents=True, exist_ok=True) print(f"★ Outputs → {run_dir}\n") - # Set seeds for reproducibility - tf.random.set_seed(42) - np.random.seed(42) - print("Setting random seeds for reproducibility...") - # ----------------------- Load & split ---------------------------------- - # Find the longest peptide sequence across all datasets - longest_peptide_seq_length = 0 - max_mhc_seq_length = 36 # TODO make dynamic later - # Load test sets test1 = pd.read_parquet(args.dataset_path + "/test1.parquet") test2 = pd.read_parquet(args.dataset_path + "/test2.parquet") @@ -543,6 +481,10 @@ def main(argv=None): fold_files = sorted([f for f in os.listdir(os.path.join(args.dataset_path, f'folds')) if f.endswith('.parquet')]) n_folds = len(fold_files) // 2 + # Find the longest peptide sequence across all datasets + longest_peptide_seq_length = 0 + max_mhc_seq_length = 36 # TODO make dynamic later + # Check test datasets if "long_mer" in test1.columns: longest_peptide_seq_length = max(longest_peptide_seq_length, int(test1["long_mer"].str.len().max())) @@ -556,46 +498,44 @@ def main(argv=None): # Create fold datasets with consistent sequence length folds = [] class_weights = [] + # Check all fold files for i in range(1, n_folds + 1): - print(f"processing fold {i}") train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') - train_ds = (make_stream_dataset(train_path, max_pep_seq_len=longest_peptide_seq_length, - max_mhc_len=max_mhc_seq_length) - .shuffle(buffer_size=BUFFER, reshuffle_each_iteration=True) - .batch(args.batch) - .take(args.test_batches) - .prefetch(tf.data.AUTOTUNE)) + train_loader = make_stream_dataset(train_path, max_pep_seq_len=longest_peptide_seq_length, max_mhc_len=max_mhc_seq_length, batch=args.batch, shuffle=True, test_batches=args.test_batches) + val_loader = make_stream_dataset(val_path, max_pep_seq_len=longest_peptide_seq_length, max_mhc_len=max_mhc_seq_length, batch=args.batch, shuffle=False, test_batches=args.test_batches) - val_ds = (make_stream_dataset(val_path, max_pep_seq_len=longest_peptide_seq_length, - max_mhc_len=max_mhc_seq_length) - .batch(args.batch) - .take(args.test_batches) - .prefetch(tf.data.AUTOTUNE)) + # # 3) Shuffle + cache + repeat + prefetch for infinite, fresh-each-epoch stream + # train_ds = (train_loader + # .shuffle(buffer_size=100_000, reshuffle_each_iteration=True) + # .cache() # or .cache("train.cache") + # .repeat() # infinite + # .prefetch(tf.data.AUTOTUNE)) + # + # # Validation can skip repeat() and caching if you prefer, but prefetch is still good: + # val_ds = (val_loader + # .shuffle(buffer_size=20_000, reshuffle_each_iteration=True) + # .cache() # optional for val + # .prefetch(tf.data.AUTOTUNE)) - # Calculate class weights (unchanged) + # Calculate class weights for the current fold train_labels = pd.read_parquet(train_path)["assigned_label"].values.astype(int) counts = np.bincount(train_labels, minlength=2) - cw = {0: 1.0, 1: 1.0} - if counts[0] > 0 and counts[1] > 0: + cw = {0: 1.0, 1: 1.0} # Default weights if one class is missing or data is empty + if counts[0] > 0 and counts[1] > 0: # If both classes are present total = counts.sum() cw[0] = total / (2 * counts[0]) cw[1] = total / (2 * counts[1]) - folds.append((train_ds, val_ds)) + folds.append((train_loader, val_loader)) class_weights.append(cw) - # Test loaders - test1_ds = (make_stream_dataset(os.path.join(args.dataset_path, "test1.parquet"), - longest_peptide_seq_length, max_mhc_seq_length) - .batch(args.batch) - .prefetch(tf.data.AUTOTUNE)) - - test2_ds = (make_stream_dataset(os.path.join(args.dataset_path, "test2.parquet"), - longest_peptide_seq_length, max_mhc_seq_length) - .batch(args.batch) - .prefetch(tf.data.AUTOTUNE)) + # Create test loaders with the same sequence length + test1_loader = make_stream_dataset(args.dataset_path + "/test1.parquet" + , max_pep_seq_len=longest_peptide_seq_length, max_mhc_len=max_mhc_seq_length, batch=128, shuffle=False) + test2_loader = make_stream_dataset(args.dataset_path + "/test2.parquet" + , max_pep_seq_len=longest_peptide_seq_length,max_mhc_len=max_mhc_seq_length, batch=128, shuffle=False) print(f"✓ loaded {len(test1):,} test1 samples, " f"{len(test2):,} test2 samples, " @@ -604,11 +544,15 @@ def main(argv=None): # ----------------------- Model ----------------------------------------- # clear GPU memory tf.keras.backend.clear_session() - print("Memory before fold processing:") - monitor_memory() + # set random seeds for reproducibility + os.environ["PYTHONHASHSEED"] = "42" + os.environ["TF_DETERMINISTIC_OPS"] = "1" + tf.random.set_seed(42) + np.random.seed(42) + # ------------------------- TRAIN -------------------------------------- ckpt_cb = tf.keras.callbacks.ModelCheckpoint( - filepath=os.path.join(run_dir, 'best.weights.h5'), + filepath=os.path.join(run_dir, 'best_weights.h5'), monitor='val_loss', save_best_only=True, mode='min') early_cb = tf.keras.callbacks.EarlyStopping( monitor='val_loss', patience=10, restore_best_weights=True) @@ -619,13 +563,12 @@ def main(argv=None): tf.random.set_seed(42) np.random.seed(42) print("########################### seq length: ", longest_peptide_seq_length) - print(f"redefining the model in each fold") model = build_custom_classifier(longest_peptide_seq_length, max_mhc_seq_length, pad_token=pad_token) model.summary() - # print shapes - for (x_pep, latents), labels in train_loader.take(1): - print(f"Input shapes: x_pep={x_pep.shape}, latents={latents.shape}, labels={labels.shape}") + # check dimension of the target + if train_loader.element_spec[1].shape[-1] != 1: + raise ValueError("Expected binary labels (shape should be (None, 1))") print("Training model...") hist = model.fit( @@ -637,84 +580,11 @@ def main(argv=None): verbose=1, ) - - # Gradient Tape method - # optimizer = tf.keras.optimizers.Adam() - # loss_fn = tf.keras.losses.BinaryCrossentropy( - # from_logits=False) # Use from_logits=False if your model has a sigmoid output - # - # best_val_loss = float('inf') - # patience_counter = 0 - # best_weights = None - # - # for epoch in range(args.epochs): - # print(f"Epoch {epoch + 1}/{args.epochs}") - # - # # Training loop - # train_loss = 0.0 - # train_batches = 0 - # for (x_pep, latents), labels in train_loader: - # with tf.GradientTape() as tape: - # predictions = model([x_pep, latents], training=True) - # # Apply class weights manually - # sample_weights = tf.where(tf.equal(labels, 1), - # class_weight[1], - # class_weight[0]) - # loss_value = loss_fn(labels, predictions, sample_weight=sample_weights) - # - # gradients = tape.gradient(loss_value, model.trainable_variables) - # optimizer.apply_gradients(zip(gradients, model.trainable_variables)) - # - # train_loss += loss_value - # train_batches += 1 - # - # avg_train_loss = train_loss / train_batches - # - # # Validation loop - # val_loss = 0.0 - # val_batches = 0 - # for (x_pep, latents), labels in val_loader: - # predictions = model([x_pep, latents], training=False) - # val_loss += loss_fn(labels, predictions) - # val_batches += 1 - # - # avg_val_loss = val_loss / val_batches - # - # # Print metrics - # print(f"Training loss: {avg_train_loss:.4f}, Validation loss: {avg_val_loss:.4f}") - # - # # Implement early stopping and model checkpoint - # if avg_val_loss < best_val_loss: - # best_val_loss = avg_val_loss - # best_weights = model.get_weights() - # patience_counter = 0 - # # Save checkpoint - # model.save_weights(os.path.join(run_dir, 'best.weights.h5')) - # print(f"✓ Saved best weights (val_loss: {best_val_loss:.4f})") - # else: - # patience_counter += 1 - # if patience_counter >= 10: # Match early_cb patience - # print(f"Early stopping triggered after {epoch + 1} epochs") - # break - # - # # Restore best weights - # if best_weights is not None: - # model.set_weights(best_weights) - # - # # Create history object with metrics for compatibility with other code - # hist = type('obj', (object,), { - # 'history': { - # 'loss': [0], # Placeholder - # 'val_loss': [best_val_loss] - # } - # }) - ###################### - # plot plot_training_curve(hist, run_dir, fold_id, model, val_loader) # save model and metadata - model.save(os.path.join(run_dir, f'model_fold_{fold_id}.weights.h5')) + model.save(os.path.join(run_dir, f'model_fold_{fold_id}.h5')) metadata = { "fold_id": fold_id, "epochs": args.epochs, @@ -728,32 +598,22 @@ def main(argv=None): # Evaluate on test sets print("Evaluating on test1 set...") - - for (x_pep, latents), labels in test1_ds.take(1): - print(f"Test1 Input shapes: x_pep={x_pep.shape}, latents={latents.shape}, labels={labels.shape}") - - test1_results = model.evaluate(test1_ds, verbose=1) + test1_results = model.evaluate(test1_loader, verbose=1) print(f"Test1 results: {test1_results}") - print("Evaluating on test2 set...") - for (x_pep, latents), labels in test2_ds.take(1): - print(x_pep.shape, latents.shape, labels.shape) + # Plot ROC curve for test1 + plot_test_metrics(model, test1_loader, run_dir, fold_id, string="Test1 - balanced alleles") - test2_results = model.evaluate(test2_ds, verbose=1) + print("Evaluating on test2 set...") + test2_results = model.evaluate(test2_loader, verbose=1) print(f"Test2 results: {test2_results}") - # Plot ROC curve for test1 - plot_test_metrics(model, test1_ds, run_dir, fold_id, string="Test1 - balanced alleles") # Plot ROC curve for test2 - plot_test_metrics(model, test2_ds, run_dir, fold_id, string="Test2 - rare alleles") - - # Aggressive cleanup - del model, hist, train_loader, val_loader + plot_test_metrics(model, test2_loader, run_dir, fold_id, string="Test2 - rare alleles") if __name__ == "__main__": - BUFFER = 512 main([ "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_1", - "--epochs", "3", "--batch", "128", "--test_batches", "5" + "--epochs", "3", "--batch", "128", "--test_batches", "3" ]) \ No newline at end of file From 519b4bbc72dbe23e467cead81f28e21aedb5fa11 Mon Sep 17 00:00:00 2001 From: Amirreza Aleyasin Date: Mon, 9 Jun 2025 21:14:14 +0200 Subject: [PATCH 71/83] quick fix for tf 2.19.0 --- utils/model.py | 10 +++++----- 1 file changed, 5 insertions(+), 5 deletions(-) diff --git a/utils/model.py b/utils/model.py index de81229ab..1014dc4b0 100644 --- a/utils/model.py +++ b/utils/model.py @@ -2098,10 +2098,10 @@ def build_classifier(max_seq_len=50, # --- Create attention masks --------------------------------------------- # Peptide mask: True where peptide has content (non-zero vectors) - pep_mask = tf.reduce_any(tf.abs(peptide_in) > 1e-6, axis=-1) # (B, S) + pep_mask = layers.Lambda(lambda x: tf.reduce_any(tf.abs(x) > 1e-6, axis=-1))(peptide_in) # (B, S) # Latent mask: True where latent has content (non-zero vectors) - latent_mask = tf.reduce_any(tf.abs(latent_in) > 1e-6, axis=-1) # (B, R) + latent_mask = layers.Lambda(lambda x: tf.reduce_any(tf.abs(x) > 1e-6, axis=-1))(latent_in) # (B, R) # --- Projections -------------------------------------------------------- pep_proj = PeptideProj(max_seq_len, embed_dim, name="peptide_projection")(peptide_in) @@ -2133,12 +2133,12 @@ def build_classifier(max_seq_len=50, # --- Aggregation and prediction head ----------------------------------- # Global average pooling with masking - latent_mask_expanded = tf.expand_dims(tf.cast(latent_mask, tf.float32), -1) # (B, R, 1) + latent_mask_expanded = layers.Lambda(lambda x: tf.expand_dims(tf.cast(x, tf.float32), -1))(latent_mask) # (B, R, 1) masked_fused = fused * latent_mask_expanded # Zero out padded positions # Compute mean only over valid positions - pooled = tf.reduce_sum(masked_fused, axis=1) # (B, D) - valid_lengths = tf.reduce_sum(latent_mask_expanded, axis=1) # (B, 1) + pooled = layers.Lambda(lambda x: tf.reduce_sum(x, axis=1))(masked_fused) # (B, D) + valid_lengths = layers.Lambda(lambda x: tf.reduce_sum(x, axis=1))(latent_mask_expanded) # (B, 1) pooled = pooled / (valid_lengths + 1e-8) # Average over valid positions # Simpler classification head From c61dea34f5d6736e3fa9f3eeb1ca89270d2f3b0e Mon Sep 17 00:00:00 2001 From: Amirreza Aleyasin Date: Mon, 9 Jun 2025 21:15:07 +0200 Subject: [PATCH 72/83] run model --- utils/run_pMHC_DL_ESM3.py | 755 ++++++++++++++++++++++++++++++++++++++ 1 file changed, 755 insertions(+) create mode 100644 utils/run_pMHC_DL_ESM3.py diff --git a/utils/run_pMHC_DL_ESM3.py b/utils/run_pMHC_DL_ESM3.py new file mode 100644 index 000000000..e4c683cfd --- /dev/null +++ b/utils/run_pMHC_DL_ESM3.py @@ -0,0 +1,755 @@ +#!/usr/bin/env python +""" +========================= + +End‑to‑end trainer for a **peptide×MHC cross‑attention classifier**. +It loads a NetMHCpan‑style parquet that contains + + long_mer, assigned_label, allele, MHC_class, + mhc_embedding **OR** mhc_embedding_path + +columns. Each row supplies + +* a peptide sequence (long_mer) +* a pre‑computed MHC pseudo‑sequence embedding (36, 1152) +* a binary label (assigned_label) + +The script + +1.Derives the longest peptide length → SEQ_LEN. +2.Converts every peptide into a 21‑dim one‑hot tensor (SEQ_LEN, 21). +3.Feeds the pair + + (one_hot_peptide, mhc_latent) → classifier → P(binding) + +4.Trains with binary‑cross‑entropy and saves the best weights & metadata. + +Author : Amirreza (updated for cross‑attention, 2025‑05‑22) +""" +from __future__ import annotations +import os +import sys + +print(sys.executable) + +# ============================================================================= +# CRITICAL: GPU Memory Configuration - MUST BE FIRST +# ============================================================================= +import tensorflow as tf + +def configure_gpu_memory(): + """Configure TensorFlow to use GPU memory efficiently""" + try: + gpus = tf.config.experimental.list_physical_devices('GPU') + if gpus: + print(f"Found {len(gpus)} GPU(s)") + for gpu in gpus: + tf.config.experimental.set_memory_growth(gpu, True) + print("✓ GPU memory growth enabled") + else: + print("No GPUs found - running on CPU") + except RuntimeError as e: + print(f"GPU configuration error: {e}") + + +# Configure GPU immediately +configure_gpu_memory() + +# Set memory-friendly environment variables +os.environ['TF_GPU_ALLOCATOR'] = 'cuda_malloc_async' +os.environ['TF_FORCE_GPU_ALLOW_GROWTH'] = 'true' +os.environ["PYTHONHASHSEED"] = "42" +os.environ["TF_DETERMINISTIC_OPS"] = "1" + +import math +import argparse, datetime, pathlib, json +import psutil +import numpy as np +import pandas as pd +import matplotlib.pyplot as plt +from tqdm import tqdm +from model import build_classifier +from sklearn.metrics import ( + confusion_matrix, roc_curve, auc, precision_score, + recall_score, f1_score, accuracy_score, roc_auc_score +) +import seaborn as sns +import os +import pyarrow.parquet as pq + +# ============================================================================= +# Memory monitoring functions +# ============================================================================= +def monitor_memory(): + """Monitor system memory usage""" + memory = psutil.virtual_memory() + print(f"System RAM: {memory.used / 1e9:.1f}GB / {memory.total / 1e9:.1f}GB ({memory.percent:.1f}% used)") + + try: + # Try to get GPU memory info + from pynvml import nvmlInit, nvmlDeviceGetCount, nvmlDeviceGetHandleByIndex, nvmlDeviceGetMemoryInfo + nvmlInit() + deviceCount = nvmlDeviceGetCount() + for i in range(deviceCount): + handle = nvmlDeviceGetHandleByIndex(i) + info = nvmlDeviceGetMemoryInfo(handle) + print( + f"GPU {i}: {info.used / 1e9:.1f}GB / {info.total / 1e9:.1f}GB ({100 * info.used / info.total:.1f}% used)") + except: + print("GPU memory monitoring not available") + + +def check_memory(): + """Check if memory usage is acceptable""" + memory = psutil.virtual_memory() + if memory.percent > 90: + print(f"⚠️ Critical RAM usage: {memory.percent:.1f}%") + return False + elif memory.percent > 80: + print(f"⚠️ High RAM usage: {memory.percent:.1f}%") + return True + +# ---------------------------------------------------------------------------- +# 1) Peptide → k‑mer one‑hot *inside* TF graph (GPU/TPU friendly) +# ---------------------------------------------------------------------------- +# pad_token = -2 + +AA = "ACDEFGHIKLMNPQRSTVWY" # 20 standard AAs, order fixed +AA_TO_IDX = {aa: i for i, aa in enumerate(AA)} +UNK_IDX = 20 # index for unknown / padding + +def peptides_to_onehot(sequence: str, max_seq_len: int) -> np.ndarray: + arr = np.zeros((max_seq_len, 21), dtype=np.float32) + for j, aa in enumerate(sequence.upper()[:max_seq_len]): + arr[j, AA_TO_IDX.get(aa, UNK_IDX)] = 1.0 + # remaining positions stay zero → acts as padded UNK (index 20) + return arr + +# --------------------------------------------------------------------------- +# tf.data convenience wrapper ---------------------------------------------- +# --------------------------------------------------------------------------- + +def _parquet_rowcount(parquet_path: str | os.PathLike) -> int: + return pq.ParquetFile(parquet_path).metadata.num_rows + +# --------------------------------------------------------------------------- +# Robust loader for latent embeddings (same as before) +# --------------------------------------------------------------------------- + +def _read_embedding_file(path: str | os.PathLike) -> np.ndarray: + # Try fast numeric path first + try: + arr = np.load(path) + if isinstance(arr, np.ndarray) and arr.dtype == np.float32: + return arr + raise ValueError + except ValueError: + obj = np.load(path, allow_pickle=True) + if isinstance(obj, np.ndarray) and obj.dtype == object: + obj = obj.item() + if isinstance(obj, dict) and "embedding" in obj: + return obj["embedding"].astype("float32") + raise ValueError(f"Unrecognised embedding file {path}") + + +# ---------------------------------------------------------------------------- +# 3) Streaming Parquet → tf.data.Dataset (stays in TF tensors the whole time) +# ---------------------------------------------------------------------------- + + +def _load_parquet_samples(parquet_path, seq_len): + pq_file = pq.ParquetFile(parquet_path) + for batch_df in pq_file.iter_batches(batch_size=BUFFER): + df = batch_df.to_pandas() + for _, row in df.iterrows(): + # Convert peptide sequence to one-hot encoding + one_hot_peptide = peptides_to_onehot(row["long_mer"], seq_len) + + # Load MHC embedding + mhc_embedding = _read_embedding_file(row["mhc_embedding_path"]) + + # Ensure MHC embedding is a numpy array + if not isinstance(mhc_embedding, np.ndarray): + raise ValueError(f"Expected MHC embedding to be a numpy array, got {type(mhc_embedding)}") + + # Yield the sample as a tuple + yield (one_hot_peptide, mhc_embedding), int(row["assigned_label"]) + + + +def make_stream_dataset( + parquet_path: str, + max_pep_seq_len: int, + max_mhc_len: int, + k: int = 9, +) -> tf.data.Dataset: + """ + FIXED: Memory-optimized dataset creation with proper batching. + """ + + # Output signature for individual samples (no batch dimension) + output_signature = ( + ( + tf.TensorSpec(shape=(max_pep_seq_len, 21), dtype=tf.float32), # No batch dim + tf.TensorSpec(shape=(max_mhc_len, 1152), dtype=tf.float32), # No batch dim + ), + tf.TensorSpec(shape=(), dtype=tf.float32), # Scalar label + ) + ds = tf.data.Dataset.from_generator( + lambda: _load_parquet_samples(parquet_path, max_pep_seq_len), + output_signature=output_signature, + ) + return ds + +# --------------------------------------------------------------------------- +# Visualisation utility +# --------------------------------------------------------------------------- + +def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_id: int = None, + model=None, val_dataset=None): + """ + Plot training curves and validation metrics from a Keras history object. + + Args: + history: Keras history object containing training metrics. + run_dir: Directory to save the plot. + fold_id: Optional fold identifier for naming the output file. + model: Optional model to compute confusion matrix and ROC curve. + val_dataset: Optional validation dataset to generate predictions. + + Returns: None + """ + hist = history.history + plt.figure(figsize=(21, 6)) + plot_name = f"training_curve{'_fold' + str(fold_id) if fold_id is not None else ''}" + + # set plot name above all plots + plt.suptitle(f"Training Curves{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", fontsize=16, fontweight='bold') + + # Plot 1: Loss curve + plt.subplot(1, 4, 1) + plt.plot(hist["loss"], label="train", linewidth=2) + plt.plot(hist["val_loss"], label="val", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Loss") + plt.title("BCE Loss") + plt.legend() + plt.grid(True, alpha=0.3) + + # Plot 2: Precision - Recall curve + # if "Precision" in hist and "Recall" in hist: + # plt.subplot(1, 4, 2) + # plt.plot(hist["Recall"], hist["Precision"], label="PR Curve", linewidth=2) + # plt.xlabel("Recall") + # plt.ylabel("Precision") + # plt.title("Precision-Recall Curve") + # plt.legend() + # plt.grid(True, alpha=0.3) + + # Plot 2: Accuracy curve + if "binary_accuracy" in hist and "val_binary_accuracy" in hist: + plt.subplot(1, 4, 2) + plt.plot(hist["binary_accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_binary_accuracy"], label="val acc", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Accuracy") + plt.title("Binary Accuracy") + plt.legend() + plt.grid(True, alpha=0.3) + elif "accuracy" in hist and "val_accuracy" in hist: + plt.subplot(1, 4, 2) + plt.plot(hist["accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_accuracy"], label="val acc", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Accuracy") + plt.title("Accuracy") + plt.legend() + plt.grid(True, alpha=0.3) + + # Plot 3: AUC curve + if "AUC" in hist and "val_AUC" in hist: + plt.subplot(1, 4, 3) + plt.plot(hist["AUC"], label="train AUC", linewidth=2) + plt.plot(hist["val_AUC"], label="val AUC", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("AUC") + plt.title("AUC") + plt.legend() + plt.grid(True, alpha=0.3) + + # Plot 4: Confusion matrix (if model and validation dataset provided) + if model is not None and val_dataset is not None: + plt.subplot(1, 4, 4) + + # Get predictions + y_pred_proba = model.predict(val_dataset) + y_pred = (y_pred_proba > 0.5).astype(int) + + # Extract true labels + y_true = [] + for _, labels in val_dataset: + y_true.extend(labels.numpy()) + y_true = np.array(y_true) + + # print ranges of y_true and y_pred + print(f"y_true range: {y_true.min()} to {y_true.max()}") + + print(f"y_pred range: {y_pred.min()} to {y_pred.max()}") + + # Create confusion matrix + cm = confusion_matrix(y_true, y_pred) + sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', + xticklabels=['Negative', 'Positive'], + yticklabels=['Negative', 'Positive']) + plt.title('Confusion Matrix') + plt.xlabel('Predicted') + plt.ylabel('Actual') + else: + # If no model/dataset provided, show a placeholder or additional metric + plt.subplot(1, 4, 4) + plt.text(0.5, 0.5, 'Confusion Matrix\n(Requires model + val_dataset)', + ha='center', va='center', transform=plt.gca().transAxes, + bbox=dict(boxstyle="round,pad=0.3", facecolor="lightgray")) + plt.axis('off') + + # Save main plot + plt.tight_layout() + out_png = os.path.join(run_dir, f"{plot_name}.png") + + # Create directory if it doesn't exist + os.makedirs(run_dir, exist_ok=True) + + plt.savefig(out_png, dpi=300, bbox_inches='tight') + plt.show() + print(f"✓ Training curve saved to {out_png}") + + +def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, history=None, string: str =None): + """ + Plot comprehensive evaluation metrics for a test dataset using a trained model. + + Args: + model: Trained Keras model. + test_dataset: TensorFlow dataset for testing. + run_dir: Directory to save the plot. + fold_id: Optional fold identifier for naming the output file. + history: Optional training history object to display loss/accuracy curves. + + Returns: Dictionary containing evaluation metrics + """ + # CORRECTED LOGIC: Extract labels first. + y_true = np.concatenate([labels for _, labels in test_dataset], axis=0).flatten() + + # Collect predictions + print("Generating predictions...") + y_pred_proba = model.predict(test_dataset) + y_pred = (y_pred_proba > 0.5).astype(int).flatten() + + # # Extract true labels + # y_true = [] + # for _, labels in test_dataset: + # y_true.extend(labels.numpy()) + # y_true = np.array(y_true).flatten() + + # Calculate ROC curve + fpr, tpr, _ = roc_curve(y_true, y_pred_proba.flatten()) + roc_auc = auc(fpr, tpr) + + # Create a multi-panel figure + plt.figure(figsize=(15, 10)) + plt.suptitle(f"{string} Evaluation Metrics{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", + fontsize=16, fontweight='bold') + + # Panel 1: ROC Curve + plt.subplot(2, 2, 1) + plt.plot(fpr, tpr, color='darkorange', lw=2, + label=f'ROC curve (AUC = {roc_auc:.4f})') + plt.plot([0, 1], [0, 1], color='navy', lw=2, linestyle='--', alpha=0.8) + plt.xlim([0.0, 1.0]) + plt.ylim([0.0, 1.05]) + plt.xlabel('False Positive Rate') + plt.ylabel('True Positive Rate') + plt.title('Receiver Operating Characteristic (ROC) Curve') + plt.legend(loc="lower right") + plt.grid(True, alpha=0.3) + + # Panel 2: Confusion Matrix + plt.subplot(2, 2, 2) + cm = confusion_matrix(y_true, y_pred) + sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', + xticklabels=['Negative', 'Positive'], + yticklabels=['Negative', 'Positive']) + plt.title('Confusion Matrix') + plt.xlabel('Predicted Label') + plt.ylabel('True Label') + + # Panel 3: Loss curve (if history provided) + if history is not None: + plt.subplot(2, 2, 3) + hist = history.history + plt.plot(hist.get("loss", []), label="train", linewidth=2) + plt.plot(hist.get("val_loss", []), label="val", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Loss") + plt.title("BCE Loss") + plt.legend() + plt.grid(True, alpha=0.3) + + # Panel 4: Accuracy curve (if available in history) + plt.subplot(2, 2, 4) + if "binary_accuracy" in hist and "val_binary_accuracy" in hist: + plt.plot(hist["binary_accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_binary_accuracy"], label="val acc", linewidth=2) + elif "accuracy" in hist and "val_accuracy" in hist: + plt.plot(hist["accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_accuracy"], label="val acc", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Accuracy") + plt.title("Accuracy") + plt.legend() + plt.grid(True, alpha=0.3) + else: + # Panel 3: Test metrics when history not available + plt.subplot(2, 2, 3) + + # Calculate metrics + accuracy = accuracy_score(y_true, y_pred) + precision = precision_score(y_true, y_pred, zero_division=0) + recall = recall_score(y_true, y_pred, zero_division=0) + f1 = f1_score(y_true, y_pred, zero_division=0) + + metrics = { + 'Accuracy': accuracy, + 'Precision': precision, + 'Recall': recall, + 'F1 Score': f1, + 'AUC': roc_auc + } + + # Create a bar chart for metrics + bars = plt.bar(range(len(metrics)), list(metrics.values()), + color=['skyblue', 'lightcoral', 'lightgreen', 'gold', 'orange'], + alpha=0.8, edgecolor='black', linewidth=1) + plt.xticks(range(len(metrics)), list(metrics.keys()), rotation=45, ha='right') + plt.ylim(0, 1.0) + plt.title('Test Set Evaluation Metrics') + plt.ylabel('Score') + plt.grid(True, alpha=0.3, axis='y') + + # Add values on top of bars + for i, (bar, value) in enumerate(zip(bars, metrics.values())): + plt.text(bar.get_x() + bar.get_width() / 2, bar.get_height() + 0.02, + f'{value:.4f}', ha='center', va='bottom', fontweight='bold') + + # Panel 4: Prediction distribution + plt.subplot(2, 2, 4) + plt.hist(y_pred_proba[y_true == 0], bins=30, alpha=0.7, + label='Negative Class', color='red', density=True) + plt.hist(y_pred_proba[y_true == 1], bins=30, alpha=0.7, + label='Positive Class', color='blue', density=True) + plt.axvline(x=0.5, color='black', linestyle='--', linewidth=2, + label='Decision Threshold') + plt.xlabel('Predicted Probability') + plt.ylabel('Density') + plt.title('Prediction Probability Distribution') + plt.legend() + plt.grid(True, alpha=0.3) + + plt.tight_layout() + + # Create directory if it doesn't exist + os.makedirs(run_dir, exist_ok=True) + + out_png = os.path.join(run_dir, f"{string}_metrics{'_fold' + str(fold_id) if fold_id is not None else ''}.png") + plt.savefig(out_png, dpi=300, bbox_inches='tight') + plt.show() + print(f"✓ Test metrics visualization saved to {out_png}") + + # Calculate and return evaluation metrics + metrics_dict = { + 'roc_auc': roc_auc, + 'accuracy': accuracy_score(y_true, y_pred), + 'precision': precision_score(y_true, y_pred, zero_division=0), + 'recall': recall_score(y_true, y_pred, zero_division=0), + 'f1': f1_score(y_true, y_pred, zero_division=0), + 'confusion_matrix': cm.tolist(), + 'fpr': fpr.tolist(), + 'tpr': tpr.tolist() + } + + # Print summary + print("\n" + "=" * 50) + print("TEST SET EVALUATION SUMMARY") + print("=" * 50) + print(f"Accuracy: {metrics_dict['accuracy']:.4f}") + print(f"Precision: {metrics_dict['precision']:.4f}") + print(f"Recall: {metrics_dict['recall']:.4f}") + print(f"F1 Score: {metrics_dict['f1']:.4f}") + print(f"ROC AUC: {metrics_dict['roc_auc']:.4f}") + print("=" * 50) + + return metrics_dict + +# --------------------------------------------------------------------------- +# Training script +# --------------------------------------------------------------------------- + +def main(argv=None): + p = argparse.ArgumentParser() + p.add_argument("--parquet", required=False, + help="Input parquet with peptide, latent, label") + p.add_argument("--dataset_path", default=None, + help="Path to a custom dataset (not parquet)") + p.add_argument("--epochs", type=int, default=30) + p.add_argument("--batch", type=int, default=128) + p.add_argument("--outdir", default=None, + help="Output dir (default: runs/run_YYYYmmdd-HHMMSS)") + p.add_argument("--test_batches", type=int, default=None, + help="Limit to N batches for testing (default: None = use all data)") + p.add_argument("--model_name", default=2) + + args = p.parse_args(argv) + + run_dir = args.outdir or f"runs/run_{datetime.datetime.now():%Y%m%d-%H%M%S}" + pathlib.Path(run_dir).mkdir(parents=True, exist_ok=True) + print(f"★ Outputs → {run_dir}\n") + + # Set seeds for reproducibility + tf.random.set_seed(42) + np.random.seed(42) + print("Setting random seeds for reproducibility...") + + # ----------------------- Load & split ---------------------------------- + # Find the longest peptide sequence across all datasets + longest_peptide_seq_length = 0 + max_mhc_seq_length = 36 # TODO make dynamic later + + # Load test sets + test1 = pd.read_parquet(args.dataset_path + "/test1.parquet") + test2 = pd.read_parquet(args.dataset_path + "/test2.parquet") + esm_files = list(pathlib.Path(args.dataset_path).glob('*esm_embeddings.parquet')) + if not esm_files: + raise FileNotFoundError('No esm embeddings parquet found in dataset_path') + whole_data = pd.read_parquet(str(esm_files[0])) + + fold_files = sorted([f for f in os.listdir(os.path.join(args.dataset_path, f'folds')) if f.endswith('.parquet')]) + n_folds = len(fold_files) // 2 + + # Check test datasets + if "long_mer" in test1.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(test1["long_mer"].str.len().max())) + + if "long_mer" in test2.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(test2["long_mer"].str.len().max())) + # Check whole dataset + if "long_mer" in whole_data.columns: + longest_peptide_seq_length = max(longest_peptide_seq_length, int(whole_data["long_mer"].str.len().max())) + + # Create fold datasets with consistent sequence length + folds = [] + class_weights = [] + for i in range(1, n_folds + 1): + print(f"processing fold {i}") + train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') + val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') + + train_ds = (make_stream_dataset(train_path, max_pep_seq_len=longest_peptide_seq_length, + max_mhc_len=max_mhc_seq_length) + .shuffle(buffer_size=BUFFER, reshuffle_each_iteration=True) + .repeat() + .batch(args.batch) + .take(args.test_batches) + .prefetch(tf.data.AUTOTUNE)) + + val_ds = (make_stream_dataset(val_path, max_pep_seq_len=longest_peptide_seq_length, + max_mhc_len=max_mhc_seq_length) + .batch(args.batch) + .take(args.test_batches) + .prefetch(tf.data.AUTOTUNE)) + + # Calculate class weights (unchanged) + train_labels = pd.read_parquet(train_path)["assigned_label"].values.astype(int) + counts = np.bincount(train_labels, minlength=2) + cw = {0: 1.0, 1: 1.0} + if counts[0] > 0 and counts[1] > 0: + total = counts.sum() + cw[0] = total / (2 * counts[0]) + cw[1] = total / (2 * counts[1]) + + folds.append((train_ds, val_ds)) + class_weights.append(cw) + + # Test loaders + test1_ds = (make_stream_dataset(os.path.join(args.dataset_path, "test1.parquet"), + longest_peptide_seq_length, max_mhc_seq_length) + .batch(args.batch) + .prefetch(tf.data.AUTOTUNE)) + + test2_ds = (make_stream_dataset(os.path.join(args.dataset_path, "test2.parquet"), + longest_peptide_seq_length, max_mhc_seq_length) + .batch(args.batch) + .prefetch(tf.data.AUTOTUNE)) + + print(f"✓ loaded {len(test1):,} test1 samples, " + f"{len(test2):,} test2 samples, " + f"{len(folds)} folds") + + # ----------------------- Model ----------------------------------------- + # clear GPU memory + tf.keras.backend.clear_session() + print("Memory before fold processing:") + monitor_memory() + # ------------------------- TRAIN -------------------------------------- + ckpt_cb = tf.keras.callbacks.ModelCheckpoint( + filepath=os.path.join(run_dir, 'best.weights.h5'), + monitor='val_loss', save_best_only=True, mode='min') + early_cb = tf.keras.callbacks.EarlyStopping( + monitor='val_loss', patience=10, restore_best_weights=True) + + for fold_id, ((train_loader, val_loader), class_weight) in enumerate(zip(folds, class_weights), start=1): + print(f'Training on fold {fold_id}/{len(folds)}') + tf.keras.backend.clear_session() + tf.random.set_seed(42) + np.random.seed(42) + print("########################### seq length: ", longest_peptide_seq_length) + print(f"redefining the model in each fold") + + + model = build_classifier(longest_peptide_seq_length, max_mhc_seq_length) + model.summary() + + # print shapes + for (x_pep, latents), labels in train_loader.take(1): + print(f"Input shapes: x_pep={x_pep.shape}, latents={latents.shape}, labels={labels.shape}") + + print("Training model...") + hist = model.fit( + train_loader, + validation_data=val_loader, + epochs= args.epochs, + class_weight=class_weight, + callbacks=[ckpt_cb, early_cb], + verbose=1, + ) + + + # Gradient Tape method + # optimizer = tf.keras.optimizers.Adam() + # loss_fn = tf.keras.losses.BinaryCrossentropy( + # from_logits=False) # Use from_logits=False if your model has a sigmoid output + # + # best_val_loss = float('inf') + # patience_counter = 0 + # best_weights = None + # + # for epoch in range(args.epochs): + # print(f"Epoch {epoch + 1}/{args.epochs}") + # + # # Training loop + # train_loss = 0.0 + # train_batches = 0 + # for (x_pep, latents), labels in train_loader: + # with tf.GradientTape() as tape: + # predictions = model([x_pep, latents], training=True) + # # Apply class weights manually + # sample_weights = tf.where(tf.equal(labels, 1), + # class_weight[1], + # class_weight[0]) + # loss_value = loss_fn(labels, predictions, sample_weight=sample_weights) + # + # gradients = tape.gradient(loss_value, model.trainable_variables) + # optimizer.apply_gradients(zip(gradients, model.trainable_variables)) + # + # train_loss += loss_value + # train_batches += 1 + # + # avg_train_loss = train_loss / train_batches + # + # # Validation loop + # val_loss = 0.0 + # val_batches = 0 + # for (x_pep, latents), labels in val_loader: + # predictions = model([x_pep, latents], training=False) + # val_loss += loss_fn(labels, predictions) + # val_batches += 1 + # + # avg_val_loss = val_loss / val_batches + # + # # Print metrics + # print(f"Training loss: {avg_train_loss:.4f}, Validation loss: {avg_val_loss:.4f}") + # + # # Implement early stopping and model checkpoint + # if avg_val_loss < best_val_loss: + # best_val_loss = avg_val_loss + # best_weights = model.get_weights() + # patience_counter = 0 + # # Save checkpoint + # model.save_weights(os.path.join(run_dir, 'best.weights.h5')) + # print(f"✓ Saved best weights (val_loss: {best_val_loss:.4f})") + # else: + # patience_counter += 1 + # if patience_counter >= 10: # Match early_cb patience + # print(f"Early stopping triggered after {epoch + 1} epochs") + # break + # + # # Restore best weights + # if best_weights is not None: + # model.set_weights(best_weights) + # + # # Create history object with metrics for compatibility with other code + # hist = type('obj', (object,), { + # 'history': { + # 'loss': [0], # Placeholder + # 'val_loss': [best_val_loss] + # } + # }) + ###################### + + # plot + plot_training_curve(hist, run_dir, fold_id, model, val_loader) + + # save model and metadata + model.save(os.path.join(run_dir, f'model_fold_{fold_id}.weights.h5')) + metadata = { + "fold_id": fold_id, + "epochs": args.epochs, + "batch_size": args.batch, + "seq_len": longest_peptide_seq_length, + "run_dir": run_dir + } + with open(os.path.join(run_dir, f'metadata_fold_{fold_id}.json'), 'w') as f: + json.dump(metadata, f, indent=4) + print(f"✓ Fold {fold_id} model saved to {run_dir}") + + # Evaluate on test sets + print("Evaluating on test1 set...") + + for (x_pep, latents), labels in test1_ds.take(1): + print(f"Test1 Input shapes: x_pep={x_pep.shape}, latents={latents.shape}, labels={labels.shape}") + + test1_results = model.evaluate(test1_ds, verbose=1) + print(f"Test1 results: {test1_results}") + print("Evaluating on test2 set...") + + # Plot ROC curve for test1 + plot_test_metrics(model, test1_ds, run_dir, fold_id, string="Test1 - balanced alleles") + + for (x_pep, latents), labels in test2_ds.take(1): + print(x_pep.shape, latents.shape, labels.shape) + + test2_results = model.evaluate(test2_ds, verbose=1) + print(f"Test2 results: {test2_results}") + + # Plot ROC curve for test2 + plot_test_metrics(model, test2_ds, run_dir, fold_id, string="Test2 - rare alleles") + + # Aggressive cleanup + del model, hist, train_loader, val_loader + + +if __name__ == "__main__": + BUFFER = 2048 + main([ + "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_1", + "--epochs", "3", "--batch", "128", "--test_batches", "200", + ]) \ No newline at end of file From 73c32801f15b134faa4a960e59da812ef3f00387 Mon Sep 17 00:00:00 2001 From: Amirreza Aleyasin Date: Tue, 10 Jun 2025 16:48:55 +0200 Subject: [PATCH 73/83] updated --- utils/run_pMHC_DL_ESM2.py | 882 +++++++++++++++++++++----------------- utils/run_pMHC_DL_ESM3.py | 839 +++++++++++++++++------------------- 2 files changed, 900 insertions(+), 821 deletions(-) diff --git a/utils/run_pMHC_DL_ESM2.py b/utils/run_pMHC_DL_ESM2.py index a8855ddc0..c75353cae 100644 --- a/utils/run_pMHC_DL_ESM2.py +++ b/utils/run_pMHC_DL_ESM2.py @@ -2,83 +2,143 @@ """ ========================= -End‑to‑end trainer for a **peptide×MHC cross‑attention classifier**. -It loads a NetMHCpan‑style parquet that contains +MEMORY-OPTIMIZED End‑to‑end trainer for a **peptide×MHC cross‑attention classifier**. +Loads NetMHCpan‑style parquet files in true streaming fashion without loading entire datasets into memory. - long_mer, assigned_label, allele, MHC_class, - mhc_embedding **OR** mhc_embedding_path +Key improvements: +1. Streaming parquet reading with configurable batch sizes +2. Lazy evaluation of dataset properties (seq length, class balance) +3. Memory-efficient TensorFlow data pipelines +4. Proper cleanup and memory monitoring -columns. Each row supplies +Author: Amirreza (memory-optimized version, 2025) +""" +from __future__ import annotations +import os +import sys -* a peptide sequence (long_mer) -* a pre‑computed MHC pseudo‑sequence embedding (36, 1152) -* a binary label (assigned_label) +print(sys.executable) +# ============================================================================= +# CRITICAL: GPU Memory Configuration - MUST BE FIRST +# ============================================================================= +import tensorflow as tf -The script -1.Derives the longest peptide length → SEQ_LEN. -2.Converts every peptide into a 21‑dim one‑hot tensor (SEQ_LEN, 21). -3.Feeds the pair +def configure_gpu_memory(): + """Configure TensorFlow to use GPU memory efficiently""" + try: + gpus = tf.config.experimental.list_physical_devices('GPU') + if gpus: + print(f"Found {len(gpus)} GPU(s)") + for gpu in gpus: + tf.config.experimental.set_memory_growth(gpu, True) + print("✓ GPU memory growth enabled") + else: + print("No GPUs found - running on CPU") + except RuntimeError as e: + print(f"GPU configuration error: {e}") - (one_hot_peptide, mhc_latent) → classifier → P(binding) -4.Trains with binary‑cross‑entropy and saves the best weights & metadata. +# Configure GPU immediately +configure_gpu_memory() -Author : Amirreza (updated for cross‑attention, 2025‑05‑22) -""" -from __future__ import annotations - -import math -import os, sys, argparse, datetime, pathlib, json -from random import random +# --------------------------------------------------------------------- +# ► Use all logical CPU cores for TF ops that still run on CPU +# --------------------------------------------------------------------- +NUM_CPUS = os.cpu_count() or 1 +tf.config.threading.set_intra_op_parallelism_threads(NUM_CPUS) +tf.config.threading.set_inter_op_parallelism_threads(NUM_CPUS) +print(f'✓ TF intra/inter-op threads set to {NUM_CPUS}') -print(sys.executable) +# Set memory-friendly environment variables +os.environ['TF_GPU_ALLOCATOR'] = 'cuda_malloc_async' +os.environ['TF_FORCE_GPU_ALLOW_GROWTH'] = 'true' +os.environ["PYTHONHASHSEED"] = "42" +os.environ["TF_DETERMINISTIC_OPS"] = "1" +import math +import argparse, datetime, pathlib, json +import psutil import numpy as np import pandas as pd -import tensorflow as tf import matplotlib.pyplot as plt -from sklearn.model_selection import train_test_split from tqdm import tqdm - from model_archive import build_custom_classifier from sklearn.metrics import ( confusion_matrix, roc_curve, auc, precision_score, recall_score, f1_score, accuracy_score, roc_auc_score ) import seaborn as sns -import os import pyarrow.parquet as pq +import gc +import weakref +import pyarrow as pa, pyarrow.compute as pc +pa.set_cpu_count(os.cpu_count()) + + +# ============================================================================= +# Memory monitoring functions +# ============================================================================= +def monitor_memory(): + """Monitor system memory usage""" + memory = psutil.virtual_memory() + print(f"System RAM: {memory.used / 1e9:.1f}GB / {memory.total / 1e9:.1f}GB ({memory.percent:.1f}% used)") + + try: + from pynvml import nvmlInit, nvmlDeviceGetCount, nvmlDeviceGetHandleByIndex, nvmlDeviceGetMemoryInfo + nvmlInit() + deviceCount = nvmlDeviceGetCount() + for i in range(deviceCount): + handle = nvmlDeviceGetHandleByIndex(i) + info = nvmlDeviceGetMemoryInfo(handle) + print( + f"GPU {i}: {info.used / 1e9:.1f}GB / {info.total / 1e9:.1f}GB ({100 * info.used / info.total:.1f}% used)") + except: + print("GPU memory monitoring not available") + + +def cleanup_memory(): + """Aggressive memory cleanup""" + gc.collect() + try: + tf.keras.backend.clear_session() + except: + pass + + # ---------------------------------------------------------------------------- # 1) Peptide → k‑mer one‑hot *inside* TF graph (GPU/TPU friendly) # ---------------------------------------------------------------------------- pad_token = 20 -AA = tf.constant(list("ACDEFGHIKLMNPQRSTVWY")) -TABLE = tf.lookup.StaticHashTable( - tf.lookup.KeyValueTensorInitializer(AA, tf.range(20, dtype=tf.int32)), - default_value=tf.constant(pad_token, dtype=tf.int32), # UNK / padding -) -def kmer_onehot_tensor(seqs: tf.Tensor, seq_len: int, k: int = 9) -> tf.Tensor: - """Vectorised k‑mer framing + one‑hot with no Python loops.""" - tokens = tf.strings.bytes_split(seqs) # ragged ‹N,L› - idx = TABLE.lookup(tokens.flat_values) - ragged = tf.RaggedTensor.from_row_lengths(idx, tokens.row_lengths()) - idx_pad = ragged.to_tensor(default_value=pad_token, shape=(None, seq_len)) # (N,L) - frames = tf.signal.frame(idx_pad, frame_length=k, frame_step=1, axis=1) # (N,RF,k) - return tf.one_hot(frames, depth=21, dtype=tf.float32) # (N,RF,k,21) +def peptides_to_onehot_kmer_windows(seq, max_seq_len, k=9): + """ + Converts a peptide sequence into a sliding window of k-mers, one-hot encoded. + Output shape: (RF, k, 21), where RF = max_seq_len - k + 1 + """ + AA = "ACDEFGHIKLMNPQRSTVWY" + aa_to_idx = {aa: i for i, aa in enumerate(AA)} + RF = max_seq_len - k + 1 + RFs = np.zeros((RF, k, 21), dtype=np.float32) + for window in range(RF): + if window + k <= len(seq): + kmer = seq[window:window + k] + for i, aa in enumerate(kmer): + idx = aa_to_idx.get(aa, pad_token) + RFs[window, i, idx] = 1.0 + # Pad remaining positions in k-mer if sequence is too short + for i in range(len(kmer), k): + RFs[window, i, pad_token] = 1.0 + else: + # Entire k-mer is padding if out of sequence + RFs[window, :, pad_token] = 1.0 + return np.array(RFs) -# --------------------------------------------------------------------------- -# tf.data convenience wrapper ---------------------------------------------- -# --------------------------------------------------------------------------- def _parquet_rowcount(parquet_path: str | os.PathLike) -> int: return pq.ParquetFile(parquet_path).metadata.num_rows -# --------------------------------------------------------------------------- -# Robust loader for latent embeddings (same as before) -# --------------------------------------------------------------------------- def _read_embedding_file(path: str | os.PathLike) -> np.ndarray: # Try fast numeric path first @@ -95,78 +155,192 @@ def _read_embedding_file(path: str | os.PathLike) -> np.ndarray: return obj["embedding"].astype("float32") raise ValueError(f"Unrecognised embedding file {path}") - # ---------------------------------------------------------------------------- -# 3) Streaming Parquet → tf.data.Dataset (stays in TF tensors the whole time) +# Streaming dataset utilities # ---------------------------------------------------------------------------- +class StreamingParquetReader: + """Memory-efficient streaming parquet reader""" + + def __init__(self, parquet_path: str, batch_size: int = 1000): + self.parquet_path = parquet_path + self.batch_size = batch_size + self._file = None + self._num_rows = None + + def __enter__(self): + self._file = pq.ParquetFile(self.parquet_path) + return self + + def __exit__(self, exc_type, exc_val, exc_tb): + if self._file: + self._file = None + + @property + def num_rows(self): + """Get total number of rows without loading data""" + if self._num_rows is None: + if self._file is None: + with pq.ParquetFile(self.parquet_path) as f: + self._num_rows = f.metadata.num_rows + else: + self._num_rows = self._file.metadata.num_rows + return self._num_rows + + def iter_batches(self): + """Iterate over parquet file in batches""" + if self._file is None: + raise RuntimeError("Reader not opened. Use within 'with' statement.") + + for batch in self._file.iter_batches(batch_size=self.batch_size): + df = batch.to_pandas() + yield df + del df, batch # Explicit cleanup + + def sample_for_metadata(self, n_samples: int = 1000): + """Sample a small portion for metadata extraction""" + with pq.ParquetFile(self.parquet_path) as f: + # Read first batch for metadata + first_batch = next(f.iter_batches(batch_size=min(n_samples, self.num_rows))) + return first_batch.to_pandas() + + +def get_dataset_metadata(parquet_path: str): + """Extract dataset metadata without loading full dataset""" + with StreamingParquetReader(parquet_path) as reader: + sample_df = reader.sample_for_metadata(reader.num_rows) + metadata = { + 'total_rows': reader.num_rows, + 'max_peptide_length': int(sample_df['long_mer'].str.len().max()) if 'long_mer' in sample_df.columns else 0, + 'class_distribution': sample_df[ + 'assigned_label'].value_counts().to_dict() if 'assigned_label' in sample_df.columns else {}, + } -def _load_parquet_rows(parquet_path, seq_len, k=9, test_batches=None): - pq_file = pq.ParquetFile(parquet_path) - batch_counter = 0 - for batch_df in pq_file.iter_batches(batch_size=2048): - if test_batches is not None and batch_counter >= test_batches: - break - df = batch_df.to_pandas() + del sample_df + return metadata + + +def calculate_class_weights(parquet_path: str): + """Calculate class weights from a sample of the dataset""" + with StreamingParquetReader(parquet_path, batch_size=1000) as reader: + label_counts = {0: 0, 1: 0} + for batch_df in reader.iter_batches(): + batch_labels = batch_df['assigned_label'].values + unique, counts = np.unique(batch_labels, return_counts=True) + for label, count in zip(unique, counts): + if label in [0, 1]: + label_counts[int(label)] += count + del batch_df + + # Calculate balanced class weights + total = sum(label_counts.values()) + if total == 0 or label_counts[0] == 0 or label_counts[1] == 0: + return {0: 1.0, 1: 1.0} + + return { + 0: total / (2 * label_counts[0]), + 1: total / (2 * label_counts[1]) + } - peps = tf.constant(df["long_mer"].astype(str).values, dtype=tf.string) - x_pep = kmer_onehot_tensor(peps, seq_len, k) # tf.Tensor on GPU/CPU +# --------------------------------------------------------------------- +# Utility that is executed in worker processes +# (must be top-level so it can be pickled on Windows) +# --------------------------------------------------------------------- +def _row_to_tensor_pack(row_dict: dict, max_pep_seq_len: int, max_mhc_len: int): + """Convert a single row (already in plain-python dict form) into tensors.""" + # --- peptide one-hot ------------------------------------------------ + pep = row_dict["long_mer"].upper()[:max_pep_seq_len] + pep_arr = peptides_to_onehot_kmer_windows( + pep, max_seq_len=max_pep_seq_len, k=9 + ) # shape: (RF, k, 21) + + # --- load MHC embedding -------------------------------------------- + mhc = _read_embedding_file(row_dict["mhc_embedding_path"]) + if mhc.shape[0] != max_mhc_len: # sanity check + raise ValueError(f"MHC length mismatch: {mhc.shape[0]} vs {max_mhc_len}") + + # --- label ---------------------------------------------------------- + label = float(row_dict["assigned_label"]) + return (pep_arr, mhc.astype("float32")), label + +from concurrent.futures import ProcessPoolExecutor +import functools, itertools + +def streaming_data_generator( + parquet_path: str, + max_pep_seq_len: int, + max_mhc_len: int, + batch_size: int = 1000): + """ + Yields *individual* samples, but converts an entire Parquet batch + on multiple CPU cores first. + """ + with StreamingParquetReader(parquet_path, batch_size) as reader, \ + ProcessPoolExecutor(max_workers=os.cpu_count()) as pool: + + # Partial function to avoid re-sending constants + worker_fn = functools.partial( + _row_to_tensor_pack, + max_pep_seq_len=max_pep_seq_len, + max_mhc_len=max_mhc_len, + ) - if "mhc_embedding" in df.columns and df["mhc_embedding"].dtype != object: - latents = tf.constant(np.stack(df["mhc_embedding"]).astype("float32")) - else: - latents = tf.constant(np.stack([_read_embedding_file(p) for p in df["mhc_embedding_path"]])) - - labels = tf.constant(df["assigned_label"].astype("float32").values[:, None]) - batch_counter += 1 - yield (x_pep, latents), labels - - -def make_stream_dataset( - parquet_path: str, - max_pep_seq_len: int, - max_mhc_len: int, - batch: int = 512, - shuffle: bool = True, - k: int = 9, - test_batches: int = None -) -> tf.data.Dataset: - """Replacement for the "path‐like" branch; optimized to avoid caching when using small test_batches.""" - rf = max_pep_seq_len - k + 1 + for batch_df in reader.iter_batches(): + # Convert Arrow table → list[dict] once; avoids pandas overhead + dict_rows = batch_df.to_dict(orient="list") # columns -> python lists + # Re-shape to list[dict(row)] + rows_iter = ( {k: dict_rows[k][i] for k in dict_rows} # row dict + for i in range(len(batch_df)) ) + + # Parallel map; chunksize tuned for large batches + results = pool.map(worker_fn, rows_iter, chunksize=64) + + # Stream each converted sample back to the generator consumer + yield from results # <-- keeps memory footprint tiny + + # explicit clean-up + del batch_df, dict_rows, rows_iter, results + + +def create_streaming_dataset(parquet_path: str, + max_pep_seq_len: int, + max_mhc_len: int, + batch_size: int = 128, + buffer_size: int = 1000, + k: int = 9): + """ + Same semantics as before, but the generator already does parallel + preprocessing. We now ask tf.data to interleave multiple generator + shards in parallel as well. + """ + RF = max_pep_seq_len - k + 1 output_signature = ( ( - tf.TensorSpec(shape=(None, rf, k, 21), dtype=tf.float32), # one-hot peptide tensor - tf.TensorSpec(shape=(None, max_mhc_len, 1152), dtype=tf.float32), # latent embeddings + tf.TensorSpec(shape=(RF, k, 21), dtype=tf.float32), + tf.TensorSpec(shape=(max_mhc_len, 1152), dtype=tf.float32), ), - tf.TensorSpec(shape=(None, 1), dtype=tf.float32), # labels + tf.TensorSpec(shape=(), dtype=tf.float32), ) - # Pass test_batches into generator to limit batches early ds = tf.data.Dataset.from_generator( - lambda: _load_parquet_rows(parquet_path, max_pep_seq_len, k, test_batches), + lambda: streaming_data_generator( + parquet_path, + max_pep_seq_len, + max_mhc_len, + buffer_size), output_signature=output_signature, ) - if shuffle: - ds = ds.shuffle(buffer_size=10 * batch, reshuffle_each_iteration=True) - - # If test_batches is provided, limit dataset and batch after - if test_batches is not None: - return ds.prefetch(tf.data.AUTOTUNE) - - # Batch *after* shuffle so that every epoch gets fresh mixes - return ds.cache().prefetch(tf.data.AUTOTUNE) - -# ---------------------------------------------------------------------------- -# 4) On‑the‑fly 1:1 class balancing without Pandas down‑sampling -# ---------------------------------------------------------------------------- + # ► Parallel interleave gives another speed-up if the Parquet file has + # many row-groups – adjust cycle_length as needed. + ds = ds.interleave( + lambda x, y: tf.data.Dataset.from_tensors((x, y)), + cycle_length=tf.data.AUTOTUNE, + num_parallel_calls=tf.data.AUTOTUNE, + deterministic=False, + ) -def build_balanced_dataset(ds: tf.data.Dataset) -> tf.data.Dataset: - """Wrap a dataset so that every step yields a balanced positive/negative mini‑batch.""" - pos = ds.filter(lambda x, y: tf.reduce_any(tf.equal(y, 1))) - neg = ds.filter(lambda x, y: tf.reduce_any(tf.equal(y, 0))) - balanced = tf.data.experimental.sample_from_datasets([pos, neg], weights=[0.5, 0.5]) - return balanced + return ds # --------------------------------------------------------------------------- # Visualisation utility @@ -174,24 +348,13 @@ def build_balanced_dataset(ds: tf.data.Dataset) -> tf.data.Dataset: def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_id: int = None, model=None, val_dataset=None): - """ - Plot training curves and validation metrics from a Keras history object. - - Args: - history: Keras history object containing training metrics. - run_dir: Directory to save the plot. - fold_id: Optional fold identifier for naming the output file. - model: Optional model to compute confusion matrix and ROC curve. - val_dataset: Optional validation dataset to generate predictions. - - Returns: None - """ + """Plot training curves and validation metrics""" hist = history.history plt.figure(figsize=(21, 6)) plot_name = f"training_curve{'_fold' + str(fold_id) if fold_id is not None else ''}" - # set plot name above all plots - plt.suptitle(f"Training Curves{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", fontsize=16, fontweight='bold') + plt.suptitle(f"Training Curves{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", + fontsize=16, fontweight='bold') # Plot 1: Loss curve plt.subplot(1, 4, 1) @@ -213,18 +376,9 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.title("Binary Accuracy") plt.legend() plt.grid(True, alpha=0.3) - elif "accuracy" in hist and "val_accuracy" in hist: - plt.subplot(1, 4, 2) - plt.plot(hist["accuracy"], label="train acc", linewidth=2) - plt.plot(hist["val_accuracy"], label="val acc", linewidth=2) - plt.xlabel("Epoch") - plt.ylabel("Accuracy") - plt.title("Accuracy") - plt.legend() - plt.grid(True, alpha=0.3) # Plot 3: AUC curve - if "AUC" in hist and "val_auc" in hist: + if "AUC" in hist and "val_AUC" in hist: plt.subplot(1, 4, 3) plt.plot(hist["AUC"], label="train AUC", linewidth=2) plt.plot(hist["val_AUC"], label="val AUC", linewidth=2) @@ -234,100 +388,78 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.legend() plt.grid(True, alpha=0.3) - # Plot 4: Confusion matrix (if model and validation dataset provided) + # Plot 4: Confusion matrix placeholder + plt.subplot(1, 4, 4) if model is not None and val_dataset is not None: - plt.subplot(1, 4, 4) - - # Get predictions - y_pred_proba = model.predict(val_dataset) + # Sample a subset for confusion matrix to avoid memory issues + sample_dataset = val_dataset.take(100) # Take only 100 batches + y_pred_proba = model.predict(sample_dataset, verbose=0) y_pred = (y_pred_proba > 0.5).astype(int) - # Extract true labels y_true = [] - for _, labels in val_dataset: + for _, labels in sample_dataset: y_true.extend(labels.numpy()) y_true = np.array(y_true) - # print ranges of y_true and y_pred - print(f"y_true range: {y_true.min()} to {y_true.max()}") - - print(f"y_pred range: {y_pred.min()} to {y_pred.max()}") - - # Create confusion matrix cm = confusion_matrix(y_true, y_pred) sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', xticklabels=['Negative', 'Positive'], yticklabels=['Negative', 'Positive']) - plt.title('Confusion Matrix') - plt.xlabel('Predicted') - plt.ylabel('Actual') + plt.title('Confusion Matrix (Sample)') else: - # If no model/dataset provided, show a placeholder or additional metric - plt.subplot(1, 4, 4) - plt.text(0.5, 0.5, 'Confusion Matrix\n(Requires model + val_dataset)', + plt.text(0.5, 0.5, 'Confusion Matrix N/A \n(Sample from validation)', ha='center', va='center', transform=plt.gca().transAxes, bbox=dict(boxstyle="round,pad=0.3", facecolor="lightgray")) plt.axis('off') - # Save main plot plt.tight_layout() - out_png = os.path.join(run_dir, f"{plot_name}.png") - - # Create directory if it doesn't exist os.makedirs(run_dir, exist_ok=True) - + out_png = os.path.join(run_dir, f"{plot_name}.png") plt.savefig(out_png, dpi=300, bbox_inches='tight') - plt.show() + plt.close() # Close to free memory print(f"✓ Training curve saved to {out_png}") -def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, history=None, string: str =None): - """ - Plot comprehensive evaluation metrics for a test dataset using a trained model. +def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, + history=None, string: str = None): + """Plot comprehensive evaluation metrics for test dataset""" + print("Generating predictions for test metrics...") - Args: - model: Trained Keras model. - test_dataset: TensorFlow dataset for testing. - run_dir: Directory to save the plot. - fold_id: Optional fold identifier for naming the output file. - history: Optional training history object to display loss/accuracy curves. + # Collect predictions and labels in batches to avoid memory issues + y_true_list = [] + y_pred_proba_list = [] - Returns: Dictionary containing evaluation metrics - """ - # Collect predictions - # Extract true labels - y_true = [] - for _, labels in test_dataset: - y_true.extend(labels.numpy()) - y_true = np.array(y_true).flatten() + for batch_x, batch_y in test_dataset: + batch_pred = model.predict(batch_x, verbose=0) + y_true_list.append(batch_y.numpy()) + y_pred_proba_list.append(batch_pred.flatten()) - print("Generating predictions...") - y_pred_proba = model.predict(test_dataset) - y_pred = (y_pred_proba > 0.5).astype(int).flatten() + y_true = np.concatenate(y_true_list).flatten() + y_pred_proba = np.concatenate(y_pred_proba_list) + y_pred = (y_pred_proba > 0.5).astype(int) # Calculate ROC curve - fpr, tpr, _ = roc_curve(y_true, y_pred_proba.flatten()) + fpr, tpr, _ = roc_curve(y_true, y_pred_proba) roc_auc = auc(fpr, tpr) - # Create a multi-panel figure + # Create evaluation plot plt.figure(figsize=(15, 10)) plt.suptitle(f"{string} Evaluation Metrics{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", fontsize=16, fontweight='bold') - # Panel 1: ROC Curve + # ROC Curve plt.subplot(2, 2, 1) - plt.plot(fpr, tpr, color='darkorange', lw=2, - label=f'ROC curve (AUC = {roc_auc:.4f})') + plt.plot(fpr, tpr, color='darkorange', lw=2, label=f'ROC curve (AUC = {roc_auc:.4f})') plt.plot([0, 1], [0, 1], color='navy', lw=2, linestyle='--', alpha=0.8) plt.xlim([0.0, 1.0]) plt.ylim([0.0, 1.05]) plt.xlabel('False Positive Rate') plt.ylabel('True Positive Rate') - plt.title('Receiver Operating Characteristic (ROC) Curve') + plt.title('ROC Curve') plt.legend(loc="lower right") plt.grid(True, alpha=0.3) - # Panel 2: Confusion Matrix + # Confusion Matrix plt.subplot(2, 2, 2) cm = confusion_matrix(y_true, y_pred) sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', @@ -337,112 +469,62 @@ def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, hi plt.xlabel('Predicted Label') plt.ylabel('True Label') - # Panel 3: Loss curve (if history provided) - if history is not None: - plt.subplot(2, 2, 3) - hist = history.history - plt.plot(hist.get("loss", []), label="train", linewidth=2) - plt.plot(hist.get("val_loss", []), label="val", linewidth=2) - plt.xlabel("Epoch") - plt.ylabel("Loss") - plt.title("BCE Loss") - plt.legend() - plt.grid(True, alpha=0.3) - - # Panel 4: Accuracy curve (if available in history) - plt.subplot(2, 2, 4) - if "binary_accuracy" in hist and "val_binary_accuracy" in hist: - plt.plot(hist["binary_accuracy"], label="train acc", linewidth=2) - plt.plot(hist["val_binary_accuracy"], label="val acc", linewidth=2) - elif "accuracy" in hist and "val_accuracy" in hist: - plt.plot(hist["accuracy"], label="train acc", linewidth=2) - plt.plot(hist["val_accuracy"], label="val acc", linewidth=2) - plt.xlabel("Epoch") - plt.ylabel("Accuracy") - plt.title("Accuracy") - plt.legend() - plt.grid(True, alpha=0.3) - else: - # Panel 3: Test metrics when history not available - plt.subplot(2, 2, 3) - - # Calculate metrics - accuracy = accuracy_score(y_true, y_pred) - precision = precision_score(y_true, y_pred, zero_division=0) - recall = recall_score(y_true, y_pred, zero_division=0) - f1 = f1_score(y_true, y_pred, zero_division=0) - - metrics = { - 'Accuracy': accuracy, - 'Precision': precision, - 'Recall': recall, - 'F1 Score': f1, - 'AUC': roc_auc - } - - # Create a bar chart for metrics - bars = plt.bar(range(len(metrics)), list(metrics.values()), - color=['skyblue', 'lightcoral', 'lightgreen', 'gold', 'orange'], - alpha=0.8, edgecolor='black', linewidth=1) - plt.xticks(range(len(metrics)), list(metrics.keys()), rotation=45, ha='right') - plt.ylim(0, 1.0) - plt.title('Test Set Evaluation Metrics') - plt.ylabel('Score') - plt.grid(True, alpha=0.3, axis='y') - - # Add values on top of bars - for i, (bar, value) in enumerate(zip(bars, metrics.values())): - plt.text(bar.get_x() + bar.get_width() / 2, bar.get_height() + 0.02, - f'{value:.4f}', ha='center', va='bottom', fontweight='bold') - - # Panel 4: Prediction distribution - plt.subplot(2, 2, 4) - plt.hist(y_pred_proba[y_true == 0], bins=30, alpha=0.7, - label='Negative Class', color='red', density=True) - plt.hist(y_pred_proba[y_true == 1], bins=30, alpha=0.7, - label='Positive Class', color='blue', density=True) - plt.axvline(x=0.5, color='black', linestyle='--', linewidth=2, - label='Decision Threshold') - plt.xlabel('Predicted Probability') - plt.ylabel('Density') - plt.title('Prediction Probability Distribution') - plt.legend() - plt.grid(True, alpha=0.3) + # Metrics bar chart + plt.subplot(2, 2, 3) + accuracy = accuracy_score(y_true, y_pred) + precision = precision_score(y_true, y_pred, zero_division=0) + recall = recall_score(y_true, y_pred, zero_division=0) + f1 = f1_score(y_true, y_pred, zero_division=0) + + metrics = {'Accuracy': accuracy, 'Precision': precision, 'Recall': recall, 'F1': f1, 'AUC': roc_auc} + bars = plt.bar(range(len(metrics)), list(metrics.values()), + color=['skyblue', 'lightcoral', 'lightgreen', 'gold', 'orange'], + alpha=0.8, edgecolor='black', linewidth=1) + plt.xticks(range(len(metrics)), list(metrics.keys()), rotation=45, ha='right') + plt.ylim(0, 1.0) + plt.title('Evaluation Metrics') + plt.ylabel('Score') + plt.grid(True, alpha=0.3, axis='y') + + for bar, value in zip(bars, metrics.values()): + plt.text(bar.get_x() + bar.get_width() / 2, bar.get_height() + 0.02, + f'{value:.3f}', ha='center', va='bottom', fontweight='bold') + + # Prediction distribution + plt.subplot(2, 2, 4) + plt.hist(y_pred_proba[y_true == 0], bins=30, alpha=0.7, label='Negative Class', + color='red', density=True) + plt.hist(y_pred_proba[y_true == 1], bins=30, alpha=0.7, label='Positive Class', + color='blue', density=True) + plt.axvline(x=0.5, color='black', linestyle='--', linewidth=2, label='Threshold') + plt.xlabel('Predicted Probability') + plt.ylabel('Density') + plt.title('Prediction Distribution') + plt.legend() + plt.grid(True, alpha=0.3) plt.tight_layout() - - # Create directory if it doesn't exist os.makedirs(run_dir, exist_ok=True) - out_png = os.path.join(run_dir, f"{string}_metrics{'_fold' + str(fold_id) if fold_id is not None else ''}.png") plt.savefig(out_png, dpi=300, bbox_inches='tight') - plt.show() + plt.close() # Close to free memory print(f"✓ Test metrics visualization saved to {out_png}") - # Calculate and return evaluation metrics - metrics_dict = { - 'roc_auc': roc_auc, - 'accuracy': accuracy_score(y_true, y_pred), - 'precision': precision_score(y_true, y_pred, zero_division=0), - 'recall': recall_score(y_true, y_pred, zero_division=0), - 'f1': f1_score(y_true, y_pred, zero_division=0), - 'confusion_matrix': cm.tolist(), - 'fpr': fpr.tolist(), - 'tpr': tpr.tolist() - } - # Print summary print("\n" + "=" * 50) - print("TEST SET EVALUATION SUMMARY") + print("EVALUATION SUMMARY") print("=" * 50) - print(f"Accuracy: {metrics_dict['accuracy']:.4f}") - print(f"Precision: {metrics_dict['precision']:.4f}") - print(f"Recall: {metrics_dict['recall']:.4f}") - print(f"F1 Score: {metrics_dict['f1']:.4f}") - print(f"ROC AUC: {metrics_dict['roc_auc']:.4f}") + print(f"Accuracy: {accuracy:.4f}") + print(f"Precision: {precision:.4f}") + print(f"Recall: {recall:.4f}") + print(f"F1 Score: {f1:.4f}") + print(f"ROC AUC: {roc_auc:.4f}") print("=" * 50) - return metrics_dict + return { + 'roc_auc': roc_auc, 'accuracy': accuracy, 'precision': precision, + 'recall': recall, 'f1': f1, 'confusion_matrix': cm.tolist() + } # --------------------------------------------------------------------------- # Training script @@ -450,18 +532,16 @@ def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, hi def main(argv=None): p = argparse.ArgumentParser() - p.add_argument("--parquet", required=False, - help="Input parquet with peptide, latent, label") - p.add_argument("--dataset_path", default=None, - help="Path to a custom dataset (not parquet)") + p.add_argument("--dataset_path", required=True, + help="Path to the dataset directory") p.add_argument("--epochs", type=int, default=30) p.add_argument("--batch", type=int, default=128) p.add_argument("--outdir", default=None, help="Output dir (default: runs/run_YYYYmmdd-HHMMSS)") - p.add_argument("--val_fraction", type=float, default=0.2, - help="Fraction for train/val split") + p.add_argument("--buffer_size", type=int, default=1000, + help="Buffer size for streaming data loading") p.add_argument("--test_batches", type=int, default=None, - help="Limit to N batches for testing (default: None = use all data)") + help="Number of batches to use for test datasets (default: 30)") args = p.parse_args(argv) @@ -469,151 +549,189 @@ def main(argv=None): pathlib.Path(run_dir).mkdir(parents=True, exist_ok=True) print(f"★ Outputs → {run_dir}\n") - # ----------------------- Load & split ---------------------------------- - # Load test sets - test1 = pd.read_parquet(args.dataset_path + "/test1.parquet") - test2 = pd.read_parquet(args.dataset_path + "/test2.parquet") - esm_files = list(pathlib.Path(args.dataset_path).glob('*esm_embeddings.parquet')) - if not esm_files: - raise FileNotFoundError('No esm embeddings parquet found in dataset_path') - whole_data = pd.read_parquet(str(esm_files[0])) + # Set seeds for reproducibility + tf.random.set_seed(42) + np.random.seed(42) + print("Setting random seeds for reproducibility...") + + print("Initial memory state:") + monitor_memory() - fold_files = sorted([f for f in os.listdir(os.path.join(args.dataset_path, f'folds')) if f.endswith('.parquet')]) + # Extract metadata from datasets without loading them fully + print("Extracting dataset metadata...") + + # Get fold information + fold_dir = os.path.join(args.dataset_path, 'folds') + fold_files = sorted([f for f in os.listdir(fold_dir) if f.endswith('.parquet')]) n_folds = len(fold_files) // 2 - # Find the longest peptide sequence across all datasets - longest_peptide_seq_length = 0 - max_mhc_seq_length = 36 # TODO make dynamic later + # Find maximum peptide length across all datasets + max_peptide_length = 0 + max_mhc_length = 36 # Fixed for now - # Check test datasets - if "long_mer" in test1.columns: - longest_peptide_seq_length = max(longest_peptide_seq_length, int(test1["long_mer"].str.len().max())) + print("Scanning datasets for maximum peptide length...") + all_parquet_files = [ + os.path.join(args.dataset_path, "test1.parquet"), + os.path.join(args.dataset_path, "test2.parquet") + ] - if "long_mer" in test2.columns: - longest_peptide_seq_length = max(longest_peptide_seq_length, int(test2["long_mer"].str.len().max())) - # Check whole dataset - if "long_mer" in whole_data.columns: - longest_peptide_seq_length = max(longest_peptide_seq_length, int(whole_data["long_mer"].str.len().max())) + # Add fold files + for i in range(1, n_folds + 1): + all_parquet_files.extend([ + os.path.join(fold_dir, f'fold_{i}_train.parquet'), + os.path.join(fold_dir, f'fold_{i}_val.parquet') + ]) - # Create fold datasets with consistent sequence length + for pq_file in all_parquet_files: + if os.path.exists(pq_file): + metadata = get_dataset_metadata(pq_file) + max_peptide_length = max(max_peptide_length, metadata['max_peptide_length']) + print( + f" {os.path.basename(pq_file)}: max_len={metadata['max_peptide_length']}, rows={metadata['total_rows']}") + + print(f"✓ Maximum peptide length across all datasets: {max_peptide_length}") + + # Create fold datasets and class weights folds = [] class_weights = [] - # Check all fold files + for i in range(1, n_folds + 1): - train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') - val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') - - train_loader = make_stream_dataset(train_path, max_pep_seq_len=longest_peptide_seq_length, max_mhc_len=max_mhc_seq_length, batch=args.batch, shuffle=True, test_batches=args.test_batches) - val_loader = make_stream_dataset(val_path, max_pep_seq_len=longest_peptide_seq_length, max_mhc_len=max_mhc_seq_length, batch=args.batch, shuffle=False, test_batches=args.test_batches) - - # # 3) Shuffle + cache + repeat + prefetch for infinite, fresh-each-epoch stream - # train_ds = (train_loader - # .shuffle(buffer_size=100_000, reshuffle_each_iteration=True) - # .cache() # or .cache("train.cache") - # .repeat() # infinite - # .prefetch(tf.data.AUTOTUNE)) - # - # # Validation can skip repeat() and caching if you prefer, but prefetch is still good: - # val_ds = (val_loader - # .shuffle(buffer_size=20_000, reshuffle_each_iteration=True) - # .cache() # optional for val - # .prefetch(tf.data.AUTOTUNE)) - - # Calculate class weights for the current fold - train_labels = pd.read_parquet(train_path)["assigned_label"].values.astype(int) - counts = np.bincount(train_labels, minlength=2) - cw = {0: 1.0, 1: 1.0} # Default weights if one class is missing or data is empty - if counts[0] > 0 and counts[1] > 0: # If both classes are present - total = counts.sum() - cw[0] = total / (2 * counts[0]) - cw[1] = total / (2 * counts[1]) - - folds.append((train_loader, val_loader)) + print(f"\nProcessing fold {i}/{n_folds}") + train_path = os.path.join(fold_dir, f'fold_{i}_train.parquet') + val_path = os.path.join(fold_dir, f'fold_{i}_val.parquet') + + # Calculate class weights from training data + print(f" Calculating class weights...") + cw = calculate_class_weights(train_path) + print(f" Class weights: {cw}") + + # Create streaming datasets + train_ds = (create_streaming_dataset(train_path, max_peptide_length, max_mhc_length, + buffer_size=args.buffer_size) + .shuffle(buffer_size=args.buffer_size, reshuffle_each_iteration=True) + .batch(args.batch) + # .take(args.test_batches) # Limit to buffer size for memory efficiency + .prefetch(tf.data.AUTOTUNE)) + + val_ds = (create_streaming_dataset(val_path, max_peptide_length, max_mhc_length, + buffer_size=args.buffer_size) + .batch(args.batch) + # .take(args.test_batches) # Limit to buffer size for memory efficiency + .prefetch(tf.data.AUTOTUNE)) + + folds.append((train_ds, val_ds)) class_weights.append(cw) - # Create test loaders with the same sequence length - test1_loader = make_stream_dataset(args.dataset_path + "/test1.parquet" - , max_pep_seq_len=longest_peptide_seq_length, max_mhc_len=max_mhc_seq_length, batch=128, shuffle=False) - test2_loader = make_stream_dataset(args.dataset_path + "/test2.parquet" - , max_pep_seq_len=longest_peptide_seq_length,max_mhc_len=max_mhc_seq_length, batch=128, shuffle=False) - - print(f"✓ loaded {len(test1):,} test1 samples, " - f"{len(test2):,} test2 samples, " - f"{len(folds)} folds") - - # ----------------------- Model ----------------------------------------- - # clear GPU memory - tf.keras.backend.clear_session() - # set random seeds for reproducibility - os.environ["PYTHONHASHSEED"] = "42" - os.environ["TF_DETERMINISTIC_OPS"] = "1" - tf.random.set_seed(42) - np.random.seed(42) + # Force cleanup + cleanup_memory() + + # Create test datasets + print("Creating test datasets...") + test1_ds = (create_streaming_dataset(os.path.join(args.dataset_path, "test1.parquet"), + max_peptide_length, max_mhc_length, buffer_size=args.buffer_size) + .batch(args.batch) + .prefetch(tf.data.AUTOTUNE)) + + test2_ds = (create_streaming_dataset(os.path.join(args.dataset_path, "test2.parquet"), + max_peptide_length, max_mhc_length, buffer_size=args.buffer_size) + .batch(args.batch) + .prefetch(tf.data.AUTOTUNE)) - # ------------------------- TRAIN -------------------------------------- - ckpt_cb = tf.keras.callbacks.ModelCheckpoint( - filepath=os.path.join(run_dir, 'best_weights.h5'), - monitor='val_loss', save_best_only=True, mode='min') - early_cb = tf.keras.callbacks.EarlyStopping( - monitor='val_loss', patience=10, restore_best_weights=True) + print(f"✓ Created {n_folds} fold datasets and 2 test datasets") + print("Memory after dataset creation:") + monitor_memory() + + # Training loop + print("\n" + "=" * 60) + print("STARTING TRAINING") + print("=" * 60) for fold_id, ((train_loader, val_loader), class_weight) in enumerate(zip(folds, class_weights), start=1): - print(f'Training on fold {fold_id}/{len(folds)}') - tf.keras.backend.clear_session() - tf.random.set_seed(42) - np.random.seed(42) - print("########################### seq length: ", longest_peptide_seq_length) - model = build_custom_classifier(longest_peptide_seq_length, max_mhc_seq_length, pad_token=pad_token) + print(f'\n🔥 Training fold {fold_id}/{n_folds}') + + # Clean up before each fold + cleanup_memory() + + # Build fresh model for each fold + print("Building model...") + model = build_custom_classifier(max_peptide_length, max_mhc_length) model.summary() - # check dimension of the target - if train_loader.element_spec[1].shape[-1] != 1: - raise ValueError("Expected binary labels (shape should be (None, 1))") + # Callbacks + ckpt_cb = tf.keras.callbacks.ModelCheckpoint( + filepath=os.path.join(run_dir, f'best_fold_{fold_id}.weights.h5'), + monitor='val_loss', save_best_only=True, mode='min', verbose=1) + early_cb = tf.keras.callbacks.EarlyStopping( + monitor='val_loss', patience=15, restore_best_weights=True, verbose=1) + + # Verify data shapes + for (x_pep, latents), labels in train_loader.take(1): + print(f"✓ Input shapes: peptide={x_pep.shape}, mhc={latents.shape}, labels={labels.shape}") + break + + print("Memory before training:") + monitor_memory() - print("Training model...") + # Train model + print("🚀 Starting training...") hist = model.fit( train_loader, validation_data=val_loader, - epochs= args.epochs, + epochs=args.epochs, class_weight=class_weight, callbacks=[ckpt_cb, early_cb], verbose=1, ) - # plot + print("Memory after training:") + monitor_memory() + + # Plot training curves plot_training_curve(hist, run_dir, fold_id, model, val_loader) - # save model and metadata - model.save(os.path.join(run_dir, f'model_fold_{fold_id}.h5')) + # Save model and metadata + model.save_weights(os.path.join(run_dir, f'model_fold_{fold_id}.weights.h5')) metadata = { "fold_id": fold_id, "epochs": args.epochs, "batch_size": args.batch, - "seq_len": longest_peptide_seq_length, - "run_dir": run_dir + "max_peptide_length": max_peptide_length, + "max_mhc_length": max_mhc_length, + "class_weights": class_weight, + "run_dir": run_dir, + "mhc_class": MHC_CLASS, } with open(os.path.join(run_dir, f'metadata_fold_{fold_id}.json'), 'w') as f: json.dump(metadata, f, indent=4) - print(f"✓ Fold {fold_id} model saved to {run_dir}") # Evaluate on test sets - print("Evaluating on test1 set...") - test1_results = model.evaluate(test1_loader, verbose=1) - print(f"Test1 results: {test1_results}") + print(f"\n📊 Evaluating fold {fold_id} on test sets...") + + # Test1 evaluation + print("Evaluating on test1 (balanced alleles)...") + plot_test_metrics(model, test1_ds, run_dir, fold_id, string="Test1_balanced_alleles") + + # Test2 evaluation + print("Evaluating on test2 (rare alleles)...") + plot_test_metrics(model, test2_ds, run_dir, fold_id, string="Test2_rare_alleles") - # Plot ROC curve for test1 - plot_test_metrics(model, test1_loader, run_dir, fold_id, string="Test1 - balanced alleles") + print(f"✅ Fold {fold_id} completed successfully") - print("Evaluating on test2 set...") - test2_results = model.evaluate(test2_loader, verbose=1) - print(f"Test2 results: {test2_results}") + # Cleanup + del model, hist + cleanup_memory() - # Plot ROC curve for test2 - plot_test_metrics(model, test2_loader, run_dir, fold_id, string="Test2 - rare alleles") + print("\n🎉 Training completed successfully!") + print(f"📁 All results saved to: {run_dir}") if __name__ == "__main__": + BUFFER = 8192 # Reduced buffer size for memory efficiency + MHC_CLASS = 1 + dataset_path = f"../data/Custom_dataset/NetMHCpan_dataset/mhc_{MHC_CLASS}" main([ - "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_1", - "--epochs", "3", "--batch", "128", "--test_batches", "3" + "--dataset_path", dataset_path, + "--epochs", "10", + "--batch", "8192", + "--buffer_size", "8192", ]) \ No newline at end of file diff --git a/utils/run_pMHC_DL_ESM3.py b/utils/run_pMHC_DL_ESM3.py index e4c683cfd..9abd7cedf 100644 --- a/utils/run_pMHC_DL_ESM3.py +++ b/utils/run_pMHC_DL_ESM3.py @@ -2,29 +2,16 @@ """ ========================= -End‑to‑end trainer for a **peptide×MHC cross‑attention classifier**. -It loads a NetMHCpan‑style parquet that contains +MEMORY-OPTIMIZED End‑to‑end trainer for a **peptide×MHC cross‑attention classifier**. +Loads NetMHCpan‑style parquet files in true streaming fashion without loading entire datasets into memory. - long_mer, assigned_label, allele, MHC_class, - mhc_embedding **OR** mhc_embedding_path +Key improvements: +1. Streaming parquet reading with configurable batch sizes +2. Lazy evaluation of dataset properties (seq length, class balance) +3. Memory-efficient TensorFlow data pipelines +4. Proper cleanup and memory monitoring -columns. Each row supplies - -* a peptide sequence (long_mer) -* a pre‑computed MHC pseudo‑sequence embedding (36, 1152) -* a binary label (assigned_label) - -The script - -1.Derives the longest peptide length → SEQ_LEN. -2.Converts every peptide into a 21‑dim one‑hot tensor (SEQ_LEN, 21). -3.Feeds the pair - - (one_hot_peptide, mhc_latent) → classifier → P(binding) - -4.Trains with binary‑cross‑entropy and saves the best weights & metadata. - -Author : Amirreza (updated for cross‑attention, 2025‑05‑22) +Author: Amirreza (memory-optimized version, 2025) """ from __future__ import annotations import os @@ -37,6 +24,7 @@ # ============================================================================= import tensorflow as tf + def configure_gpu_memory(): """Configure TensorFlow to use GPU memory efficiently""" try: @@ -55,6 +43,14 @@ def configure_gpu_memory(): # Configure GPU immediately configure_gpu_memory() +# --------------------------------------------------------------------- +# ► Use all logical CPU cores for TF ops that still run on CPU +# --------------------------------------------------------------------- +NUM_CPUS = os.cpu_count() or 1 +tf.config.threading.set_intra_op_parallelism_threads(NUM_CPUS) +tf.config.threading.set_inter_op_parallelism_threads(NUM_CPUS) +print(f'✓ TF intra/inter-op threads set to {NUM_CPUS}') + # Set memory-friendly environment variables os.environ['TF_GPU_ALLOCATOR'] = 'cuda_malloc_async' os.environ['TF_FORCE_GPU_ALLOW_GROWTH'] = 'true' @@ -74,8 +70,12 @@ def configure_gpu_memory(): recall_score, f1_score, accuracy_score, roc_auc_score ) import seaborn as sns -import os import pyarrow.parquet as pq +import gc +import weakref +import pyarrow as pa, pyarrow.compute as pc +pa.set_cpu_count(os.cpu_count()) + # ============================================================================= # Memory monitoring functions @@ -86,7 +86,6 @@ def monitor_memory(): print(f"System RAM: {memory.used / 1e9:.1f}GB / {memory.total / 1e9:.1f}GB ({memory.percent:.1f}% used)") try: - # Try to get GPU memory info from pynvml import nvmlInit, nvmlDeviceGetCount, nvmlDeviceGetHandleByIndex, nvmlDeviceGetMemoryInfo nvmlInit() deviceCount = nvmlDeviceGetCount() @@ -99,45 +98,33 @@ def monitor_memory(): print("GPU memory monitoring not available") -def check_memory(): - """Check if memory usage is acceptable""" - memory = psutil.virtual_memory() - if memory.percent > 90: - print(f"⚠️ Critical RAM usage: {memory.percent:.1f}%") - return False - elif memory.percent > 80: - print(f"⚠️ High RAM usage: {memory.percent:.1f}%") - return True +def cleanup_memory(): + """Aggressive memory cleanup""" + gc.collect() + try: + tf.keras.backend.clear_session() + except: + pass + # ---------------------------------------------------------------------------- -# 1) Peptide → k‑mer one‑hot *inside* TF graph (GPU/TPU friendly) +# Peptide encoding utilities # ---------------------------------------------------------------------------- -# pad_token = -2 - AA = "ACDEFGHIKLMNPQRSTVWY" # 20 standard AAs, order fixed AA_TO_IDX = {aa: i for i, aa in enumerate(AA)} UNK_IDX = 20 # index for unknown / padding + def peptides_to_onehot(sequence: str, max_seq_len: int) -> np.ndarray: + """Convert peptide sequence to one-hot encoding""" arr = np.zeros((max_seq_len, 21), dtype=np.float32) for j, aa in enumerate(sequence.upper()[:max_seq_len]): arr[j, AA_TO_IDX.get(aa, UNK_IDX)] = 1.0 - # remaining positions stay zero → acts as padded UNK (index 20) return arr -# --------------------------------------------------------------------------- -# tf.data convenience wrapper ---------------------------------------------- -# --------------------------------------------------------------------------- - -def _parquet_rowcount(parquet_path: str | os.PathLike) -> int: - return pq.ParquetFile(parquet_path).metadata.num_rows - -# --------------------------------------------------------------------------- -# Robust loader for latent embeddings (same as before) -# --------------------------------------------------------------------------- def _read_embedding_file(path: str | os.PathLike) -> np.ndarray: - # Try fast numeric path first + """Robust loader for latent embeddings""" try: arr = np.load(path) if isinstance(arr, np.ndarray) and arr.dtype == np.float32: @@ -153,78 +140,204 @@ def _read_embedding_file(path: str | os.PathLike) -> np.ndarray: # ---------------------------------------------------------------------------- -# 3) Streaming Parquet → tf.data.Dataset (stays in TF tensors the whole time) +# Streaming dataset utilities # ---------------------------------------------------------------------------- +class StreamingParquetReader: + """Memory-efficient streaming parquet reader""" + + def __init__(self, parquet_path: str, batch_size: int = 1000): + self.parquet_path = parquet_path + self.batch_size = batch_size + self._file = None + self._num_rows = None + + def __enter__(self): + self._file = pq.ParquetFile(self.parquet_path) + return self + + def __exit__(self, exc_type, exc_val, exc_tb): + if self._file: + self._file = None + + @property + def num_rows(self): + """Get total number of rows without loading data""" + if self._num_rows is None: + if self._file is None: + with pq.ParquetFile(self.parquet_path) as f: + self._num_rows = f.metadata.num_rows + else: + self._num_rows = self._file.metadata.num_rows + return self._num_rows + + def iter_batches(self): + """Iterate over parquet file in batches""" + if self._file is None: + raise RuntimeError("Reader not opened. Use within 'with' statement.") + + for batch in self._file.iter_batches(batch_size=self.batch_size): + df = batch.to_pandas() + yield df + del df, batch # Explicit cleanup + + def sample_for_metadata(self, n_samples: int = 1000): + """Sample a small portion for metadata extraction""" + with pq.ParquetFile(self.parquet_path) as f: + # Read first batch for metadata + first_batch = next(f.iter_batches(batch_size=min(n_samples, self.num_rows))) + return first_batch.to_pandas() + + +def get_dataset_metadata(parquet_path: str): + """Extract dataset metadata without loading full dataset""" + with StreamingParquetReader(parquet_path) as reader: + sample_df = reader.sample_for_metadata(reader.num_rows) + metadata = { + 'total_rows': reader.num_rows, + 'max_peptide_length': int(sample_df['long_mer'].str.len().max()) if 'long_mer' in sample_df.columns else 0, + 'class_distribution': sample_df[ + 'assigned_label'].value_counts().to_dict() if 'assigned_label' in sample_df.columns else {}, + } -def _load_parquet_samples(parquet_path, seq_len): - pq_file = pq.ParquetFile(parquet_path) - for batch_df in pq_file.iter_batches(batch_size=BUFFER): - df = batch_df.to_pandas() - for _, row in df.iterrows(): - # Convert peptide sequence to one-hot encoding - one_hot_peptide = peptides_to_onehot(row["long_mer"], seq_len) + del sample_df + return metadata + + +def calculate_class_weights(parquet_path: str): + """Calculate class weights from a sample of the dataset""" + with StreamingParquetReader(parquet_path, batch_size=1000) as reader: + label_counts = {0: 0, 1: 0} + for batch_df in reader.iter_batches(): + batch_labels = batch_df['assigned_label'].values + unique, counts = np.unique(batch_labels, return_counts=True) + for label, count in zip(unique, counts): + if label in [0, 1]: + label_counts[int(label)] += count + del batch_df + + # Calculate balanced class weights + total = sum(label_counts.values()) + if total == 0 or label_counts[0] == 0 or label_counts[1] == 0: + return {0: 1.0, 1: 1.0} + + return { + 0: total / (2 * label_counts[0]), + 1: total / (2 * label_counts[1]) + } - # Load MHC embedding - mhc_embedding = _read_embedding_file(row["mhc_embedding_path"]) - # Ensure MHC embedding is a numpy array - if not isinstance(mhc_embedding, np.ndarray): - raise ValueError(f"Expected MHC embedding to be a numpy array, got {type(mhc_embedding)}") +# --------------------------------------------------------------------- +# Utility that is executed in worker processes +# (must be top-level so it can be pickled on Windows) +# --------------------------------------------------------------------- +def _row_to_tensor_pack(row_dict: dict, max_pep_seq_len: int, max_mhc_len: int): + """Convert a single row (already in plain-python dict form) into tensors.""" + # --- peptide one-hot ------------------------------------------------ + pep = row_dict["long_mer"].upper()[:max_pep_seq_len] + pep_arr = np.zeros((max_pep_seq_len, 21), dtype=np.float32) + for j, aa in enumerate(pep): + pep_arr[j, AA_TO_IDX.get(aa, UNK_IDX)] = 1.0 - # Yield the sample as a tuple - yield (one_hot_peptide, mhc_embedding), int(row["assigned_label"]) + # --- load MHC embedding -------------------------------------------- + mhc = _read_embedding_file(row_dict["mhc_embedding_path"]) + if mhc.shape[0] != max_mhc_len: # sanity check + raise ValueError(f"MHC length mismatch: {mhc.shape[0]} vs {max_mhc_len}") + # --- label ---------------------------------------------------------- + label = float(row_dict["assigned_label"]) + return (pep_arr, mhc.astype("float32")), label +from concurrent.futures import ProcessPoolExecutor +import functools, itertools -def make_stream_dataset( +def streaming_data_generator( parquet_path: str, max_pep_seq_len: int, max_mhc_len: int, - k: int = 9, -) -> tf.data.Dataset: + batch_size: int = 1000): """ - FIXED: Memory-optimized dataset creation with proper batching. + Yields *individual* samples, but converts an entire Parquet batch + on multiple CPU cores first. """ + with StreamingParquetReader(parquet_path, batch_size) as reader, \ + ProcessPoolExecutor(max_workers=os.cpu_count()) as pool: + + # Partial function to avoid re-sending constants + worker_fn = functools.partial( + _row_to_tensor_pack, + max_pep_seq_len=max_pep_seq_len, + max_mhc_len=max_mhc_len, + ) + + for batch_df in reader.iter_batches(): + # Convert Arrow table → list[dict] once; avoids pandas overhead + dict_rows = batch_df.to_dict(orient="list") # columns -> python lists + # Re-shape to list[dict(row)] + rows_iter = ( {k: dict_rows[k][i] for k in dict_rows} # row dict + for i in range(len(batch_df)) ) - # Output signature for individual samples (no batch dimension) + # Parallel map; chunksize tuned for large batches + results = pool.map(worker_fn, rows_iter, chunksize=64) + + # Stream each converted sample back to the generator consumer + yield from results # <-- keeps memory footprint tiny + + # explicit clean-up + del batch_df, dict_rows, rows_iter, results + + +def create_streaming_dataset(parquet_path: str, + max_pep_seq_len: int, + max_mhc_len: int, + batch_size: int = 128, + buffer_size: int = 1000): + """ + Same semantics as before, but the generator already does parallel + preprocessing. We now ask tf.data to interleave multiple generator + shards in parallel as well. + """ output_signature = ( ( - tf.TensorSpec(shape=(max_pep_seq_len, 21), dtype=tf.float32), # No batch dim - tf.TensorSpec(shape=(max_mhc_len, 1152), dtype=tf.float32), # No batch dim + tf.TensorSpec(shape=(max_pep_seq_len, 21), dtype=tf.float32), + tf.TensorSpec(shape=(max_mhc_len, 1152), dtype=tf.float32), ), - tf.TensorSpec(shape=(), dtype=tf.float32), # Scalar label + tf.TensorSpec(shape=(), dtype=tf.float32), ) + ds = tf.data.Dataset.from_generator( - lambda: _load_parquet_samples(parquet_path, max_pep_seq_len), + lambda: streaming_data_generator( + parquet_path, + max_pep_seq_len, + max_mhc_len, + buffer_size), output_signature=output_signature, ) + + # ► Parallel interleave gives another speed-up if the Parquet file has + # many row-groups – adjust cycle_length as needed. + ds = ds.interleave( + lambda x, y: tf.data.Dataset.from_tensors((x, y)), + cycle_length=tf.data.AUTOTUNE, + num_parallel_calls=tf.data.AUTOTUNE, + deterministic=False, + ) + return ds -# --------------------------------------------------------------------------- -# Visualisation utility -# --------------------------------------------------------------------------- +# ---------------------------------------------------------------------------- +# Visualization utilities (keeping the same as original) +# ---------------------------------------------------------------------------- def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_id: int = None, model=None, val_dataset=None): - """ - Plot training curves and validation metrics from a Keras history object. - - Args: - history: Keras history object containing training metrics. - run_dir: Directory to save the plot. - fold_id: Optional fold identifier for naming the output file. - model: Optional model to compute confusion matrix and ROC curve. - val_dataset: Optional validation dataset to generate predictions. - - Returns: None - """ + """Plot training curves and validation metrics""" hist = history.history plt.figure(figsize=(21, 6)) plot_name = f"training_curve{'_fold' + str(fold_id) if fold_id is not None else ''}" - # set plot name above all plots - plt.suptitle(f"Training Curves{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", fontsize=16, fontweight='bold') + plt.suptitle(f"Training Curves{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", + fontsize=16, fontweight='bold') # Plot 1: Loss curve plt.subplot(1, 4, 1) @@ -236,16 +349,6 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.legend() plt.grid(True, alpha=0.3) - # Plot 2: Precision - Recall curve - # if "Precision" in hist and "Recall" in hist: - # plt.subplot(1, 4, 2) - # plt.plot(hist["Recall"], hist["Precision"], label="PR Curve", linewidth=2) - # plt.xlabel("Recall") - # plt.ylabel("Precision") - # plt.title("Precision-Recall Curve") - # plt.legend() - # plt.grid(True, alpha=0.3) - # Plot 2: Accuracy curve if "binary_accuracy" in hist and "val_binary_accuracy" in hist: plt.subplot(1, 4, 2) @@ -256,15 +359,6 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.title("Binary Accuracy") plt.legend() plt.grid(True, alpha=0.3) - elif "accuracy" in hist and "val_accuracy" in hist: - plt.subplot(1, 4, 2) - plt.plot(hist["accuracy"], label="train acc", linewidth=2) - plt.plot(hist["val_accuracy"], label="val acc", linewidth=2) - plt.xlabel("Epoch") - plt.ylabel("Accuracy") - plt.title("Accuracy") - plt.legend() - plt.grid(True, alpha=0.3) # Plot 3: AUC curve if "AUC" in hist and "val_AUC" in hist: @@ -277,103 +371,78 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ plt.legend() plt.grid(True, alpha=0.3) - # Plot 4: Confusion matrix (if model and validation dataset provided) + # Plot 4: Confusion matrix placeholder + plt.subplot(1, 4, 4) if model is not None and val_dataset is not None: - plt.subplot(1, 4, 4) - - # Get predictions - y_pred_proba = model.predict(val_dataset) + # Sample a subset for confusion matrix to avoid memory issues + sample_dataset = val_dataset.take(100) # Take only 100 batches + y_pred_proba = model.predict(sample_dataset, verbose=0) y_pred = (y_pred_proba > 0.5).astype(int) - # Extract true labels y_true = [] - for _, labels in val_dataset: + for _, labels in sample_dataset: y_true.extend(labels.numpy()) y_true = np.array(y_true) - # print ranges of y_true and y_pred - print(f"y_true range: {y_true.min()} to {y_true.max()}") - - print(f"y_pred range: {y_pred.min()} to {y_pred.max()}") - - # Create confusion matrix cm = confusion_matrix(y_true, y_pred) sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', xticklabels=['Negative', 'Positive'], yticklabels=['Negative', 'Positive']) - plt.title('Confusion Matrix') - plt.xlabel('Predicted') - plt.ylabel('Actual') + plt.title('Confusion Matrix (100 Batches)') else: - # If no model/dataset provided, show a placeholder or additional metric - plt.subplot(1, 4, 4) - plt.text(0.5, 0.5, 'Confusion Matrix\n(Requires model + val_dataset)', + plt.text(0.5, 0.5, 'Confusion Matrix N/A \n(Sample from validation)', ha='center', va='center', transform=plt.gca().transAxes, bbox=dict(boxstyle="round,pad=0.3", facecolor="lightgray")) plt.axis('off') - # Save main plot plt.tight_layout() - out_png = os.path.join(run_dir, f"{plot_name}.png") - - # Create directory if it doesn't exist os.makedirs(run_dir, exist_ok=True) - + out_png = os.path.join(run_dir, f"{plot_name}.png") plt.savefig(out_png, dpi=300, bbox_inches='tight') - plt.show() + plt.close() # Close to free memory print(f"✓ Training curve saved to {out_png}") -def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, history=None, string: str =None): - """ - Plot comprehensive evaluation metrics for a test dataset using a trained model. - - Args: - model: Trained Keras model. - test_dataset: TensorFlow dataset for testing. - run_dir: Directory to save the plot. - fold_id: Optional fold identifier for naming the output file. - history: Optional training history object to display loss/accuracy curves. +def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, + history=None, string: str = None): + """Plot comprehensive evaluation metrics for test dataset""" + print("Generating predictions for test metrics...") - Returns: Dictionary containing evaluation metrics - """ - # CORRECTED LOGIC: Extract labels first. - y_true = np.concatenate([labels for _, labels in test_dataset], axis=0).flatten() + # Collect predictions and labels in batches to avoid memory issues + y_true_list = [] + y_pred_proba_list = [] - # Collect predictions - print("Generating predictions...") - y_pred_proba = model.predict(test_dataset) - y_pred = (y_pred_proba > 0.5).astype(int).flatten() + for batch_x, batch_y in test_dataset: + batch_pred = model.predict(batch_x, verbose=0) + y_true_list.append(batch_y.numpy()) + y_pred_proba_list.append(batch_pred.flatten()) - # # Extract true labels - # y_true = [] - # for _, labels in test_dataset: - # y_true.extend(labels.numpy()) - # y_true = np.array(y_true).flatten() + y_true = np.concatenate(y_true_list).flatten() + y_pred_proba = np.concatenate(y_pred_proba_list) + y_pred = (y_pred_proba > 0.5).astype(int) # Calculate ROC curve - fpr, tpr, _ = roc_curve(y_true, y_pred_proba.flatten()) + fpr, tpr, _ = roc_curve(y_true, y_pred_proba) roc_auc = auc(fpr, tpr) - # Create a multi-panel figure + # Create evaluation plot plt.figure(figsize=(15, 10)) plt.suptitle(f"{string} Evaluation Metrics{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", fontsize=16, fontweight='bold') - # Panel 1: ROC Curve + # ROC Curve plt.subplot(2, 2, 1) - plt.plot(fpr, tpr, color='darkorange', lw=2, - label=f'ROC curve (AUC = {roc_auc:.4f})') + plt.plot(fpr, tpr, color='darkorange', lw=2, label=f'ROC curve (AUC = {roc_auc:.4f})') plt.plot([0, 1], [0, 1], color='navy', lw=2, linestyle='--', alpha=0.8) plt.xlim([0.0, 1.0]) plt.ylim([0.0, 1.05]) plt.xlabel('False Positive Rate') plt.ylabel('True Positive Rate') - plt.title('Receiver Operating Characteristic (ROC) Curve') + plt.title('ROC Curve') plt.legend(loc="lower right") plt.grid(True, alpha=0.3) - # Panel 2: Confusion Matrix + # Confusion Matrix plt.subplot(2, 2, 2) cm = confusion_matrix(y_true, y_pred) sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', @@ -383,130 +452,77 @@ def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, hi plt.xlabel('Predicted Label') plt.ylabel('True Label') - # Panel 3: Loss curve (if history provided) - if history is not None: - plt.subplot(2, 2, 3) - hist = history.history - plt.plot(hist.get("loss", []), label="train", linewidth=2) - plt.plot(hist.get("val_loss", []), label="val", linewidth=2) - plt.xlabel("Epoch") - plt.ylabel("Loss") - plt.title("BCE Loss") - plt.legend() - plt.grid(True, alpha=0.3) - - # Panel 4: Accuracy curve (if available in history) - plt.subplot(2, 2, 4) - if "binary_accuracy" in hist and "val_binary_accuracy" in hist: - plt.plot(hist["binary_accuracy"], label="train acc", linewidth=2) - plt.plot(hist["val_binary_accuracy"], label="val acc", linewidth=2) - elif "accuracy" in hist and "val_accuracy" in hist: - plt.plot(hist["accuracy"], label="train acc", linewidth=2) - plt.plot(hist["val_accuracy"], label="val acc", linewidth=2) - plt.xlabel("Epoch") - plt.ylabel("Accuracy") - plt.title("Accuracy") - plt.legend() - plt.grid(True, alpha=0.3) - else: - # Panel 3: Test metrics when history not available - plt.subplot(2, 2, 3) - - # Calculate metrics - accuracy = accuracy_score(y_true, y_pred) - precision = precision_score(y_true, y_pred, zero_division=0) - recall = recall_score(y_true, y_pred, zero_division=0) - f1 = f1_score(y_true, y_pred, zero_division=0) - - metrics = { - 'Accuracy': accuracy, - 'Precision': precision, - 'Recall': recall, - 'F1 Score': f1, - 'AUC': roc_auc - } - - # Create a bar chart for metrics - bars = plt.bar(range(len(metrics)), list(metrics.values()), - color=['skyblue', 'lightcoral', 'lightgreen', 'gold', 'orange'], - alpha=0.8, edgecolor='black', linewidth=1) - plt.xticks(range(len(metrics)), list(metrics.keys()), rotation=45, ha='right') - plt.ylim(0, 1.0) - plt.title('Test Set Evaluation Metrics') - plt.ylabel('Score') - plt.grid(True, alpha=0.3, axis='y') - - # Add values on top of bars - for i, (bar, value) in enumerate(zip(bars, metrics.values())): - plt.text(bar.get_x() + bar.get_width() / 2, bar.get_height() + 0.02, - f'{value:.4f}', ha='center', va='bottom', fontweight='bold') - - # Panel 4: Prediction distribution - plt.subplot(2, 2, 4) - plt.hist(y_pred_proba[y_true == 0], bins=30, alpha=0.7, - label='Negative Class', color='red', density=True) - plt.hist(y_pred_proba[y_true == 1], bins=30, alpha=0.7, - label='Positive Class', color='blue', density=True) - plt.axvline(x=0.5, color='black', linestyle='--', linewidth=2, - label='Decision Threshold') - plt.xlabel('Predicted Probability') - plt.ylabel('Density') - plt.title('Prediction Probability Distribution') - plt.legend() - plt.grid(True, alpha=0.3) + # Metrics bar chart + plt.subplot(2, 2, 3) + accuracy = accuracy_score(y_true, y_pred) + precision = precision_score(y_true, y_pred, zero_division=0) + recall = recall_score(y_true, y_pred, zero_division=0) + f1 = f1_score(y_true, y_pred, zero_division=0) + + metrics = {'Accuracy': accuracy, 'Precision': precision, 'Recall': recall, 'F1': f1, 'AUC': roc_auc} + bars = plt.bar(range(len(metrics)), list(metrics.values()), + color=['skyblue', 'lightcoral', 'lightgreen', 'gold', 'orange'], + alpha=0.8, edgecolor='black', linewidth=1) + plt.xticks(range(len(metrics)), list(metrics.keys()), rotation=45, ha='right') + plt.ylim(0, 1.0) + plt.title('Evaluation Metrics') + plt.ylabel('Score') + plt.grid(True, alpha=0.3, axis='y') + + for bar, value in zip(bars, metrics.values()): + plt.text(bar.get_x() + bar.get_width() / 2, bar.get_height() + 0.02, + f'{value:.3f}', ha='center', va='bottom', fontweight='bold') + + # Prediction distribution + plt.subplot(2, 2, 4) + plt.hist(y_pred_proba[y_true == 0], bins=30, alpha=0.7, label='Negative Class', + color='red', density=True) + plt.hist(y_pred_proba[y_true == 1], bins=30, alpha=0.7, label='Positive Class', + color='blue', density=True) + plt.axvline(x=0.5, color='black', linestyle='--', linewidth=2, label='Threshold') + plt.xlabel('Predicted Probability') + plt.ylabel('Density') + plt.title('Prediction Distribution') + plt.legend() + plt.grid(True, alpha=0.3) plt.tight_layout() - - # Create directory if it doesn't exist os.makedirs(run_dir, exist_ok=True) - out_png = os.path.join(run_dir, f"{string}_metrics{'_fold' + str(fold_id) if fold_id is not None else ''}.png") plt.savefig(out_png, dpi=300, bbox_inches='tight') - plt.show() + plt.close() # Close to free memory print(f"✓ Test metrics visualization saved to {out_png}") - # Calculate and return evaluation metrics - metrics_dict = { - 'roc_auc': roc_auc, - 'accuracy': accuracy_score(y_true, y_pred), - 'precision': precision_score(y_true, y_pred, zero_division=0), - 'recall': recall_score(y_true, y_pred, zero_division=0), - 'f1': f1_score(y_true, y_pred, zero_division=0), - 'confusion_matrix': cm.tolist(), - 'fpr': fpr.tolist(), - 'tpr': tpr.tolist() - } - # Print summary print("\n" + "=" * 50) - print("TEST SET EVALUATION SUMMARY") + print("EVALUATION SUMMARY") print("=" * 50) - print(f"Accuracy: {metrics_dict['accuracy']:.4f}") - print(f"Precision: {metrics_dict['precision']:.4f}") - print(f"Recall: {metrics_dict['recall']:.4f}") - print(f"F1 Score: {metrics_dict['f1']:.4f}") - print(f"ROC AUC: {metrics_dict['roc_auc']:.4f}") + print(f"Accuracy: {accuracy:.4f}") + print(f"Precision: {precision:.4f}") + print(f"Recall: {recall:.4f}") + print(f"F1 Score: {f1:.4f}") + print(f"ROC AUC: {roc_auc:.4f}") print("=" * 50) - return metrics_dict + return { + 'roc_auc': roc_auc, 'accuracy': accuracy, 'precision': precision, + 'recall': recall, 'f1': f1, 'confusion_matrix': cm.tolist() + } -# --------------------------------------------------------------------------- -# Training script -# --------------------------------------------------------------------------- +# ---------------------------------------------------------------------------- +# Main training function +# ---------------------------------------------------------------------------- def main(argv=None): p = argparse.ArgumentParser() - p.add_argument("--parquet", required=False, - help="Input parquet with peptide, latent, label") - p.add_argument("--dataset_path", default=None, - help="Path to a custom dataset (not parquet)") + p.add_argument("--dataset_path", required=True, + help="Path to the dataset directory") p.add_argument("--epochs", type=int, default=30) p.add_argument("--batch", type=int, default=128) p.add_argument("--outdir", default=None, help="Output dir (default: runs/run_YYYYmmdd-HHMMSS)") - p.add_argument("--test_batches", type=int, default=None, - help="Limit to N batches for testing (default: None = use all data)") - p.add_argument("--model_name", default=2) + p.add_argument("--buffer_size", type=int, default=1000, + help="Buffer size for streaming data loading") args = p.parse_args(argv) @@ -519,237 +535,182 @@ def main(argv=None): np.random.seed(42) print("Setting random seeds for reproducibility...") - # ----------------------- Load & split ---------------------------------- - # Find the longest peptide sequence across all datasets - longest_peptide_seq_length = 0 - max_mhc_seq_length = 36 # TODO make dynamic later + print("Initial memory state:") + monitor_memory() - # Load test sets - test1 = pd.read_parquet(args.dataset_path + "/test1.parquet") - test2 = pd.read_parquet(args.dataset_path + "/test2.parquet") - esm_files = list(pathlib.Path(args.dataset_path).glob('*esm_embeddings.parquet')) - if not esm_files: - raise FileNotFoundError('No esm embeddings parquet found in dataset_path') - whole_data = pd.read_parquet(str(esm_files[0])) + # Extract metadata from datasets without loading them fully + print("Extracting dataset metadata...") - fold_files = sorted([f for f in os.listdir(os.path.join(args.dataset_path, f'folds')) if f.endswith('.parquet')]) + # Get fold information + fold_dir = os.path.join(args.dataset_path, 'folds') + fold_files = sorted([f for f in os.listdir(fold_dir) if f.endswith('.parquet')]) n_folds = len(fold_files) // 2 - # Check test datasets - if "long_mer" in test1.columns: - longest_peptide_seq_length = max(longest_peptide_seq_length, int(test1["long_mer"].str.len().max())) + # Find maximum peptide length across all datasets + max_peptide_length = 0 + max_mhc_length = 36 # Fixed for now + + print("Scanning datasets for maximum peptide length...") + all_parquet_files = [ + os.path.join(args.dataset_path, "test1.parquet"), + os.path.join(args.dataset_path, "test2.parquet") + ] + + # Add fold files + for i in range(1, n_folds + 1): + all_parquet_files.extend([ + os.path.join(fold_dir, f'fold_{i}_train.parquet'), + os.path.join(fold_dir, f'fold_{i}_val.parquet') + ]) + + for pq_file in all_parquet_files: + if os.path.exists(pq_file): + metadata = get_dataset_metadata(pq_file) + max_peptide_length = max(max_peptide_length, metadata['max_peptide_length']) + print( + f" {os.path.basename(pq_file)}: max_len={metadata['max_peptide_length']}, rows={metadata['total_rows']}") - if "long_mer" in test2.columns: - longest_peptide_seq_length = max(longest_peptide_seq_length, int(test2["long_mer"].str.len().max())) - # Check whole dataset - if "long_mer" in whole_data.columns: - longest_peptide_seq_length = max(longest_peptide_seq_length, int(whole_data["long_mer"].str.len().max())) + print(f"✓ Maximum peptide length across all datasets: {max_peptide_length}") - # Create fold datasets with consistent sequence length + # Create fold datasets and class weights folds = [] class_weights = [] - for i in range(1, n_folds + 1): - print(f"processing fold {i}") - train_path = os.path.join(args.dataset_path, f'folds/fold_{i}_train.parquet') - val_path = os.path.join(args.dataset_path, f'folds/fold_{i}_val.parquet') - - train_ds = (make_stream_dataset(train_path, max_pep_seq_len=longest_peptide_seq_length, - max_mhc_len=max_mhc_seq_length) - .shuffle(buffer_size=BUFFER, reshuffle_each_iteration=True) - .repeat() - .batch(args.batch) - .take(args.test_batches) - .prefetch(tf.data.AUTOTUNE)) - val_ds = (make_stream_dataset(val_path, max_pep_seq_len=longest_peptide_seq_length, - max_mhc_len=max_mhc_seq_length) + for i in range(1, n_folds + 1): + print(f"\nProcessing fold {i}/{n_folds}") + train_path = os.path.join(fold_dir, f'fold_{i}_train.parquet') + val_path = os.path.join(fold_dir, f'fold_{i}_val.parquet') + + # Calculate class weights from training data + print(f" Calculating class weights...") + cw = calculate_class_weights(train_path) + print(f" Class weights: {cw}") + + # Create streaming datasets + train_ds = (create_streaming_dataset(train_path, max_peptide_length, max_mhc_length, + buffer_size=args.buffer_size) + .shuffle(buffer_size=args.buffer_size, reshuffle_each_iteration=True) .batch(args.batch) - .take(args.test_batches) .prefetch(tf.data.AUTOTUNE)) - # Calculate class weights (unchanged) - train_labels = pd.read_parquet(train_path)["assigned_label"].values.astype(int) - counts = np.bincount(train_labels, minlength=2) - cw = {0: 1.0, 1: 1.0} - if counts[0] > 0 and counts[1] > 0: - total = counts.sum() - cw[0] = total / (2 * counts[0]) - cw[1] = total / (2 * counts[1]) + val_ds = (create_streaming_dataset(val_path, max_peptide_length, max_mhc_length, + buffer_size=args.buffer_size) + .batch(args.batch) + .prefetch(tf.data.AUTOTUNE)) folds.append((train_ds, val_ds)) class_weights.append(cw) - # Test loaders - test1_ds = (make_stream_dataset(os.path.join(args.dataset_path, "test1.parquet"), - longest_peptide_seq_length, max_mhc_seq_length) + # Force cleanup + cleanup_memory() + + # Create test datasets + print("Creating test datasets...") + test1_ds = (create_streaming_dataset(os.path.join(args.dataset_path, "test1.parquet"), + max_peptide_length, max_mhc_length, buffer_size=args.buffer_size) .batch(args.batch) .prefetch(tf.data.AUTOTUNE)) - test2_ds = (make_stream_dataset(os.path.join(args.dataset_path, "test2.parquet"), - longest_peptide_seq_length, max_mhc_seq_length) + test2_ds = (create_streaming_dataset(os.path.join(args.dataset_path, "test2.parquet"), + max_peptide_length, max_mhc_length, buffer_size=args.buffer_size) .batch(args.batch) .prefetch(tf.data.AUTOTUNE)) - print(f"✓ loaded {len(test1):,} test1 samples, " - f"{len(test2):,} test2 samples, " - f"{len(folds)} folds") - - # ----------------------- Model ----------------------------------------- - # clear GPU memory - tf.keras.backend.clear_session() - print("Memory before fold processing:") + print(f"✓ Created {n_folds} fold datasets and 2 test datasets") + print("Memory after dataset creation:") monitor_memory() - # ------------------------- TRAIN -------------------------------------- - ckpt_cb = tf.keras.callbacks.ModelCheckpoint( - filepath=os.path.join(run_dir, 'best.weights.h5'), - monitor='val_loss', save_best_only=True, mode='min') - early_cb = tf.keras.callbacks.EarlyStopping( - monitor='val_loss', patience=10, restore_best_weights=True) + + # Training loop + print("\n" + "=" * 60) + print("STARTING TRAINING") + print("=" * 60) for fold_id, ((train_loader, val_loader), class_weight) in enumerate(zip(folds, class_weights), start=1): - print(f'Training on fold {fold_id}/{len(folds)}') - tf.keras.backend.clear_session() - tf.random.set_seed(42) - np.random.seed(42) - print("########################### seq length: ", longest_peptide_seq_length) - print(f"redefining the model in each fold") + print(f'\n🔥 Training fold {fold_id}/{n_folds}') + # Clean up before each fold + cleanup_memory() - model = build_classifier(longest_peptide_seq_length, max_mhc_seq_length) + # Build fresh model for each fold + print("Building model...") + model = build_classifier(max_peptide_length, max_mhc_length) model.summary() - # print shapes + # Callbacks + ckpt_cb = tf.keras.callbacks.ModelCheckpoint( + filepath=os.path.join(run_dir, f'best_fold_{fold_id}.weights.h5'), + monitor='val_loss', save_best_only=True, mode='min', verbose=1) + early_cb = tf.keras.callbacks.EarlyStopping( + monitor='val_loss', patience=15, restore_best_weights=True, verbose=1) + + # Verify data shapes for (x_pep, latents), labels in train_loader.take(1): - print(f"Input shapes: x_pep={x_pep.shape}, latents={latents.shape}, labels={labels.shape}") + print(f"✓ Input shapes: peptide={x_pep.shape}, mhc={latents.shape}, labels={labels.shape}") + break - print("Training model...") + print("Memory before training:") + monitor_memory() + + # Train model + print("🚀 Starting training...") hist = model.fit( train_loader, validation_data=val_loader, - epochs= args.epochs, + epochs=args.epochs, class_weight=class_weight, callbacks=[ckpt_cb, early_cb], verbose=1, ) + print("Memory after training:") + monitor_memory() - # Gradient Tape method - # optimizer = tf.keras.optimizers.Adam() - # loss_fn = tf.keras.losses.BinaryCrossentropy( - # from_logits=False) # Use from_logits=False if your model has a sigmoid output - # - # best_val_loss = float('inf') - # patience_counter = 0 - # best_weights = None - # - # for epoch in range(args.epochs): - # print(f"Epoch {epoch + 1}/{args.epochs}") - # - # # Training loop - # train_loss = 0.0 - # train_batches = 0 - # for (x_pep, latents), labels in train_loader: - # with tf.GradientTape() as tape: - # predictions = model([x_pep, latents], training=True) - # # Apply class weights manually - # sample_weights = tf.where(tf.equal(labels, 1), - # class_weight[1], - # class_weight[0]) - # loss_value = loss_fn(labels, predictions, sample_weight=sample_weights) - # - # gradients = tape.gradient(loss_value, model.trainable_variables) - # optimizer.apply_gradients(zip(gradients, model.trainable_variables)) - # - # train_loss += loss_value - # train_batches += 1 - # - # avg_train_loss = train_loss / train_batches - # - # # Validation loop - # val_loss = 0.0 - # val_batches = 0 - # for (x_pep, latents), labels in val_loader: - # predictions = model([x_pep, latents], training=False) - # val_loss += loss_fn(labels, predictions) - # val_batches += 1 - # - # avg_val_loss = val_loss / val_batches - # - # # Print metrics - # print(f"Training loss: {avg_train_loss:.4f}, Validation loss: {avg_val_loss:.4f}") - # - # # Implement early stopping and model checkpoint - # if avg_val_loss < best_val_loss: - # best_val_loss = avg_val_loss - # best_weights = model.get_weights() - # patience_counter = 0 - # # Save checkpoint - # model.save_weights(os.path.join(run_dir, 'best.weights.h5')) - # print(f"✓ Saved best weights (val_loss: {best_val_loss:.4f})") - # else: - # patience_counter += 1 - # if patience_counter >= 10: # Match early_cb patience - # print(f"Early stopping triggered after {epoch + 1} epochs") - # break - # - # # Restore best weights - # if best_weights is not None: - # model.set_weights(best_weights) - # - # # Create history object with metrics for compatibility with other code - # hist = type('obj', (object,), { - # 'history': { - # 'loss': [0], # Placeholder - # 'val_loss': [best_val_loss] - # } - # }) - ###################### - - # plot + # Plot training curves plot_training_curve(hist, run_dir, fold_id, model, val_loader) - # save model and metadata - model.save(os.path.join(run_dir, f'model_fold_{fold_id}.weights.h5')) + # Save model and metadata + model.save_weights(os.path.join(run_dir, f'model_fold_{fold_id}.weights.h5')) metadata = { "fold_id": fold_id, "epochs": args.epochs, "batch_size": args.batch, - "seq_len": longest_peptide_seq_length, - "run_dir": run_dir + "max_peptide_length": max_peptide_length, + "max_mhc_length": max_mhc_length, + "class_weights": class_weight, + "run_dir": run_dir, + "mhc_class": MHC_CLASS } with open(os.path.join(run_dir, f'metadata_fold_{fold_id}.json'), 'w') as f: json.dump(metadata, f, indent=4) - print(f"✓ Fold {fold_id} model saved to {run_dir}") # Evaluate on test sets - print("Evaluating on test1 set...") - - for (x_pep, latents), labels in test1_ds.take(1): - print(f"Test1 Input shapes: x_pep={x_pep.shape}, latents={latents.shape}, labels={labels.shape}") - - test1_results = model.evaluate(test1_ds, verbose=1) - print(f"Test1 results: {test1_results}") - print("Evaluating on test2 set...") + print(f"\n📊 Evaluating fold {fold_id} on test sets...") - # Plot ROC curve for test1 - plot_test_metrics(model, test1_ds, run_dir, fold_id, string="Test1 - balanced alleles") + # Test1 evaluation + print("Evaluating on test1 (balanced alleles)...") + plot_test_metrics(model, test1_ds, run_dir, fold_id, string="Test1_balanced_alleles") - for (x_pep, latents), labels in test2_ds.take(1): - print(x_pep.shape, latents.shape, labels.shape) + # Test2 evaluation + print("Evaluating on test2 (rare alleles)...") + plot_test_metrics(model, test2_ds, run_dir, fold_id, string="Test2_rare_alleles") - test2_results = model.evaluate(test2_ds, verbose=1) - print(f"Test2 results: {test2_results}") + print(f"✅ Fold {fold_id} completed successfully") - # Plot ROC curve for test2 - plot_test_metrics(model, test2_ds, run_dir, fold_id, string="Test2 - rare alleles") + # Cleanup + del model, hist + cleanup_memory() - # Aggressive cleanup - del model, hist, train_loader, val_loader + print("\n🎉 Training completed successfully!") + print(f"📁 All results saved to: {run_dir}") if __name__ == "__main__": - BUFFER = 2048 + BUFFER = 8192 # Reduced buffer size for memory efficiency + MHC_CLASS = 1 + dataset_path = f"../data/Custom_dataset/NetMHCpan_dataset/mhc_{MHC_CLASS}" main([ - "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_1", - "--epochs", "3", "--batch", "128", "--test_batches", "200", + "--dataset_path", dataset_path, + "--epochs", "10", + "--batch", "8192", + "--buffer_size", "8192", ]) \ No newline at end of file From d9e16c4a7f7999f962f2353422e1985f6a36ef31 Mon Sep 17 00:00:00 2001 From: Amirreza Aleyasin Date: Wed, 11 Jun 2025 07:16:54 +0200 Subject: [PATCH 74/83] refactor dataset creation and processing functions for ESM-3 compatibility --- utils/create_ESM_dataset.py | 14 ++++++------ utils/processing_functions.py | 43 ++++++++++++++++++----------------- 2 files changed, 29 insertions(+), 28 deletions(-) diff --git a/utils/create_ESM_dataset.py b/utils/create_ESM_dataset.py index a39a536df..0bea18a1a 100644 --- a/utils/create_ESM_dataset.py +++ b/utils/create_ESM_dataset.py @@ -1,10 +1,9 @@ #!/usr/bin/env python """ -requires python3.10+ -Create a parquet dataset that combines NetMHCpan metadata with ESM-2 embeddings -for each MHC-I allele. +Create a parquet dataset that combines metadata with ESM-3 embeddings +for each MHC allele. -Usage: python make_dataset.py +Usage: python create_dataset.py """ import os @@ -21,7 +20,7 @@ # 1. CONFIGURATION – adjust if your paths change # --------------------------------------------------------------------- dataset_name = "NetMHCpan_dataset" -mhc_class = 2 +mhc_class = 1 CSV_PATH = pathlib.Path(f"../data/{dataset_name}/combined_data_{mhc_class}.csv") NPZ_PATH = pathlib.Path( f"../data/ESM/esmc_600m/NetMHCpan pseudoseqs/mhc{mhc_class}_encodings.npz" @@ -36,7 +35,8 @@ f"../data/Custom_dataset/{dataset_name}/mhc_{mhc_class}/mhc{mhc_class}_encodings" ) # or `None` to embed directly -AUGMENTATION = None # "GNUSS", None +AUGMENTATION = "down_sampling" # "GNUSS", None +K = 10 # Number of folds for cross-validation # --------------------------------------------------------------------- @@ -304,7 +304,7 @@ def main() -> None: folds = create_k_fold_leave_one_out_stratified_cv( datasets['train'], target_col="assigned_label", - k=5, + k=K, id_col="allele", augmentation=AUGMENTATION, ) diff --git a/utils/processing_functions.py b/utils/processing_functions.py index 148e73c1d..9ec3d3790 100644 --- a/utils/processing_functions.py +++ b/utils/processing_functions.py @@ -1290,6 +1290,7 @@ def create_k_fold_leave_one_out_stratified_cv( folds = [] for fold_idx, left_out_id in enumerate(left_out_ids, 1): + fold_seed = random_state + fold_idx mask_left_out = df[id_col] == left_out_id working_df = df.loc[~mask_left_out].copy() @@ -1298,7 +1299,7 @@ def create_k_fold_leave_one_out_stratified_cv( # (GroupShuffleSplit with test_size=1 group) # --------------------------------------------------------------- gss = GroupShuffleSplit( - n_splits=1, test_size=1, random_state=42 + n_splits=1, test_size=1, random_state=fold_seed ) (train_groups_idx, val_only_groups_idx), = gss.split( X=np.zeros(len(working_df)), y=None, groups=working_df[id_col] @@ -1313,7 +1314,7 @@ def create_k_fold_leave_one_out_stratified_cv( # 2) stratified split of *eligible* rows # --------------------------------------------------------------- sss = StratifiedShuffleSplit( - n_splits=1, train_size=train_size, random_state=42 + n_splits=1, train_size=train_size, random_state=fold_seed ) train_idx, extra_val_idx = next( sss.split(df_eligible, df_eligible[target_col]) @@ -1328,19 +1329,19 @@ def create_k_fold_leave_one_out_stratified_cv( # --------------------------------------------------------------- # 3) balance train and val via down-sampling # --------------------------------------------------------------- - # def _balance_down_sampling(frame: pd.DataFrame) -> pd.DataFrame: - # min_count = frame[target_col].value_counts().min() - # print(f"Balancing {len(frame)} rows to {min_count} per class") - # balanced_parts = [ - # resample( - # frame[frame[target_col] == lbl], - # replace=False, - # n_samples=min_count, - # random_state=rng, - # ) - # for lbl in frame[target_col].unique() - # ] - # return pd.concat(balanced_parts, ignore_index=True) + def _balance_down_sampling(frame: pd.DataFrame) -> pd.DataFrame: + min_count = frame[target_col].value_counts().min() + print(f"Balancing {len(frame)} rows to {min_count} per class") + balanced_parts = [ + resample( + frame[frame[target_col] == lbl], + replace=False, + n_samples=min_count, + random_state=fold_seed, + ) + for lbl in frame[target_col].unique() + ] + return pd.concat(balanced_parts, ignore_index=True) def _balance_GNUSS(frame: pd.DataFrame) -> pd.DataFrame: """ @@ -1360,7 +1361,7 @@ def _balance_GNUSS(frame: pd.DataFrame) -> pd.DataFrame: if count < max_count: # Upsample with replacement n_needed = max_count - count - sampled = df_label.sample(n=n_needed, replace=True, random_state=rng) + sampled = df_label.sample(n=n_needed, replace=True, random_state=fold_seed) # Add Gaussian noise to numeric features noise = pd.DataFrame( rng.normal(loc=0, scale=1e-6, size=(n_needed, len(numeric_cols))), @@ -1376,9 +1377,9 @@ def _balance_GNUSS(frame: pd.DataFrame) -> pd.DataFrame: if augmentation == "GNUSS": df_train_bal = _balance_GNUSS(df_train) df_val_bal = _balance_GNUSS(df_val) - # elif augmentation == "down_sampling": # default to down-sampling - # df_train_bal = _balance_down_sampling(df_train) - # df_val_bal = _balance_down_sampling(df_val) + elif augmentation == "down_sampling": # default to down-sampling + df_train_bal = _balance_down_sampling(df_train) + df_val_bal = _balance_down_sampling(df_val) elif not augmentation: df_train_bal = df_train.copy() df_val_bal = df_val.copy() @@ -1387,8 +1388,8 @@ def _balance_GNUSS(frame: pd.DataFrame) -> pd.DataFrame: raise ValueError(f"Unknown augmentation method: {augmentation}") # Shuffle both datasets to avoid any ordering bias - df_train_bal = df_train_bal.sample(frac=1.0, random_state=rng).reset_index(drop=True) - df_val_bal = df_val_bal.sample(frac=1.0, random_state=rng).reset_index(drop=True) + df_train_bal = df_train_bal.sample(frac=1.0, random_state=fold_seed).reset_index(drop=True) + df_val_bal = df_val_bal.sample(frac=1.0, random_state=fold_seed).reset_index(drop=True) folds.append((df_train_bal, df_val_bal, left_out_id)) print( From 3f96be6f26e92880b2724cc5ad7289e84564fa5e Mon Sep 17 00:00:00 2001 From: Amirreza Aleyasin Date: Tue, 24 Jun 2025 17:11:13 +0200 Subject: [PATCH 75/83] update model parameters and add new training scripts for memory optimization --- src/model3.py | 214 ++++++++ src/model4_recon.py | 258 ++++++++++ src/run_model3.py | 758 +++++++++++++++++++++++++++ src/run_model4_recon.py | 767 ++++++++++++++++++++++++++++ src/run_pMHC_DL_ESM.py | 2 +- utils/create_ESM_dataset.py | 2 +- utils/model_archive.py | 75 +++ utils/visualize_tensorflow_model.py | 2 +- 8 files changed, 2075 insertions(+), 3 deletions(-) create mode 100644 src/model3.py create mode 100644 src/model4_recon.py create mode 100644 src/run_model3.py create mode 100644 src/run_model4_recon.py diff --git a/src/model3.py b/src/model3.py new file mode 100644 index 000000000..1f9d5865e --- /dev/null +++ b/src/model3.py @@ -0,0 +1,214 @@ +#!/usr/bin/env python +""" +pepmhc_cross_attention.py +------------------------- + +Minimal end-to-end demo of a peptide × MHC cross-attention classifier +with explainable attention visualisation. + +Author: 2025-05-22 +""" + +import numpy as np +import tensorflow as tf +from tensorflow import keras +from tensorflow.keras import layers +import matplotlib.pyplot as plt +import seaborn as sns + +# -------------------------------------------------------------------------------- +# 1. Synthetic toy-data helpers +# -------------------------------------------------------------------------------- +AA = "ACDEFGHIKLMNPQRSTVWY" +AA_TO_INT = {a:i for i,a in enumerate(AA)} +UNK = 20 # index for “unknown” + +def onehot(seq: str, max_len: int) -> np.ndarray: + """Return (max_len,21) one-hot matrix.""" + mat = np.zeros((max_len, 21), dtype=np.float32) + for i, aa in enumerate(seq[:max_len]): + mat[i, AA_TO_INT.get(aa, UNK)] = 1.0 + return mat + +# def toy_batch(batch_size=32, +# pep_max=14, +# mhc_max=36, +# mhc_dim=1152): +# """Synthetic (peptide, mhc, label) batch.""" +# peps, mhcs, labels = [], [], [] +# for _ in range(batch_size): +# # random peptide ----------------------------------------------------- +# Lp = np.random.randint(8, pep_max+1) +# pep = ''.join(np.random.choice(list(AA), Lp)) +# peps.append(onehot(pep, pep_max)) # (pep_max,21) +# +# # random MHC latent -------------------------------------------------- +# Lm = np.random.randint(20, mhc_max+1) +# mhc_lat = np.random.randn(Lm, mhc_dim).astype(np.float32) +# pad_mhc = np.zeros((mhc_max, mhc_dim), dtype=np.float32) +# pad_mhc[:Lm] = mhc_lat +# mhcs.append(pad_mhc) # (mhc_max,1152) +# +# # RANDOM label (replace by real NetMHCpan label in practice) --------- +# labels.append([np.random.randint(0,2)]) +# +# return (np.stack(peps), np.stack(mhcs), np.asarray(labels, np.float32)) + + +# -------------------------------------------------------------------------------- +# 2. Model building block: cross-attention with score output +# -------------------------------------------------------------------------------- +""" +model.py – light-weight peptide × MHC cross-attention classifier + plus twin model that exposes the attention matrix + for explainability. + +The only public symbol is + build_classifier(max_pep_len, max_mhc_len, …) +which returns + clf_model, att_model +""" +import tensorflow as tf +from tensorflow import keras +from tensorflow.keras import layers +import numpy as np + +# --------------------------------------------------------------------- +# helpers +# --------------------------------------------------------------------- +def cross_att_block(query, # (B,pep_len,D) + context, # (B,mhc_len,D) + heads=8, + name="xatt"): + """ + Keras MultiHeadAttention; returns (att_out, att_scores) + Shapes: + att_out (B, pep_len, D) + att_scores (B, heads, pep_len, mhc_len) + """ + mha = layers.MultiHeadAttention(num_heads=heads, + key_dim=query.shape[-1], + name=name) + + att_out, att_scores = mha(query=query, + value=context, + key=context, + return_attention_scores=True) + return att_out, att_scores + + +# --------------------------------------------------------------------- +# main builder +# --------------------------------------------------------------------- +def build_classifier(max_pep_len : int, + max_mhc_len : int, + pep_emb_dim : int = 64, + mhc_emb_dim : int = 64, + mhc_latent_dim : int = 1152, + heads : int = 8): + """ + Returns + clf_model – compiled model for training / inference + att_model – same weights, outputs attention scores only + """ + # Inputs ----------------------------------------------------------- + inp_pep = keras.Input(shape=(max_pep_len, 21), name="pep_onehot") + inp_mhc = keras.Input(shape=(max_mhc_len,1152), name="mhc_latent") + + # Linear projections ---------------------------------------------- + pep_emb = layers.Dense(pep_emb_dim, activation=None, + name="pep_proj")(inp_pep) # (B,pep_len,D) + mhc_emb = layers.Dense(mhc_emb_dim, activation=None, + name="mhc_proj")(inp_mhc) # (B,mhc_len,D) + + # Positional encoding (simple learned) ---------------------------- + pep_pos = layers.Embedding(input_dim=max_pep_len, + output_dim=pep_emb_dim, + name="pep_pos_emb")(tf.range(max_pep_len)) + mhc_pos = layers.Embedding(input_dim=max_mhc_len, + output_dim=mhc_emb_dim, + name="mhc_pos_emb")(tf.range(max_mhc_len)) + pep_emb = pep_emb + pep_pos + mhc_emb = mhc_emb + mhc_pos + + # Dense layer to reduce dimension of mhc_emb + mhc_emb = layers.Dense(mhc_emb_dim, activation=None, + name="mhc_dim_reduction")(mhc_emb) # (B,mhc_len,D) + + # Cross-attention -------------------------------------------------- + att_pep, att_scores = cross_att_block(pep_emb, mhc_emb, + heads=heads, name="pep2mhc") + + # Pool & classifier ----------------------------------------------- + pooled = layers.GlobalAveragePooling1D()(att_pep) + x = layers.Dense(32, activation="relu")(pooled) + out = layers.Dense(1, activation="sigmoid", name="prob")(x) + + clf_model = keras.Model([inp_pep, inp_mhc], out, name="PepMHC_clf") + clf_model.compile(optimizer="adam", + loss="binary_crossentropy", + metrics=["binary_accuracy","AUC"]) + + # attention twin --------------------------------------------------- + att_model = keras.Model([inp_pep, inp_mhc], att_scores, + name="PepMHC_attention") + + return clf_model, att_model + + +# -------------------------------------------------------------------------------- +# 4. Demo run (synthetic data, 2 epochs, heat map) +# -------------------------------------------------------------------------------- +# if __name__ == "__main__": +# tf.random.set_seed(0); np.random.seed(0) +# +# PEP_MAX = 14 +# MHC_MAX = 36 +# BATCH = 64 +# STEPS = 4 # keep tiny for a quick sanity run +# +# model, att_model = build_classifier(max_pep_len=PEP_MAX, max_mhc_len=MHC_MAX) +# +# print(model.summary(line_length=110)) +# +# # quick dummy training -------------------------------------------------- +# for step in range(STEPS): +# Xp, Xm, y = toy_batch(BATCH, pep_max=PEP_MAX, mhc_max=MHC_MAX) +# model.train_on_batch([Xp,Xm], y) +# +# # one inference batch & attention --------------------------------------- +# Xp_test, Xm_test, y_test = toy_batch(8, pep_max=PEP_MAX, mhc_max=MHC_MAX) +# preds = model.predict([Xp_test, Xm_test]) +# att_scores = att_model.predict([Xp_test, Xm_test]) # (B,heads,pep_len,mhc_len) +# +# print("\nPredictions:", preds.squeeze().round(3)) +# +# # -------------------------------------------------------------------------------- +# # 5. visualise attention for the first sample (average over heads) +# # -------------------------------------------------------------------------------- +# sample = 0 +# A = att_scores[sample] # (heads,pep_len,mhc_len) +# A_mean = A.mean(axis=0) # (pep_len,mhc_len) +# +# plt.figure(figsize=(8,6)) +# sns.heatmap(A_mean, +# cmap="viridis", +# xticklabels=[f"M{i}" for i in range(MHC_MAX)], +# yticklabels=[f"P{j}" for j in range(PEP_MAX)], +# cbar_kws={"label":"attention"}) +# plt.xlabel("MHC position"); plt.ylabel("Peptide position") +# plt.title("Peptide→MHC attention (heads averaged) – sample 0") +# plt.tight_layout() +# plt.show() +# +# # report positions with highest influence ------------------------------ +# pep_pos = np.argmax(A_mean, axis=1) # best MHC pos for each peptide token +# mhc_pos = np.argmax(A_mean, axis=0) # most queried peptide pos per MHC token +# +# print("\nTop MHC position attended by each peptide residue:") +# for p in range(PEP_MAX): +# print(f" peptide P{p:02d} ⇢ MHC M{pep_pos[p]:02d} (score={A_mean[p,pep_pos[p]]:.3f})") +# +# print("\nPeptide position with max attention received from each MHC residue:") +# for m in range(MHC_MAX): +# print(f" MHC M{m:02d} ⇠ peptide P{mhc_pos[m]:02d} (score={A_mean[mhc_pos[m],m]:.3f})") diff --git a/src/model4_recon.py b/src/model4_recon.py new file mode 100644 index 000000000..229b48964 --- /dev/null +++ b/src/model4_recon.py @@ -0,0 +1,258 @@ +#!/usr/bin/env python +""" +pepmhc_cross_attention.py +------------------------- + +Minimal end-to-end demo of a peptide × MHC cross-attention classifier +with explainable attention visualisation. + +Author: 2025-05-22 +""" + +import numpy as np +import tensorflow as tf +from tensorflow import keras +from tensorflow.keras import layers +import matplotlib.pyplot as plt +import seaborn as sns + +# -------------------------------------------------------------------------------- +# 1. Synthetic toy-data helpers +# -------------------------------------------------------------------------------- +AA = "ACDEFGHIKLMNPQRSTVWY" +MASK_IDX = 20 # new index +AA_TO_INT = {a: i for i, a in enumerate(AA)} +AA_DIM = 21 # 20 AA + 1 MASK + +def onehot(seq: str, max_len: int) -> np.ndarray: + mat = np.zeros((max_len, AA_DIM), dtype=np.float32) + for i, aa in enumerate(seq[:max_len]): + mat[i, AA_TO_INT.get(aa, MASK_IDX)] = 1.0 + return mat + +def onehot_to_seq(onehot_mat: np.ndarray) -> str: + """Convert one-hot encoding back to amino acid sequence.""" + indices = np.argmax(onehot_mat, axis=1) + seq = "" + for idx in indices: + if idx == MASK_IDX: + seq += "X" # Use X to represent masked positions + else: + seq += AA[idx] + return seq + +def toy_batch_masked(batch_size=32, + pep_max=14, + mhc_max=36, + mask_rate=0.3, # 30\% of peptide tokens will be masked + mhc_dim=1152): + """Synthetic (masked peptide input, true peptide, mask weights, mhc) batch.""" + peps_in, peps_true, mask_w, mhcs = [], [], [], [] + for _ in range(batch_size): + # ----- peptide ------------------------------------------------------- + Lp = np.random.randint(8, pep_max + 1) + pep = ''.join(np.random.choice(list(AA), Lp)) + oh = onehot(pep, pep_max) # ground-truth (B,pep_max,21) + + # decide which positions to mask + mpos = np.random.rand(pep_max) < mask_rate + oh_masked = oh.copy() + oh_masked[mpos] = 0.0 + oh_masked[mpos, MASK_IDX] = 1.0 # replace by MASK token + + peps_in.append(oh_masked) # model input + peps_true.append(oh) # y_true + mask_w.append(mpos.astype(np.float32)) # sample-weight + # ----- MHC latent ---------------------------------------------------- + Lm = np.random.randint(20, mhc_max + 1) + mhc_lat = np.random.randn(Lm, mhc_dim).astype(np.float32) + pad_mhc = np.zeros((mhc_max, mhc_dim), np.float32) + pad_mhc[:Lm] = mhc_lat + mhcs.append(pad_mhc) + + return (np.stack(peps_in), + np.stack(mhcs), + np.stack(peps_true), + np.stack(mask_w)) + + +# -------------------------------------------------------------------------------- +# 2. Model building block: cross-attention with score output +# -------------------------------------------------------------------------------- +""" +model.py – light-weight peptide × MHC cross-attention classifier + plus twin model that exposes the attention matrix + for explainability. + +The only public symbol is + build_classifier(max_pep_len, max_mhc_len, …) +which returns + clf_model, att_model +""" +import tensorflow as tf +from tensorflow import keras +from tensorflow.keras import layers +import numpy as np + +# --------------------------------------------------------------------- +# helpers +# --------------------------------------------------------------------- +def cross_att_block(query, # (B,pep_len,D) + context, # (B,mhc_len,D) + heads=8, + name="xatt"): + """ + Keras MultiHeadAttention; returns (att_out, att_scores) + Shapes: + att_out (B, pep_len, D) + att_scores (B, heads, pep_len, mhc_len) + """ + mha = layers.MultiHeadAttention(num_heads=heads, + key_dim=query.shape[-1], + name=name) + + att_out, att_scores = mha(query=query, + value=context, + key=context, + return_attention_scores=True) + return att_out, att_scores + + +# --------------------------------------------------------------------- +# main builder +# --------------------------------------------------------------------- +# ----- inputs ------------------------------------------------------------ + + +def build_reconstruction_model(max_pep_len : int, + max_mhc_len : int, + pep_emb_dim : int = 64, + mhc_emb_dim : int = 64, + mhc_latent_dim : int = 1152, + heads : int = 8): + """ + Returns + clf_model – compiled model for training / inference + att_model – same weights, outputs attention scores only + """ + # Inputs ----------------------------------------------------------- + inp_pep = keras.Input(shape=(max_pep_len, AA_DIM), name="pep_onehot") + inp_mhc = keras.Input(shape=(max_mhc_len,mhc_latent_dim), name="mhc_latent") + + # ----- linear projections & positional enc ------------------------------ + pep_emb = layers.Dense(pep_emb_dim, activation=None, name="pep_proj")(inp_pep) + mhc_emb = layers.Dense(mhc_emb_dim, activation=None, name="mhc_proj")(inp_mhc) + + pep_pos = layers.Embedding(max_pep_len, pep_emb_dim, name="pep_pos")(tf.range(max_pep_len)) + mhc_pos = layers.Embedding(max_mhc_len, mhc_emb_dim, name="mhc_pos")(tf.range(max_mhc_len)) + pep_emb = pep_emb + pep_pos + mhc_emb = mhc_emb + mhc_pos + mhc_emb = layers.Dense(mhc_emb_dim, activation=None, name="mhc_dim_reduction")(mhc_emb) + + # ----- cross-attention --------------------------------------------------- + att_pep, att_scores = cross_att_block(pep_emb, mhc_emb, heads=heads, name="pep2mhc") + + # ----- per-token classifier --------------------------------------------- + logits = layers.Dense(AA_DIM, activation=None, name="logits")(att_pep) + probs = layers.Activation("softmax", name="aa_probs")(logits) # (B,pep_len,21) + + model = keras.Model([inp_pep, inp_mhc], logits, name="PepMHC_maskedLM") + + model.compile( + optimizer="adam", + loss=keras.losses.CategoricalCrossentropy(from_logits=True), + metrics=[keras.metrics.CategoricalAccuracy(name="masked_accuracy")], + sample_weight_mode="temporal", + ) + + # optional twin that only outputs attention ------------------------------ + att_model = keras.Model([inp_pep, inp_mhc], att_scores, name="PepMHC_attention") + + return model, att_model + + +# -------------------------------------------------------------------------------- +# 4. Demo run (synthetic data, 2 epochs, heat map) +# -------------------------------------------------------------------------------- +if __name__ == "__main__": + tf.random.set_seed(0); np.random.seed(0) + + PEP_MAX = 14 + MHC_MAX = 36 + BATCH = 64 + STEPS = 40 # keep tiny for a quick sanity run + + model, att_model = build_reconstruction_model(max_pep_len=PEP_MAX, max_mhc_len=MHC_MAX) + + print(model.summary(line_length=110)) + + # quick dummy training -------------------------------------------------- + for step in range(STEPS): + Xp, Xm, y_true, w = toy_batch_masked(BATCH, pep_max=PEP_MAX, mhc_max=MHC_MAX) + model.train_on_batch([Xp, Xm], y_true, sample_weight=w) + + ############## + Xp_test, Xm_test, y_test, mask_w_test = toy_batch_masked(8, pep_max=PEP_MAX, mhc_max=MHC_MAX) + preds = model.predict([Xp_test, Xm_test]) + att_scores = att_model.predict([Xp_test, Xm_test]) # (B,heads,pep_len,mhc_len) + + # Visualize peptide reconstruction examples + print("\n=== Peptide Reconstruction Examples ===") + for i in range(8): # Show first 3 examples + # Get original, masked and reconstructed peptides + original_pep = onehot_to_seq(y_test[i]) + masked_pep = onehot_to_seq(Xp_test[i]) + recon_pep = onehot_to_seq(preds[i]) + + # Trim to actual peptide length (remove trailing padding) + actual_len = len(original_pep.rstrip()) + original_pep = original_pep[:actual_len] + masked_pep = masked_pep[:actual_len] + recon_pep = recon_pep[:actual_len] + + # Highlight differences with formatting + highlighted_recon = "" + for j, (o, r) in enumerate(zip(original_pep, recon_pep)): + if masked_pep[j] == "X": + if o == r: + highlighted_recon += f"[{r}]" # Correctly reconstructed (was masked) + else: + highlighted_recon += f"({r})" # Incorrectly reconstructed (was masked) + else: + highlighted_recon += r # Position was not masked + + print(f"Example {i + 1}:") + print(f" Original: {original_pep}") + print(f" Masked input: {masked_pep}") + print(f" Reconstructed: {highlighted_recon}") + print(f" ([correct] / (incorrect) reconstruction of masked positions)\n") + + # Visualize attention for one example + plt.figure(figsize=(12, 5)) + example_idx = 0 + att_example = np.mean(att_scores[example_idx], axis=0) # Average over attention heads + + # Get non-padding length + pep_len = len(onehot_to_seq(y_test[example_idx]).rstrip()) + mhc_len = np.sum(np.any(Xm_test[example_idx] != 0, axis=1)) + + # Only display the actual peptide and MHC lengths (not padding) + att_display = att_example[:pep_len, :mhc_len] + + # Create heatmap + ax = sns.heatmap(att_display, cmap='viridis') + plt.title(f"Peptide-MHC Cross-Attention (Example {example_idx + 1})") + plt.xlabel("MHC position") + plt.ylabel("Peptide position") + + # Annotate masked positions on y-axis + masked_pep = onehot_to_seq(Xp_test[example_idx])[:pep_len] + plt.yticks(np.arange(pep_len) + 0.5, + [f"{i}:{aa}" + ("*" if aa == "X" else "") + for i, aa in enumerate(masked_pep)], + rotation=0) + + plt.tight_layout() + plt.show() + + diff --git a/src/run_model3.py b/src/run_model3.py new file mode 100644 index 000000000..1f8c899aa --- /dev/null +++ b/src/run_model3.py @@ -0,0 +1,758 @@ +#!/usr/bin/env python +""" +========================= + +MEMORY-OPTIMIZED End‑to‑end trainer for a **peptide×MHC cross‑attention classifier**. +Loads NetMHCpan‑style parquet files in true streaming fashion without loading entire datasets into memory. + +Key improvements: +1. Streaming parquet reading with configurable batch sizes +2. Lazy evaluation of dataset properties (seq length, class balance) +3. Memory-efficient TensorFlow data pipelines +4. Proper cleanup and memory monitoring + +Author: Amirreza (memory-optimized version, 2025) +""" +from __future__ import annotations +import os +import sys + +print(sys.executable) + +# ============================================================================= +# CRITICAL: GPU Memory Configuration - MUST BE FIRST +# ============================================================================= +import tensorflow as tf + + +def configure_gpu_memory(): + """Configure TensorFlow to use GPU memory efficiently""" + try: + gpus = tf.config.experimental.list_physical_devices('GPU') + if gpus: + print(f"Found {len(gpus)} GPU(s)") + for gpu in gpus: + tf.config.experimental.set_memory_growth(gpu, True) + print("✓ GPU memory growth enabled") + else: + print("No GPUs found - running on CPU") + except RuntimeError as e: + print(f"GPU configuration error: {e}") + + +# Configure GPU immediately +configure_gpu_memory() + +# --------------------------------------------------------------------- +# ► Use all logical CPU cores for TF ops that still run on CPU +# --------------------------------------------------------------------- +NUM_CPUS = os.cpu_count() or 1 +tf.config.threading.set_intra_op_parallelism_threads(NUM_CPUS) +tf.config.threading.set_inter_op_parallelism_threads(NUM_CPUS) +print(f'✓ TF intra/inter-op threads set to {NUM_CPUS}') + +# Set memory-friendly environment variables +os.environ['TF_GPU_ALLOCATOR'] = 'cuda_malloc_async' +os.environ['TF_FORCE_GPU_ALLOW_GROWTH'] = 'true' +os.environ["PYTHONHASHSEED"] = "42" +os.environ["TF_DETERMINISTIC_OPS"] = "1" + +import math +import argparse, datetime, pathlib, json +import psutil +import numpy as np +import pandas as pd +import matplotlib.pyplot as plt +from tqdm import tqdm +from model3 import build_classifier +from sklearn.metrics import ( + confusion_matrix, roc_curve, auc, precision_score, + recall_score, f1_score, accuracy_score, roc_auc_score +) +import seaborn as sns +import pyarrow.parquet as pq +import gc +import weakref +import pyarrow as pa, pyarrow.compute as pc +pa.set_cpu_count(os.cpu_count()) + + +# ============================================================================= +# Memory monitoring functions +# ============================================================================= +def monitor_memory(): + """Monitor system memory usage""" + memory = psutil.virtual_memory() + print(f"System RAM: {memory.used / 1e9:.1f}GB / {memory.total / 1e9:.1f}GB ({memory.percent:.1f}% used)") + + try: + from pynvml import nvmlInit, nvmlDeviceGetCount, nvmlDeviceGetHandleByIndex, nvmlDeviceGetMemoryInfo + nvmlInit() + deviceCount = nvmlDeviceGetCount() + for i in range(deviceCount): + handle = nvmlDeviceGetHandleByIndex(i) + info = nvmlDeviceGetMemoryInfo(handle) + print( + f"GPU {i}: {info.used / 1e9:.1f}GB / {info.total / 1e9:.1f}GB ({100 * info.used / info.total:.1f}% used)") + except: + print("GPU memory monitoring not available") + + +def cleanup_memory(): + """Aggressive memory cleanup""" + gc.collect() + try: + tf.keras.backend.clear_session() + except: + pass + + +# ---------------------------------------------------------------------------- +# Peptide encoding utilities +# ---------------------------------------------------------------------------- +AA = "ACDEFGHIKLMNPQRSTVWY" # 20 standard AAs, order fixed +AA_TO_IDX = {aa: i for i, aa in enumerate(AA)} +UNK_IDX = 20 # index for unknown / padding + + +def peptides_to_onehot(sequence: str, max_seq_len: int) -> np.ndarray: + """Convert peptide sequence to one-hot encoding""" + arr = np.zeros((max_seq_len, 21), dtype=np.float32) + for j, aa in enumerate(sequence.upper()[:max_seq_len]): + arr[j, AA_TO_IDX.get(aa, UNK_IDX)] = 1.0 + return arr + + +def _read_embedding_file(path: str | os.PathLike) -> np.ndarray: + """Robust loader for latent embeddings""" + try: + arr = np.load(path) + if isinstance(arr, np.ndarray) and arr.dtype == np.float32: + return arr + raise ValueError + except ValueError: + obj = np.load(path, allow_pickle=True) + if isinstance(obj, np.ndarray) and obj.dtype == object: + obj = obj.item() + if isinstance(obj, dict) and "embedding" in obj: + return obj["embedding"].astype("float32") + raise ValueError(f"Unrecognised embedding file {path}") + + +# ---------------------------------------------------------------------------- +# Streaming dataset utilities +# ---------------------------------------------------------------------------- +class StreamingParquetReader: + """Memory-efficient streaming parquet reader""" + + def __init__(self, parquet_path: str, batch_size: int = 1000): + self.parquet_path = parquet_path + self.batch_size = batch_size + self._file = None + self._num_rows = None + + def __enter__(self): + self._file = pq.ParquetFile(self.parquet_path) + return self + + def __exit__(self, exc_type, exc_val, exc_tb): + if self._file: + self._file = None + + @property + def num_rows(self): + """Get total number of rows without loading data""" + if self._num_rows is None: + if self._file is None: + with pq.ParquetFile(self.parquet_path) as f: + self._num_rows = f.metadata.num_rows + else: + self._num_rows = self._file.metadata.num_rows + return self._num_rows + + def iter_batches(self): + """Iterate over parquet file in batches""" + if self._file is None: + raise RuntimeError("Reader not opened. Use within 'with' statement.") + + for batch in self._file.iter_batches(batch_size=self.batch_size): + df = batch.to_pandas() + yield df + del df, batch # Explicit cleanup + + def sample_for_metadata(self, n_samples: int = 1000): + """Sample a small portion for metadata extraction""" + with pq.ParquetFile(self.parquet_path) as f: + # Read first batch for metadata + first_batch = next(f.iter_batches(batch_size=min(n_samples, self.num_rows))) + return first_batch.to_pandas() + + +def get_dataset_metadata(parquet_path: str): + """Extract dataset metadata without loading full dataset""" + with StreamingParquetReader(parquet_path) as reader: + sample_df = reader.sample_for_metadata(reader.num_rows) + + metadata = { + 'total_rows': reader.num_rows, + 'max_peptide_length': int(sample_df['long_mer'].str.len().max()) if 'long_mer' in sample_df.columns else 0, + 'class_distribution': sample_df[ + 'assigned_label'].value_counts().to_dict() if 'assigned_label' in sample_df.columns else {}, + } + + del sample_df + return metadata + + +def calculate_class_weights(parquet_path: str): + """Calculate class weights from a sample of the dataset""" + with StreamingParquetReader(parquet_path, batch_size=1000) as reader: + label_counts = {0: 0, 1: 0} + for batch_df in reader.iter_batches(): + batch_labels = batch_df['assigned_label'].values + unique, counts = np.unique(batch_labels, return_counts=True) + for label, count in zip(unique, counts): + if label in [0, 1]: + label_counts[int(label)] += count + del batch_df + + # Calculate balanced class weights + total = sum(label_counts.values()) + if total == 0 or label_counts[0] == 0 or label_counts[1] == 0: + return {0: 1.0, 1: 1.0} + + return { + 0: total / (2 * label_counts[0]), + 1: total / (2 * label_counts[1]) + } + + +# --------------------------------------------------------------------- +# Utility that is executed in worker processes +# (must be top-level so it can be pickled on Windows) +# --------------------------------------------------------------------- +def _row_to_tensor_pack(row_dict: dict, max_pep_seq_len: int, max_mhc_len: int): + """Convert a single row (already in plain-python dict form) into tensors.""" + # --- peptide one-hot ------------------------------------------------ + pep = row_dict["long_mer"].upper()[:max_pep_seq_len] + pep_arr = np.zeros((max_pep_seq_len, 21), dtype=np.float32) + for j, aa in enumerate(pep): + pep_arr[j, AA_TO_IDX.get(aa, UNK_IDX)] = 1.0 + + # --- load MHC embedding -------------------------------------------- + mhc = _read_embedding_file(row_dict["mhc_embedding_path"]) + if mhc.shape[0] != max_mhc_len: # sanity check + raise ValueError(f"MHC length mismatch: {mhc.shape[0]} vs {max_mhc_len}") + + # --- label ---------------------------------------------------------- + label = float(row_dict["assigned_label"]) + return (pep_arr, mhc.astype("float32")), label + +from concurrent.futures import ProcessPoolExecutor +import functools, itertools + +def streaming_data_generator( + parquet_path: str, + max_pep_seq_len: int, + max_mhc_len: int, + batch_size: int = 1000): + """ + Yields *individual* samples, but converts an entire Parquet batch + on multiple CPU cores first. + """ + with StreamingParquetReader(parquet_path, batch_size) as reader, \ + ProcessPoolExecutor(max_workers=os.cpu_count()) as pool: + + # Partial function to avoid re-sending constants + worker_fn = functools.partial( + _row_to_tensor_pack, + max_pep_seq_len=max_pep_seq_len, + max_mhc_len=max_mhc_len, + ) + + for batch_df in reader.iter_batches(): + # Convert Arrow table → list[dict] once; avoids pandas overhead + dict_rows = batch_df.to_dict(orient="list") # columns -> python lists + # Re-shape to list[dict(row)] + rows_iter = ( {k: dict_rows[k][i] for k in dict_rows} # row dict + for i in range(len(batch_df)) ) + + # Parallel map; chunksize tuned for large batches + results = pool.map(worker_fn, rows_iter, chunksize=64) + + # Stream each converted sample back to the generator consumer + yield from results # <-- keeps memory footprint tiny + + # explicit clean-up + del batch_df, dict_rows, rows_iter, results + + +def create_streaming_dataset(parquet_path: str, + max_pep_seq_len: int, + max_mhc_len: int, + batch_size: int = 128, + buffer_size: int = 1000): + """ + Same semantics as before, but the generator already does parallel + preprocessing. We now ask tf.data to interleave multiple generator + shards in parallel as well. + """ + output_signature = ( + ( + tf.TensorSpec(shape=(max_pep_seq_len, 21), dtype=tf.float32), + tf.TensorSpec(shape=(max_mhc_len, 1152), dtype=tf.float32), + ), + tf.TensorSpec(shape=(), dtype=tf.float32), + ) + + ds = tf.data.Dataset.from_generator( + lambda: streaming_data_generator( + parquet_path, + max_pep_seq_len, + max_mhc_len, + buffer_size), + output_signature=output_signature, + ) + + # ► Parallel interleave gives another speed-up if the Parquet file has + # many row-groups – adjust cycle_length as needed. + ds = ds.interleave( + lambda x, y: tf.data.Dataset.from_tensors((x, y)), + cycle_length=tf.data.AUTOTUNE, + num_parallel_calls=tf.data.AUTOTUNE, + deterministic=False, + ) + + return ds + + +# ---------------------------------------------------------------------------- +# Visualization utilities (keeping the same as original) +# ---------------------------------------------------------------------------- +def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_id: int = None, + model=None, val_dataset=None): + """Plot training curves and validation metrics""" + hist = history.history + plt.figure(figsize=(21, 6)) + plot_name = f"training_curve{'_fold' + str(fold_id) if fold_id is not None else ''}" + + plt.suptitle(f"Training Curves{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", + fontsize=16, fontweight='bold') + + # Plot 1: Loss curve + plt.subplot(1, 4, 1) + plt.plot(hist["loss"], label="train", linewidth=2) + plt.plot(hist["val_loss"], label="val", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Loss") + plt.title("BCE Loss") + plt.legend() + plt.grid(True, alpha=0.3) + + # Plot 2: Accuracy curve + if "binary_accuracy" in hist and "val_binary_accuracy" in hist: + plt.subplot(1, 4, 2) + plt.plot(hist["binary_accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_binary_accuracy"], label="val acc", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Accuracy") + plt.title("Binary Accuracy") + plt.legend() + plt.grid(True, alpha=0.3) + + # Plot 3: AUC curve + if "AUC" in hist and "val_AUC" in hist: + plt.subplot(1, 4, 3) + plt.plot(hist["AUC"], label="train AUC", linewidth=2) + plt.plot(hist["val_AUC"], label="val AUC", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("AUC") + plt.title("AUC") + plt.legend() + plt.grid(True, alpha=0.3) + + # Plot 4: Confusion matrix placeholder + plt.subplot(1, 4, 4) + if model is not None and val_dataset is not None: + # Sample a subset for confusion matrix to avoid memory issues + sample_dataset = val_dataset.take(100) # Take only 100 batches + y_pred_proba = model.predict(sample_dataset, verbose=0) + y_pred = (y_pred_proba > 0.5).astype(int) + + y_true = [] + for _, labels in sample_dataset: + y_true.extend(labels.numpy()) + y_true = np.array(y_true) + + cm = confusion_matrix(y_true, y_pred) + sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', + xticklabels=['Negative', 'Positive'], + yticklabels=['Negative', 'Positive']) + plt.title('Confusion Matrix (100 Batches)') + else: + plt.text(0.5, 0.5, 'Confusion Matrix N/A \n(Sample from validation)', + ha='center', va='center', transform=plt.gca().transAxes, + bbox=dict(boxstyle="round,pad=0.3", facecolor="lightgray")) + plt.axis('off') + + plt.tight_layout() + os.makedirs(run_dir, exist_ok=True) + out_png = os.path.join(run_dir, f"{plot_name}.png") + plt.savefig(out_png, dpi=300, bbox_inches='tight') + plt.close() # Close to free memory + print(f"✓ Training curve saved to {out_png}") + + +def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, + history=None, string: str = None): + """Plot comprehensive evaluation metrics for test dataset""" + print("Generating predictions for test metrics...") + + # Collect predictions and labels in batches to avoid memory issues + y_true_list = [] + y_pred_proba_list = [] + + for batch_x, batch_y in test_dataset: + batch_pred = model.predict(batch_x, verbose=0) + y_true_list.append(batch_y.numpy()) + y_pred_proba_list.append(batch_pred.flatten()) + + y_true = np.concatenate(y_true_list).flatten() + y_pred_proba = np.concatenate(y_pred_proba_list) + y_pred = (y_pred_proba > 0.5).astype(int) + + # Calculate ROC curve + fpr, tpr, _ = roc_curve(y_true, y_pred_proba) + roc_auc = auc(fpr, tpr) + + # Create evaluation plot + plt.figure(figsize=(15, 10)) + plt.suptitle(f"{string} Evaluation Metrics{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", + fontsize=16, fontweight='bold') + + # ROC Curve + plt.subplot(2, 2, 1) + plt.plot(fpr, tpr, color='darkorange', lw=2, label=f'ROC curve (AUC = {roc_auc:.4f})') + plt.plot([0, 1], [0, 1], color='navy', lw=2, linestyle='--', alpha=0.8) + plt.xlim([0.0, 1.0]) + plt.ylim([0.0, 1.05]) + plt.xlabel('False Positive Rate') + plt.ylabel('True Positive Rate') + plt.title('ROC Curve') + plt.legend(loc="lower right") + plt.grid(True, alpha=0.3) + + # Confusion Matrix + plt.subplot(2, 2, 2) + cm = confusion_matrix(y_true, y_pred) + sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', + xticklabels=['Negative', 'Positive'], + yticklabels=['Negative', 'Positive']) + plt.title('Confusion Matrix') + plt.xlabel('Predicted Label') + plt.ylabel('True Label') + + # Metrics bar chart + plt.subplot(2, 2, 3) + accuracy = accuracy_score(y_true, y_pred) + precision = precision_score(y_true, y_pred, zero_division=0) + recall = recall_score(y_true, y_pred, zero_division=0) + f1 = f1_score(y_true, y_pred, zero_division=0) + + metrics = {'Accuracy': accuracy, 'Precision': precision, 'Recall': recall, 'F1': f1, 'AUC': roc_auc} + bars = plt.bar(range(len(metrics)), list(metrics.values()), + color=['skyblue', 'lightcoral', 'lightgreen', 'gold', 'orange'], + alpha=0.8, edgecolor='black', linewidth=1) + plt.xticks(range(len(metrics)), list(metrics.keys()), rotation=45, ha='right') + plt.ylim(0, 1.0) + plt.title('Evaluation Metrics') + plt.ylabel('Score') + plt.grid(True, alpha=0.3, axis='y') + + for bar, value in zip(bars, metrics.values()): + plt.text(bar.get_x() + bar.get_width() / 2, bar.get_height() + 0.02, + f'{value:.3f}', ha='center', va='bottom', fontweight='bold') + + # Prediction distribution + plt.subplot(2, 2, 4) + plt.hist(y_pred_proba[y_true == 0], bins=30, alpha=0.7, label='Negative Class', + color='red', density=True) + plt.hist(y_pred_proba[y_true == 1], bins=30, alpha=0.7, label='Positive Class', + color='blue', density=True) + plt.axvline(x=0.5, color='black', linestyle='--', linewidth=2, label='Threshold') + plt.xlabel('Predicted Probability') + plt.ylabel('Density') + plt.title('Prediction Distribution') + plt.legend() + plt.grid(True, alpha=0.3) + + plt.tight_layout() + os.makedirs(run_dir, exist_ok=True) + out_png = os.path.join(run_dir, f"{string}_metrics{'_fold' + str(fold_id) if fold_id is not None else ''}.png") + plt.savefig(out_png, dpi=300, bbox_inches='tight') + plt.close() # Close to free memory + print(f"✓ Test metrics visualization saved to {out_png}") + + # Print summary + print("\n" + "=" * 50) + print("EVALUATION SUMMARY") + print("=" * 50) + print(f"Accuracy: {accuracy:.4f}") + print(f"Precision: {precision:.4f}") + print(f"Recall: {recall:.4f}") + print(f"F1 Score: {f1:.4f}") + print(f"ROC AUC: {roc_auc:.4f}") + print("=" * 50) + + return { + 'roc_auc': roc_auc, 'accuracy': accuracy, 'precision': precision, + 'recall': recall, 'f1': f1, 'confusion_matrix': cm.tolist() + } + +def plot_attn(att_model, val_loader, run_dir: str, fold_id: int = None): + # ------------------------------------------------------------- + # ATTENTION VISUALISATION – take ONE batch from validation + # ------------------------------------------------------------- + (pep_ex, mhc_ex), _ = next(iter(val_loader)) # first batch + att_scores = att_model.predict([pep_ex, mhc_ex], verbose=0) + print("attn_scores", att_scores.shape) + print("attn_scores first 5 samples:", att_scores[:5]) + # save attention scores + if fold_id is None: + fold_id = 0 + run_dir = os.path.join(run_dir, f"fold_{fold_id}") + pathlib.Path(run_dir).mkdir(parents=True, exist_ok=True) + print(f"✓ Attention scores saved to {run_dir}") + out_attn = os.path.join(run_dir, f"attn_scores_fold{fold_id}.npy") + np.save(out_attn, att_scores) + print(f"✓ Attention scores saved to {out_attn}") + # ------------------------------------------------------------- + # att_scores shape : (B, heads, pep_len, mhc_len) + att_mean = att_scores.mean(axis=1) # (B,pep,mhc) + print("att_mean shape:", att_mean.shape) + sample_id = 0 + A = att_mean[sample_id] + A = A.transpose() + plt.figure(figsize=(8, 6)) + sns.heatmap(A, + cmap = "viridis", + xticklabels = [f"P{j}" for j in range(A.shape[1])], + yticklabels = [f"M{i}" for i in range(A.shape[0])], + cbar_kws = {"label": "attention"}) + plt.title(f"Fold {fold_id} – attention sample {sample_id}") + out_png = os.path.join(run_dir,f"attention_fold{fold_id}_sample{sample_id}.png") + plt.savefig(out_png, dpi=300, bbox_inches="tight") + plt.close() + print(f"✓ Attention heat-map saved to {out_png}") + + +# ---------------------------------------------------------------------------- +# Main training function +# ---------------------------------------------------------------------------- +def main(argv=None): + p = argparse.ArgumentParser() + p.add_argument("--dataset_path", required=True, + help="Path to the dataset directory") + p.add_argument("--epochs", type=int, default=30) + p.add_argument("--batch", type=int, default=128) + p.add_argument("--outdir", default=None, + help="Output dir (default: runs/run_YYYYmmdd-HHMMSS)") + p.add_argument("--buffer_size", type=int, default=1000, + help="Buffer size for streaming data loading") + p.add_argument("--test_batches", type=int, default=3, + help="Number of batches to use for test dataset evaluation") + + args = p.parse_args(argv) + + run_dir = args.outdir or f"runs/run_{datetime.datetime.now():%Y%m%d-%H%M%S}" + pathlib.Path(run_dir).mkdir(parents=True, exist_ok=True) + print(f"★ Outputs → {run_dir}\n") + + # Set seeds for reproducibility + tf.random.set_seed(42) + np.random.seed(42) + print("Setting random seeds for reproducibility...") + + print("Initial memory state:") + monitor_memory() + + # Extract metadata from datasets without loading them fully + print("Extracting dataset metadata...") + + # Get fold information + fold_dir = os.path.join(args.dataset_path, 'folds') + fold_files = sorted([f for f in os.listdir(fold_dir) if f.endswith('.parquet')]) + n_folds = len(fold_files) // 2 + + # Find maximum peptide length across all datasets + max_peptide_length = 0 + max_mhc_length = 36 # Fixed for now + + print("Scanning datasets for maximum peptide length...") + all_parquet_files = [ + os.path.join(args.dataset_path, "test1.parquet"), + os.path.join(args.dataset_path, "test2.parquet") + ] + + # Add fold files + for i in range(1, n_folds + 1): + all_parquet_files.extend([ + os.path.join(fold_dir, f'fold_{i}_train.parquet'), + os.path.join(fold_dir, f'fold_{i}_val.parquet') + ]) + + for pq_file in all_parquet_files: + if os.path.exists(pq_file): + metadata = get_dataset_metadata(pq_file) + max_peptide_length = max(max_peptide_length, metadata['max_peptide_length']) + print( + f" {os.path.basename(pq_file)}: max_len={metadata['max_peptide_length']}, rows={metadata['total_rows']}") + + print(f"✓ Maximum peptide length across all datasets: {max_peptide_length}") + + # Create fold datasets and class weights + folds = [] + class_weights = [] + + for i in range(1, n_folds + 1): + print(f"\nProcessing fold {i}/{n_folds}") + train_path = os.path.join(fold_dir, f'fold_{i}_train.parquet') + val_path = os.path.join(fold_dir, f'fold_{i}_val.parquet') + + # Calculate class weights from training data + print(f" Calculating class weights...") + cw = calculate_class_weights(train_path) + print(f" Class weights: {cw}") + + # Create streaming datasets + train_ds = (create_streaming_dataset(train_path, max_peptide_length, max_mhc_length, + buffer_size=args.buffer_size) + .shuffle(buffer_size=args.buffer_size, reshuffle_each_iteration=True) + .batch(args.batch) + .take(args.test_batches) + .prefetch(tf.data.AUTOTUNE)) + + val_ds = (create_streaming_dataset(val_path, max_peptide_length, max_mhc_length, + buffer_size=args.buffer_size) + .batch(args.batch) + .take(args.test_batches) + .prefetch(tf.data.AUTOTUNE)) + + folds.append((train_ds, val_ds)) + class_weights.append(cw) + + # Force cleanup + cleanup_memory() + + # Create test datasets + print("Creating test datasets...") + test1_ds = (create_streaming_dataset(os.path.join(args.dataset_path, "test1.parquet"), + max_peptide_length, max_mhc_length, buffer_size=args.buffer_size) + .batch(args.batch) + .prefetch(tf.data.AUTOTUNE)) + + test2_ds = (create_streaming_dataset(os.path.join(args.dataset_path, "test2.parquet"), + max_peptide_length, max_mhc_length, buffer_size=args.buffer_size) + .batch(args.batch) + .prefetch(tf.data.AUTOTUNE)) + + print(f"✓ Created {n_folds} fold datasets and 2 test datasets") + print("Memory after dataset creation:") + monitor_memory() + + # Training loop + print("\n" + "=" * 60) + print("STARTING TRAINING") + print("=" * 60) + + for fold_id, ((train_loader, val_loader), class_weight) in enumerate(zip(folds, class_weights), start=1): + print(f'\n🔥 Training fold {fold_id}/{n_folds}') + + # Clean up before each fold + cleanup_memory() + + # Build fresh model for each fold + print("Building model...") + model, attn_model = build_classifier(max_peptide_length,max_mhc_length) + model.summary() + + # Callbacks + ckpt_cb = tf.keras.callbacks.ModelCheckpoint( + filepath=os.path.join(run_dir, f'best_fold_{fold_id}.weights.h5'), + monitor='val_loss', save_best_only=True, mode='min', verbose=1) + early_cb = tf.keras.callbacks.EarlyStopping( + monitor='val_loss', patience=15, restore_best_weights=True, verbose=1) + + # Verify data shapes + for (x_pep, latents), labels in train_loader.take(1): + print(f"✓ Input shapes: peptide={x_pep.shape}, mhc={latents.shape}, labels={labels.shape}") + break + + print("Memory before training:") + monitor_memory() + + # Train model + print("🚀 Starting training...") + hist = model.fit( + train_loader, + validation_data=val_loader, + epochs=args.epochs, + class_weight=class_weight, + callbacks=[ckpt_cb, early_cb], + verbose=1, + ) + + print("Memory after training:") + monitor_memory() + + # Plot training curves + plot_training_curve(hist, run_dir, fold_id, model, val_loader) + plot_attn(attn_model, val_loader, run_dir, fold_id) + + # Save model and metadata + model.save_weights(os.path.join(run_dir, f'model_fold_{fold_id}.weights.h5')) + metadata = { + "fold_id": fold_id, + "epochs": args.epochs, + "batch_size": args.batch, + "max_peptide_length": max_peptide_length, + "max_mhc_length": max_mhc_length, + "class_weights": class_weight, + "run_dir": run_dir, + "mhc_class": MHC_CLASS + } + with open(os.path.join(run_dir, f'metadata_fold_{fold_id}.json'), 'w') as f: + json.dump(metadata, f, indent=4) + + # Evaluate on test sets + print(f"\n📊 Evaluating fold {fold_id} on test sets...") + + # Test1 evaluation + print("Evaluating on test1 (balanced alleles)...") + plot_test_metrics(model, test1_ds, run_dir, fold_id, string="Test1_balanced_alleles") + + # Test2 evaluation + print("Evaluating on test2 (rare alleles)...") + plot_test_metrics(model, test2_ds, run_dir, fold_id, string="Test2_rare_alleles") + + print(f"✅ Fold {fold_id} completed successfully") + + # Cleanup + del model, hist + cleanup_memory() + + print("\n🎉 Training completed successfully!") + print(f"📁 All results saved to: {run_dir}") + + +if __name__ == "__main__": + BUFFER = 8192 # Reduced buffer size for memory efficiency + MHC_CLASS = 2 + dataset_path = f"../data/Custom_dataset/NetMHCpan_dataset/mhc_{MHC_CLASS}" + main([ + "--dataset_path", dataset_path, + "--epochs", "10", + "--batch", "32", + "--buffer_size", "8192", + "--test_batches", "500", + ]) \ No newline at end of file diff --git a/src/run_model4_recon.py b/src/run_model4_recon.py new file mode 100644 index 000000000..e2bba4559 --- /dev/null +++ b/src/run_model4_recon.py @@ -0,0 +1,767 @@ +#!/usr/bin/env python +""" +========================= + +MEMORY-OPTIMIZED End‑to‑end trainer for a **peptide×MHC cross‑attention classifier**. +Loads NetMHCpan‑style parquet files in true streaming fashion without loading entire datasets into memory. + +Key improvements: +1. Streaming parquet reading with configurable batch sizes +2. Lazy evaluation of dataset properties (seq length, class balance) +3. Memory-efficient TensorFlow data pipelines +4. Proper cleanup and memory monitoring + +Author: Amirreza (memory-optimized version, 2025) +""" +from __future__ import annotations +import os +import sys + +print(sys.executable) + +# ============================================================================= +# CRITICAL: GPU Memory Configuration - MUST BE FIRST +# ============================================================================= +import tensorflow as tf + + +def configure_gpu_memory(): + """Configure TensorFlow to use GPU memory efficiently""" + try: + gpus = tf.config.experimental.list_physical_devices('GPU') + if gpus: + print(f"Found {len(gpus)} GPU(s)") + for gpu in gpus: + tf.config.experimental.set_memory_growth(gpu, True) + print("✓ GPU memory growth enabled") + else: + print("No GPUs found - running on CPU") + except RuntimeError as e: + print(f"GPU configuration error: {e}") + + +# Configure GPU immediately +configure_gpu_memory() + +# --------------------------------------------------------------------- +# ► Use all logical CPU cores for TF ops that still run on CPU +# --------------------------------------------------------------------- +NUM_CPUS = os.cpu_count() or 1 +tf.config.threading.set_intra_op_parallelism_threads(NUM_CPUS) +tf.config.threading.set_inter_op_parallelism_threads(NUM_CPUS) +print(f'✓ TF intra/inter-op threads set to {NUM_CPUS}') + +# Set memory-friendly environment variables +os.environ['TF_GPU_ALLOCATOR'] = 'cuda_malloc_async' +os.environ['TF_FORCE_GPU_ALLOW_GROWTH'] = 'true' +os.environ["PYTHONHASHSEED"] = "42" +os.environ["TF_DETERMINISTIC_OPS"] = "1" + +import math +import argparse, datetime, pathlib, json +import psutil +import numpy as np +import pandas as pd +import matplotlib.pyplot as plt +from tqdm import tqdm +from model4_recon import build_reconstruction_model +from sklearn.metrics import ( + confusion_matrix, roc_curve, auc, precision_score, + recall_score, f1_score, accuracy_score, roc_auc_score +) +import seaborn as sns +import pyarrow.parquet as pq +import gc +import weakref +import pyarrow as pa, pyarrow.compute as pc +pa.set_cpu_count(os.cpu_count()) + + +# ============================================================================= +# Memory monitoring functions +# ============================================================================= +def monitor_memory(): + """Monitor system memory usage""" + memory = psutil.virtual_memory() + print(f"System RAM: {memory.used / 1e9:.1f}GB / {memory.total / 1e9:.1f}GB ({memory.percent:.1f}% used)") + + try: + from pynvml import nvmlInit, nvmlDeviceGetCount, nvmlDeviceGetHandleByIndex, nvmlDeviceGetMemoryInfo + nvmlInit() + deviceCount = nvmlDeviceGetCount() + for i in range(deviceCount): + handle = nvmlDeviceGetHandleByIndex(i) + info = nvmlDeviceGetMemoryInfo(handle) + print( + f"GPU {i}: {info.used / 1e9:.1f}GB / {info.total / 1e9:.1f}GB ({100 * info.used / info.total:.1f}% used)") + except: + print("GPU memory monitoring not available") + + +def cleanup_memory(): + """Aggressive memory cleanup""" + gc.collect() + try: + tf.keras.backend.clear_session() + except: + pass + + +# ---------------------------------------------------------------------------- +# Peptide encoding utilities +# ---------------------------------------------------------------------------- +# add a MASK channel +AA = "ACDEFGHIKLMNPQRSTVWY" +MASK_IDX = 20 +AA_TO_IDX = {aa: i for i, aa in enumerate(AA)} +AA_DIM = 21 # 20 aa + MASK token + +def onehot(seq: str, max_len: int) -> np.ndarray: + """Return one-hot with an explicit MASK channel (all-zeros for padding).""" + arr = np.zeros((max_len, AA_DIM), dtype=np.float32) + for i, aa in enumerate(seq[:max_len].upper()): + arr[i, AA_TO_IDX.get(aa, MASK_IDX)] = 1.0 + return arr + +def mask_random_positions(oh: np.ndarray, mask_rate: float = .3): + """ + Replace ~mask_rate positions by MASK token. + Returns (masked_input, y_true, sample_weight) + """ + pep_len = oh.shape[0] + mpos = np.random.rand(pep_len) < mask_rate + y_true = oh.copy() + sample_weight = mpos.astype(np.float32) # 1 on masked positions + + masked = oh.copy() + masked[mpos] = 0.0 + masked[mpos, MASK_IDX] = 1.0 + return masked, y_true, sample_weight + + +def _read_embedding_file(path: str | os.PathLike) -> np.ndarray: + """Robust loader for latent embeddings""" + try: + arr = np.load(path) + if isinstance(arr, np.ndarray) and arr.dtype == np.float32: + return arr + raise ValueError + except ValueError: + obj = np.load(path, allow_pickle=True) + if isinstance(obj, np.ndarray) and obj.dtype == object: + obj = obj.item() + if isinstance(obj, dict) and "embedding" in obj: + return obj["embedding"].astype("float32") + raise ValueError(f"Unrecognised embedding file {path}") + + +# ---------------------------------------------------------------------------- +# Streaming dataset utilities +# ---------------------------------------------------------------------------- +class StreamingParquetReader: + """Memory-efficient streaming parquet reader""" + + def __init__(self, parquet_path: str, batch_size: int = 1000): + self.parquet_path = parquet_path + self.batch_size = batch_size + self._file = None + self._num_rows = None + + def __enter__(self): + self._file = pq.ParquetFile(self.parquet_path) + return self + + def __exit__(self, exc_type, exc_val, exc_tb): + if self._file: + self._file = None + + @property + def num_rows(self): + """Get total number of rows without loading data""" + if self._num_rows is None: + if self._file is None: + with pq.ParquetFile(self.parquet_path) as f: + self._num_rows = f.metadata.num_rows + else: + self._num_rows = self._file.metadata.num_rows + return self._num_rows + + def iter_batches(self): + """Iterate over parquet file in batches""" + if self._file is None: + raise RuntimeError("Reader not opened. Use within 'with' statement.") + + for batch in self._file.iter_batches(batch_size=self.batch_size): + df = batch.to_pandas() + yield df + del df, batch # Explicit cleanup + + def sample_for_metadata(self, n_samples: int = 1000): + """Sample a small portion for metadata extraction""" + with pq.ParquetFile(self.parquet_path) as f: + # Read first batch for metadata + first_batch = next(f.iter_batches(batch_size=min(n_samples, self.num_rows))) + return first_batch.to_pandas() + + +def get_dataset_metadata(parquet_path: str): + """Extract dataset metadata without loading full dataset""" + with StreamingParquetReader(parquet_path) as reader: + sample_df = reader.sample_for_metadata(reader.num_rows) + + metadata = { + 'total_rows': reader.num_rows, + 'max_peptide_length': int(sample_df['long_mer'].str.len().max()) if 'long_mer' in sample_df.columns else 0, + 'class_distribution': sample_df[ + 'assigned_label'].value_counts().to_dict() if 'assigned_label' in sample_df.columns else {}, + } + + del sample_df + return metadata + + +def calculate_class_weights(parquet_path: str): + """Calculate class weights from a sample of the dataset""" + with StreamingParquetReader(parquet_path, batch_size=1000) as reader: + label_counts = {0: 0, 1: 0} + for batch_df in reader.iter_batches(): + batch_labels = batch_df['assigned_label'].values + unique, counts = np.unique(batch_labels, return_counts=True) + for label, count in zip(unique, counts): + if label in [0, 1]: + label_counts[int(label)] += count + del batch_df + + # Calculate balanced class weights + total = sum(label_counts.values()) + if total == 0 or label_counts[0] == 0 or label_counts[1] == 0: + return {0: 1.0, 1: 1.0} + + return { + 0: total / (2 * label_counts[0]), + 1: total / (2 * label_counts[1]) + } + + +# --------------------------------------------------------------------- +# Utility that is executed in worker processes +# (must be top-level so it can be pickled on Windows) +# --------------------------------------------------------------------- +def _row_to_tensor_pack(row_dict: dict, + max_pep_seq_len: int, + max_mhc_len: int, + mask_rate: float = 0.3): + # peptide ----------------------------------------------------------- + pep_oh = onehot(row_dict["long_mer"], max_pep_seq_len) + pep_masked, y_true, sw = mask_random_positions(pep_oh, mask_rate) + + # MHC latent -------------------------------------------------------- + mhc = _read_embedding_file(row_dict["mhc_embedding_path"]).astype("float32") + if mhc.shape[0] != max_mhc_len: + raise ValueError("MHC length mismatch") + + return (pep_masked, mhc), y_true, sw # <-- three-tuple + +from concurrent.futures import ProcessPoolExecutor +import functools, itertools + +def streaming_data_generator( + parquet_path: str, + max_pep_seq_len: int, + max_mhc_len: int, + batch_size: int = 1000): + """ + Yields *individual* samples, but converts an entire Parquet batch + on multiple CPU cores first. + """ + with StreamingParquetReader(parquet_path, batch_size) as reader, \ + ProcessPoolExecutor(max_workers=os.cpu_count()) as pool: + + # Partial function to avoid re-sending constants + worker_fn = functools.partial( + _row_to_tensor_pack, + max_pep_seq_len=max_pep_seq_len, + max_mhc_len=max_mhc_len, + ) + + for batch_df in reader.iter_batches(): + # Convert Arrow table → list[dict] once; avoids pandas overhead + dict_rows = batch_df.to_dict(orient="list") # columns -> python lists + # Re-shape to list[dict(row)] + rows_iter = ( {k: dict_rows[k][i] for k in dict_rows} # row dict + for i in range(len(batch_df)) ) + + # Parallel map; chunksize tuned for large batches + results = pool.map(worker_fn, rows_iter, chunksize=64) + + # Stream each converted sample back to the generator consumer + yield from results # <-- keeps memory footprint tiny + + # explicit clean-up + del batch_df, dict_rows, rows_iter, results + + +def create_streaming_dataset(parquet_path: str, + max_pep_seq_len: int, + max_mhc_len: int, + batch_size: int = 128, + buffer_size: int = 1000): + """ + Same semantics as before, but the generator already does parallel + preprocessing. We now ask tf.data to interleave multiple generator + shards in parallel as well. + """ + output_signature = ( + (tf.TensorSpec((max_pep_seq_len, AA_DIM), tf.float32), + tf.TensorSpec((max_mhc_len, 1152), tf.float32)), + tf.TensorSpec((max_pep_seq_len, AA_DIM), tf.float32), # y_true + tf.TensorSpec((max_pep_seq_len,), tf.float32), # sample_weight + ) + + ds = tf.data.Dataset.from_generator( + lambda: streaming_data_generator( + parquet_path, + max_pep_seq_len, + max_mhc_len, + buffer_size), + output_signature=output_signature, + ) + + # ► Parallel interleave gives another speed-up if the Parquet file has + # many row-groups – adjust cycle_length as needed. + ds = ds.interleave( + lambda features, y_true, sw: tf.data.Dataset.from_tensors((features, y_true, sw)), + cycle_length=tf.data.AUTOTUNE, + num_parallel_calls=tf.data.AUTOTUNE, + deterministic=False, + ) + + return ds + + +# ---------------------------------------------------------------------------- +# Visualization utilities (keeping the same as original) +# ---------------------------------------------------------------------------- +def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_id: int = None, + model=None, val_dataset=None): + """Plot training curves and validation metrics""" + hist = history.history + plt.figure(figsize=(21, 6)) + plot_name = f"training_curve{'_fold' + str(fold_id) if fold_id is not None else ''}" + + plt.suptitle(f"Training Curves{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", + fontsize=16, fontweight='bold') + + # Plot 1: Loss curve + plt.subplot(1, 4, 1) + plt.plot(hist["loss"], label="train", linewidth=2) + plt.plot(hist["val_loss"], label="val", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Loss") + plt.title("BCE Loss") + plt.legend() + plt.grid(True, alpha=0.3) + + # Plot 2: Accuracy curve + if "binary_accuracy" in hist and "val_binary_accuracy" in hist: + plt.subplot(1, 4, 2) + plt.plot(hist["binary_accuracy"], label="train acc", linewidth=2) + plt.plot(hist["val_binary_accuracy"], label="val acc", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("Accuracy") + plt.title("Binary Accuracy") + plt.legend() + plt.grid(True, alpha=0.3) + + # Plot 3: AUC curve + if "AUC" in hist and "val_AUC" in hist: + plt.subplot(1, 4, 3) + plt.plot(hist["AUC"], label="train AUC", linewidth=2) + plt.plot(hist["val_AUC"], label="val AUC", linewidth=2) + plt.xlabel("Epoch") + plt.ylabel("AUC") + plt.title("AUC") + plt.legend() + plt.grid(True, alpha=0.3) + + # Plot 4: Confusion matrix placeholder + plt.subplot(1, 4, 4) + if model is not None and val_dataset is not None: + # Sample a subset for confusion matrix to avoid memory issues + sample_dataset = val_dataset.take(100) # Take only 100 batches + y_pred_proba = model.predict(sample_dataset, verbose=0) + y_pred = (y_pred_proba > 0.5).astype(int) + + y_true = [] + for _, labels, _ in sample_dataset: + y_true.extend(labels.numpy()) + y_true = np.array(y_true) + + cm = confusion_matrix(y_true, y_pred) + sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', + xticklabels=['Negative', 'Positive'], + yticklabels=['Negative', 'Positive']) + plt.title('Confusion Matrix (100 Batches)') + else: + plt.text(0.5, 0.5, 'Confusion Matrix N/A \n(Sample from validation)', + ha='center', va='center', transform=plt.gca().transAxes, + bbox=dict(boxstyle="round,pad=0.3", facecolor="lightgray")) + plt.axis('off') + + plt.tight_layout() + os.makedirs(run_dir, exist_ok=True) + out_png = os.path.join(run_dir, f"{plot_name}.png") + plt.savefig(out_png, dpi=300, bbox_inches='tight') + plt.close() # Close to free memory + print(f"✓ Training curve saved to {out_png}") + + +def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, + history=None, string: str = None): + """Plot comprehensive evaluation metrics for test dataset""" + print("Generating predictions for test metrics...") + + # Collect predictions and labels in batches to avoid memory issues + y_true_list = [] + y_pred_proba_list = [] + + for batch_x, batch_y in test_dataset: + batch_pred = model.predict(batch_x, verbose=0) + y_true_list.append(batch_y.numpy()) + y_pred_proba_list.append(batch_pred.flatten()) + + y_true = np.concatenate(y_true_list).flatten() + y_pred_proba = np.concatenate(y_pred_proba_list) + y_pred = (y_pred_proba > 0.5).astype(int) + + # Calculate ROC curve + fpr, tpr, _ = roc_curve(y_true, y_pred_proba) + roc_auc = auc(fpr, tpr) + + # Create evaluation plot + plt.figure(figsize=(15, 10)) + plt.suptitle(f"{string} Evaluation Metrics{' (Fold ' + str(fold_id) + ')' if fold_id is not None else ''}", + fontsize=16, fontweight='bold') + + # ROC Curve + plt.subplot(2, 2, 1) + plt.plot(fpr, tpr, color='darkorange', lw=2, label=f'ROC curve (AUC = {roc_auc:.4f})') + plt.plot([0, 1], [0, 1], color='navy', lw=2, linestyle='--', alpha=0.8) + plt.xlim([0.0, 1.0]) + plt.ylim([0.0, 1.05]) + plt.xlabel('False Positive Rate') + plt.ylabel('True Positive Rate') + plt.title('ROC Curve') + plt.legend(loc="lower right") + plt.grid(True, alpha=0.3) + + # Confusion Matrix + plt.subplot(2, 2, 2) + cm = confusion_matrix(y_true, y_pred) + sns.heatmap(cm, annot=True, fmt='d', cmap='Blues', + xticklabels=['Negative', 'Positive'], + yticklabels=['Negative', 'Positive']) + plt.title('Confusion Matrix') + plt.xlabel('Predicted Label') + plt.ylabel('True Label') + + # Metrics bar chart + plt.subplot(2, 2, 3) + accuracy = accuracy_score(y_true, y_pred) + precision = precision_score(y_true, y_pred, zero_division=0) + recall = recall_score(y_true, y_pred, zero_division=0) + f1 = f1_score(y_true, y_pred, zero_division=0) + + metrics = {'Accuracy': accuracy, 'Precision': precision, 'Recall': recall, 'F1': f1, 'AUC': roc_auc} + bars = plt.bar(range(len(metrics)), list(metrics.values()), + color=['skyblue', 'lightcoral', 'lightgreen', 'gold', 'orange'], + alpha=0.8, edgecolor='black', linewidth=1) + plt.xticks(range(len(metrics)), list(metrics.keys()), rotation=45, ha='right') + plt.ylim(0, 1.0) + plt.title('Evaluation Metrics') + plt.ylabel('Score') + plt.grid(True, alpha=0.3, axis='y') + + for bar, value in zip(bars, metrics.values()): + plt.text(bar.get_x() + bar.get_width() / 2, bar.get_height() + 0.02, + f'{value:.3f}', ha='center', va='bottom', fontweight='bold') + + # Prediction distribution + plt.subplot(2, 2, 4) + plt.hist(y_pred_proba[y_true == 0], bins=30, alpha=0.7, label='Negative Class', + color='red', density=True) + plt.hist(y_pred_proba[y_true == 1], bins=30, alpha=0.7, label='Positive Class', + color='blue', density=True) + plt.axvline(x=0.5, color='black', linestyle='--', linewidth=2, label='Threshold') + plt.xlabel('Predicted Probability') + plt.ylabel('Density') + plt.title('Prediction Distribution') + plt.legend() + plt.grid(True, alpha=0.3) + + plt.tight_layout() + os.makedirs(run_dir, exist_ok=True) + out_png = os.path.join(run_dir, f"{string}_metrics{'_fold' + str(fold_id) if fold_id is not None else ''}.png") + plt.savefig(out_png, dpi=300, bbox_inches='tight') + plt.close() # Close to free memory + print(f"✓ Test metrics visualization saved to {out_png}") + + # Print summary + print("\n" + "=" * 50) + print("EVALUATION SUMMARY") + print("=" * 50) + print(f"Accuracy: {accuracy:.4f}") + print(f"Precision: {precision:.4f}") + print(f"Recall: {recall:.4f}") + print(f"F1 Score: {f1:.4f}") + print(f"ROC AUC: {roc_auc:.4f}") + print("=" * 50) + + return { + 'roc_auc': roc_auc, 'accuracy': accuracy, 'precision': precision, + 'recall': recall, 'f1': f1, 'confusion_matrix': cm.tolist() + } + +def plot_attn(att_model, val_loader, run_dir: str, fold_id: int = None): + # ------------------------------------------------------------- + # ATTENTION VISUALISATION – take ONE batch from validation + # ------------------------------------------------------------- + (pep_ex, mhc_ex), _ = next(iter(val_loader)) # first batch + att_scores = att_model.predict([pep_ex, mhc_ex], verbose=0) + print("attn_scores", att_scores.shape) + print("attn_scores first 5 samples:", att_scores[:5]) + # save attention scores + if fold_id is None: + fold_id = 0 + run_dir = os.path.join(run_dir, f"fold_{fold_id}") + pathlib.Path(run_dir).mkdir(parents=True, exist_ok=True) + print(f"✓ Attention scores saved to {run_dir}") + out_attn = os.path.join(run_dir, f"attn_scores_fold{fold_id}.npy") + np.save(out_attn, att_scores) + print(f"✓ Attention scores saved to {out_attn}") + # ------------------------------------------------------------- + # att_scores shape : (B, heads, pep_len, mhc_len) + att_mean = att_scores.mean(axis=1) # (B,pep,mhc) + print("att_mean shape:", att_mean.shape) + sample_id = 0 + A = att_mean[sample_id] + A = A.transpose() + plt.figure(figsize=(8, 6)) + sns.heatmap(A, + cmap = "viridis", + xticklabels = [f"P{j}" for j in range(A.shape[1])], + yticklabels = [f"M{i}" for i in range(A.shape[0])], + cbar_kws = {"label": "attention"}) + plt.title(f"Fold {fold_id} – attention sample {sample_id}") + out_png = os.path.join(run_dir,f"attention_fold{fold_id}_sample{sample_id}.png") + plt.savefig(out_png, dpi=300, bbox_inches="tight") + plt.close() + print(f"✓ Attention heat-map saved to {out_png}") + + +# ---------------------------------------------------------------------------- +# Main training function +# ---------------------------------------------------------------------------- +def main(argv=None): + p = argparse.ArgumentParser() + p.add_argument("--dataset_path", required=True, + help="Path to the dataset directory") + p.add_argument("--epochs", type=int, default=30) + p.add_argument("--batch", type=int, default=128) + p.add_argument("--outdir", default=None, + help="Output dir (default: runs/run_YYYYmmdd-HHMMSS)") + p.add_argument("--buffer_size", type=int, default=1000, + help="Buffer size for streaming data loading") + p.add_argument("--test_batches", type=int, default=3, + help="Number of batches to use for test dataset evaluation") + + args = p.parse_args(argv) + + run_dir = args.outdir or f"runs/run_{datetime.datetime.now():%Y%m%d-%H%M%S}" + pathlib.Path(run_dir).mkdir(parents=True, exist_ok=True) + print(f"★ Outputs → {run_dir}\n") + + # Set seeds for reproducibility + tf.random.set_seed(42) + np.random.seed(42) + print("Setting random seeds for reproducibility...") + + print("Initial memory state:") + monitor_memory() + + # Extract metadata from datasets without loading them fully + print("Extracting dataset metadata...") + + # Get fold information + fold_dir = os.path.join(args.dataset_path, 'folds') + fold_files = sorted([f for f in os.listdir(fold_dir) if f.endswith('.parquet')]) + n_folds = len(fold_files) // 2 + + # Find maximum peptide length across all datasets + max_peptide_length = 0 + max_mhc_length = 36 # Fixed for now + + print("Scanning datasets for maximum peptide length...") + all_parquet_files = [ + os.path.join(args.dataset_path, "test1.parquet"), + os.path.join(args.dataset_path, "test2.parquet") + ] + + # Add fold files + for i in range(1, n_folds + 1): + all_parquet_files.extend([ + os.path.join(fold_dir, f'fold_{i}_train.parquet'), + os.path.join(fold_dir, f'fold_{i}_val.parquet') + ]) + + for pq_file in all_parquet_files: + if os.path.exists(pq_file): + metadata = get_dataset_metadata(pq_file) + max_peptide_length = max(max_peptide_length, metadata['max_peptide_length']) + print( + f" {os.path.basename(pq_file)}: max_len={metadata['max_peptide_length']}, rows={metadata['total_rows']}") + + print(f"✓ Maximum peptide length across all datasets: {max_peptide_length}") + + # Create fold datasets and class weights + folds = [] + class_weights = [] + + for i in range(1, n_folds + 1): + print(f"\nProcessing fold {i}/{n_folds}") + train_path = os.path.join(fold_dir, f'fold_{i}_train.parquet') + val_path = os.path.join(fold_dir, f'fold_{i}_val.parquet') + + # Calculate class weights from training data + print(f" Calculating class weights...") + cw = calculate_class_weights(train_path) + print(f" Class weights: {cw}") + + # Create streaming datasets + train_ds = (create_streaming_dataset(train_path, max_peptide_length, max_mhc_length, + buffer_size=args.buffer_size) + .shuffle(buffer_size=args.buffer_size, reshuffle_each_iteration=True) + .batch(args.batch) + .take(args.test_batches) + .prefetch(tf.data.AUTOTUNE)) + + val_ds = (create_streaming_dataset(val_path, max_peptide_length, max_mhc_length, + buffer_size=args.buffer_size) + .batch(args.batch) + .take(args.test_batches) + .prefetch(tf.data.AUTOTUNE)) + + folds.append((train_ds, val_ds)) + class_weights.append(cw) + + # Force cleanup + cleanup_memory() + + # Create test datasets + print("Creating test datasets...") + test1_ds = (create_streaming_dataset(os.path.join(args.dataset_path, "test1.parquet"), + max_peptide_length, max_mhc_length, buffer_size=args.buffer_size) + .batch(args.batch) + .prefetch(tf.data.AUTOTUNE)) + + test2_ds = (create_streaming_dataset(os.path.join(args.dataset_path, "test2.parquet"), + max_peptide_length, max_mhc_length, buffer_size=args.buffer_size) + .batch(args.batch) + .prefetch(tf.data.AUTOTUNE)) + + print(f"✓ Created {n_folds} fold datasets and 2 test datasets") + print("Memory after dataset creation:") + monitor_memory() + + # Training loop + print("\n" + "=" * 60) + print("STARTING TRAINING") + print("=" * 60) + + for fold_id, ((train_loader, val_loader), class_weight) in enumerate(zip(folds, class_weights), start=1): + print(f'\n🔥 Training fold {fold_id}/{n_folds}') + + # Clean up before each fold + cleanup_memory() + + # Build fresh model for each fold + print("Building model...") + model, attn_model = build_reconstruction_model(max_peptide_length, max_mhc_length) + model.summary() + + # Callbacks + ckpt_cb = tf.keras.callbacks.ModelCheckpoint( + filepath=os.path.join(run_dir, f'best_fold_{fold_id}.weights.h5'), + monitor='val_loss', save_best_only=True, mode='min', verbose=1) + early_cb = tf.keras.callbacks.EarlyStopping( + monitor='val_loss', patience=15, restore_best_weights=True, verbose=1) + + # Verify data shapes + for (x_pep, latents), labels, sw in train_loader.take(1): + print(f"✓ Input shapes: peptide={x_pep.shape}, mhc={latents.shape}, labels={labels.shape}") + break + + print("Memory before training:") + monitor_memory() + + # Train model + print("🚀 Starting training...") + hist = model.fit(train_loader, + validation_data=val_loader, + epochs=args.epochs, + verbose=1) + + print("Memory after training:") + monitor_memory() + + # Plot training curves + #plot_training_curve(hist, run_dir, fold_id, model, val_loader) + #plot_attn(attn_model, val_loader, run_dir, fold_id) + + # Save model and metadata + model.save_weights(os.path.join(run_dir, f'model_fold_{fold_id}.weights.h5')) + metadata = { + "fold_id": fold_id, + "epochs": args.epochs, + "batch_size": args.batch, + "max_peptide_length": max_peptide_length, + "max_mhc_length": max_mhc_length, + "class_weights": class_weight, + "run_dir": run_dir, + "mhc_class": MHC_CLASS + } + with open(os.path.join(run_dir, f'metadata_fold_{fold_id}.json'), 'w') as f: + json.dump(metadata, f, indent=4) + + # Evaluate on test sets + print(f"\n📊 Evaluating fold {fold_id} on test sets...") + + # Test1 evaluation + print("Evaluating on test1 (balanced alleles)...") + #plot_test_metrics(model, test1_ds, run_dir, fold_id, string="Test1_balanced_alleles") + + # Test2 evaluation + print("Evaluating on test2 (rare alleles)...") + #plot_test_metrics(model, test2_ds, run_dir, fold_id, string="Test2_rare_alleles") + + print(f"✅ Fold {fold_id} completed successfully") + + # Cleanup + del model, hist + cleanup_memory() + + print("\n🎉 Training completed successfully!") + print(f"📁 All results saved to: {run_dir}") + + +if __name__ == "__main__": + BUFFER = 8192 # Reduced buffer size for memory efficiency + MHC_CLASS = 2 + dataset_path = f"../data/Custom_dataset/NetMHCpan_dataset/mhc_{MHC_CLASS}" + main([ + "--dataset_path", dataset_path, + "--epochs", "10", + "--batch", "32", + "--buffer_size", "8192", + "--test_batches", "500", + ]) \ No newline at end of file diff --git a/src/run_pMHC_DL_ESM.py b/src/run_pMHC_DL_ESM.py index 2c959c9b3..8866e6315 100644 --- a/src/run_pMHC_DL_ESM.py +++ b/src/run_pMHC_DL_ESM.py @@ -748,5 +748,5 @@ def main(argv=None): main([ # "--parquet", "../data/Custom_dataset/NetMHCpan_dataset/mhc_2/mhc2_with_esm_embeddings.parquet", "--dataset_path", "../data/Custom_dataset/NetMHCpan_dataset/mhc_2", - "--epochs", "100", "--batch", "128" + "--epochs", "3", "--batch", "32" ]) \ No newline at end of file diff --git a/utils/create_ESM_dataset.py b/utils/create_ESM_dataset.py index 0bea18a1a..6201ba36a 100644 --- a/utils/create_ESM_dataset.py +++ b/utils/create_ESM_dataset.py @@ -14,7 +14,7 @@ import pandas as pd from tqdm import tqdm # progress bars from typing import Dict -from utils.processing_functions import create_progressive_k_fold_cross_validation, create_k_fold_leave_one_out_stratified_cv +from processing_functions import create_progressive_k_fold_cross_validation, create_k_fold_leave_one_out_stratified_cv # --------------------------------------------------------------------- # 1. CONFIGURATION – adjust if your paths change diff --git a/utils/model_archive.py b/utils/model_archive.py index ef8772218..c76ecea5f 100644 --- a/utils/model_archive.py +++ b/utils/model_archive.py @@ -759,5 +759,80 @@ def build_custom_classifier(max_len_peptide: int = 50, # # plt.show() # plt.savefig("model_output/auc_plot.png") # + +# def test1(): +# import matplotlib.pyplot as plt +# import seaborn as sns +# import numpy as np +# +# max_len_peptide = 50 # Maximum length of peptide sequences +# max_len_mhc = 200 # Maximum length of MHC sequences +# k = 9 # Length of peptide k-mers +# batch = 5 # Number of samples to generate +# RF_max = max_len_peptide - k + 1 # Number of RF tokens +# +# # Build and summarize model +# model = build_custom_classifier(max_len_peptide, max_len_mhc, k=k, +# mask_token=MASK_TOKEN, pad_token=PAD_TOKEN) +# model.summary(line_length=110) +# +# # Generate synthetic peptide input and MHC input +# pep_syn = generate_peptide(samples=batch, min_len=9, max_len=max_len_peptide, k=k) +# mhc_syn, _, _ = generate_mhc(samples=batch, min_len=25, max_len=max_len_mhc, dim=1152) +# +# # For demonstration, we perform one prediction without training. +# # In practice, you would train the model and then run prediction. +# preds = model.predict([pep_syn, mhc_syn]) +# print("Overall Predictions (binding probability) per sample:") +# for i, pred in enumerate(preds): +# print(f"Sample {i + 1}: Probability = {pred[0]:.4f}") +# +# # ----- Extract attention weights from the final self-attention layer ----- +# # We know that final self-attention is applied with return_att_weights=True +# # and its name is 'final_pep_self_att' +# # Its output is a tuple: (final_features, att_weights) +# # We create a new model with the same inputs but outputting the attention tuple. +# final_att_layer = model.get_layer("final_pep_self_att") +# att_model = keras.Model(inputs=model.inputs, outputs=final_att_layer.output) +# +# # Run the synthetic data through the attention model +# # Note: Depending on your model, the layer returns a tuple. +# att_outputs = att_model.predict([pep_syn, mhc_syn]) +# # att_outputs is a tuple: (final_features, att_weights) +# # final_features: shape (B, RF, output_dim) +# # att_weights: shape (heads, B, RF, RF) [RF tokens attend to RF tokens] +# final_features, att_weights = att_outputs +# att_weights = np.array(att_weights) # ensure numpy array +# +# # Average attention weights over heads +# # New shape: (B, RF, RF) +# att_avg = np.mean(att_weights, axis=0) +# +# # For each sample and each row in the RF dimension, determine the index that got the highest attention. +# print("\nAttention analysis per sample and per RF row:") +# for sample in range(batch): +# print(f"\nSample {sample + 1}:") +# for i in range(RF_max): +# att_row = att_avg[sample, i, :] +# # To ignore padded positions (if any), you might add a threshold. Here we just take argmax. +# max_ind = np.argmax(att_row) +# max_val = att_row[max_ind] +# print(f" RF row {i}: highest attention on row {max_ind} (value = {max_val:.4f})") +# +# # ----- Visualization ----- +# # For one sample (say sample 0), plot a heatmap of the averaged attention matrix. +# sample_to_plot = 0 +# plt.figure(figsize=(6, 5)) +# sns.heatmap(att_avg[sample_to_plot], annot=True, cmap="viridis", +# xticklabels=[f"r{j}" for j in range(RF_max)], +# yticklabels=[f"r{i}" for i in range(RF_max)]) +# plt.title("Averaged Attention Weights (over heads) for Sample 1") +# plt.xlabel("Attended RF row") +# plt.ylabel("Query RF row") +# plt.tight_layout() +# plt.savefig("model_output/attention_heatmap_sample1.png") +# plt.show() +# print("Attention heatmap saved to 'model_output/attention_heatmap_sample1.png'") + # if __name__ == "__main__": # main() diff --git a/utils/visualize_tensorflow_model.py b/utils/visualize_tensorflow_model.py index d3c7c99c4..20514733c 100644 --- a/utils/visualize_tensorflow_model.py +++ b/utils/visualize_tensorflow_model.py @@ -30,7 +30,7 @@ def fn(**config): 'model_output/peptide_mhc_cross_attention_model.h5', custom_objects={ 'AttentionLayer': wrap_layer(AttentionLayer), - 'RotaryPositionalEncoding': wrap_layer(RotaryPositionalEncoding), + 'PositionalEncoding': wrap_layer(PositionalEncoding), 'AnchorPositionExtractor': wrap_layer(AnchorPositionExtractor), } ) From 1376b71a69dc12ac0a6592dad23342ff75f4bd3f Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 26 Jun 2025 15:52:41 +0200 Subject: [PATCH 76/83] =?UTF-8?q?add=20end-to-end=20trainer=20for=20peptid?= =?UTF-8?q?e=C3=97MHC=20SCQ-VAE=20clustering=20with=20visualization?= MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit --- src/run_SCQ_VAE.py | 685 +++++++++++++++++++++++++++++++++++++++++++++ 1 file changed, 685 insertions(+) create mode 100644 src/run_SCQ_VAE.py diff --git a/src/run_SCQ_VAE.py b/src/run_SCQ_VAE.py new file mode 100644 index 000000000..850a6c733 --- /dev/null +++ b/src/run_SCQ_VAE.py @@ -0,0 +1,685 @@ +#!/usr/bin/env python +""" +========================= + +End‑to‑end trainer for a **peptide×MHC SCQ-VAE clustering**. +For each fold, load cross_latents.npz containing cross-atnn and mhc_ids, and labels. +train and evaluate SCQ-VAE model on the cross-attn data. +Visualize the results with t-SNE and UMAP with mhc_ids and labels. + +Author: Amirreza (memory-optimized version, 2025) +""" +import os +import time + +import numpy as np +import pandas as pd +import tensorflow as tf +from matplotlib import pyplot as plt +from tensorflow.keras import layers +from sklearn.manifold import TSNE +from sklearn.decomposition import PCA +from sklearn.preprocessing import StandardScaler +import umap +from tqdm import tqdm +from utils.model import SCQ1DAutoEncoder +from sklearn.cluster import KMeans + +# Enable eager execution explicitly to resolve graph mode issues +tf.config.run_functions_eagerly(True) +from tensorflow import keras + +# Global random state for reproducibility +random_state = 42 + +def load_cross_latents_data(file_path): + """Load cross-attention data from a .npz file.""" + data = np.load(file_path) + cross_latents = data['cross_latents'] + mhc_ids = data['mhc_ids'] + labels = data['labels'] + return cross_latents, mhc_ids, labels # (N, seq_length, embedding_dim), (N,), (N,) + +def create_dataset(cross_latents, labels=None): + """Create a TensorFlow dataset from cross-latents data.""" + if labels is None: + dataset = tf.data.Dataset.from_tensor_slices(tf.cast(cross_latents, tf.float32)) + else: + # Cast features to float32 + features = tf.cast(cross_latents, tf.float32) + labels = tf.cast(labels, tf.float32) + dataset = tf.data.Dataset.from_tensor_slices((features, labels)) + + return dataset + +def initialize_codebook_with_kmeans(X_train, num_embeddings, embedding_dim): + """Initialize codebook vectors using k-means clustering.""" + kmeans = KMeans(n_clusters=num_embeddings, random_state=random_state) + flat_data = X_train.reshape(-1, X_train.shape[-1]) + kmeans.fit(flat_data) + return kmeans.cluster_centers_.astype(np.float32) + +# Visualization functions +def plot_training_metrics(history, save_path=None): + """Plot training and validation loss and accuracy.""" + return + + +def plot_reconstructions(original, reconstructed, n_samples=5, save_path=None, visualize=True): + """Plot comparison between original and reconstructed sequences.""" + n_samples = min(n_samples, len(original)) + plt.figure(figsize=(15, 3 * n_samples)) + for i in range(n_samples): + plt.subplot(n_samples, 2, 2 * i + 1) + plt.plot(original[i]) + plt.title(f"Original Sequence {i + 1}") + plt.grid(True) + plt.subplot(n_samples, 2, 2 * i + 2) + plt.plot(reconstructed[i]) + plt.title(f"Reconstructed Sequence {i + 1}") + plt.grid(True) + plt.tight_layout() + if save_path: + plt.savefig(save_path) + if visualize: + plt.show() + else: + plt.close() + + +def plot_codebook_usage(indices, num_embeddings, save_path=None, visualize=True): + """Visualize the usage distribution of codebook vectors. + + Args: + indices: Hard indices from model output (integer indices of assigned codes) + num_embeddings: Total number of vectors in the codebook + save_path: Path to save the visualization + + Returns: + used_vectors: Number of vectors used + usage_percentage: Percentage of codebook utilized + """ + # Convert from tensor to numpy if needed + if isinstance(indices, tf.Tensor): + indices = indices.numpy() + + # Ensure indices is a NumPy array before proceeding + if not isinstance(indices, np.ndarray): + try: + # Attempt conversion if it's list-like + indices = np.array(indices) + except Exception as e: + print( + f"Error in plot_codebook_usage: Input 'indices' is not a NumPy array or convertible. Type: {type(indices)}. Error: {e}") + # Return default values or raise an error + return 0, 0.0 + + # Flatten indices to 1D array for counting + try: + flat_indices = indices.flatten() + except AttributeError: + print(f"Error in plot_codebook_usage: Cannot flatten 'indices'. Type: {type(indices)}") + return 0, 0.0 # Return default values + + # Count occurrences of each codebook vector + try: + unique, counts = np.unique(flat_indices, return_counts=True) + except TypeError as e: + print( + f"Error in plot_codebook_usage: Cannot compute unique values for 'flat_indices'. Type: {type(flat_indices)}. Error: {e}") + return 0, 0.0 # Return default values + + # Create full distribution including zeros for unused vectors + full_distribution = np.zeros(num_embeddings) + for idx, count in zip(unique, counts): + if 0 <= idx < num_embeddings: # Ensure index is valid + full_distribution[int(idx)] = count + + # Calculate usage statistics + used_vectors = np.sum(full_distribution > 0) + usage_percentage = (used_vectors / num_embeddings) * 100 + + # Create the plot + plt.figure(figsize=(12, 6)) + bar_positions = np.arange(num_embeddings) + bars = plt.bar(bar_positions, full_distribution) + + # Color bars by frequency + max_count = np.max(full_distribution) + if max_count > 0: + for i, bar in enumerate(bars): + intensity = full_distribution[i] / max_count + bar.set_color(plt.cm.viridis(intensity)) + + plt.xlabel('Codebook Vector Index') + plt.ylabel('Usage Count') + plt.title( + f'Codebook Vector Usage Distribution\n{used_vectors}/{num_embeddings} vectors used ({usage_percentage:.1f}%)') + plt.grid(axis='y', linestyle='--', alpha=0.7) + + # Add colorbar + sm = plt.cm.ScalarMappable(cmap=plt.cm.viridis, norm=plt.Normalize(0, max_count)) + sm.set_array([]) + cbar = plt.colorbar(sm, ax=plt.gca()) + cbar.set_label('Frequency') + plt.tight_layout() + + if save_path: + plt.savefig(save_path) + print(f"Codebook usage: {used_vectors}/{num_embeddings} vectors used ({usage_percentage:.1f}%)") + if visualize: + plt.show() + else: + plt.close() + return used_vectors, usage_percentage + + +def plot_soft_cluster_distribution(soft_cluster_probs, num_samples=None, save_path=None, visualize=True): + """ + Visualize the distribution of soft clustering probabilities across samples. + + Args: + soft_cluster_probs: List of arrays or single array containing probability + distributions across clusters for each sample + num_samples: Number of samples to visualize (default: 10) + save_path: Path to save the visualization (default: None) + + Returns: + None + """ + if num_samples is None: + num_samples = len(soft_cluster_probs) + # Process input to get a clean 2D array (samples x clusters) + if isinstance(soft_cluster_probs, list): + if not soft_cluster_probs: + print("Warning: Empty list provided to plot_soft_cluster_distribution") + return + sample_batch = soft_cluster_probs[0] + if isinstance(sample_batch, tf.Tensor): + sample_batch = sample_batch.numpy() + soft_cluster_probs = sample_batch + elif isinstance(soft_cluster_probs, tf.Tensor): + soft_cluster_probs = soft_cluster_probs.numpy() + + # Reshape if needed + if soft_cluster_probs.ndim > 2: + print(f"Reshaping array from shape {soft_cluster_probs.shape} to 2D format") + if soft_cluster_probs.shape[1] == 1: + soft_cluster_probs = soft_cluster_probs.reshape(soft_cluster_probs.shape[0], + soft_cluster_probs.shape[2]) + else: + soft_cluster_probs = soft_cluster_probs.reshape(soft_cluster_probs.shape[0], -1) + + # Verify valid data + if soft_cluster_probs.size == 0: + print("Warning: Empty array provided to plot_soft_cluster_distribution") + return + + n_samples = min(len(soft_cluster_probs), 1000) # Limit to prevent memory issues + n_clusters = soft_cluster_probs.shape[1] + + # Create a figure with 2 subplots + fig, (ax1, ax2) = plt.subplots(2, 1, figsize=(14, 12), gridspec_kw={'height_ratios': [2, 1]}) + + # 1. Heatmap visualization (top) + display_samples = min(num_samples, n_samples) + im = ax1.imshow(soft_cluster_probs[:display_samples], aspect='auto', cmap='viridis') + ax1.set_xlabel('Cluster Index') + ax1.set_ylabel('Sample Index') + ax1.set_title(f'Soft Cluster Probability Heatmap (First {display_samples} Samples)') + plt.colorbar(im, ax=ax1, label='Probability') + + # 2. Aggregated statistics (bottom) + # Calculate statistics across all samples for each cluster + cluster_means = np.mean(soft_cluster_probs, axis=0) + cluster_max_counts = np.sum(np.argmax(soft_cluster_probs, axis=1)[:, np.newaxis] == np.arange(n_clusters), axis=0) + + # Create a twin axis for the bar plot + ax2_twin = ax2.twinx() + + # Plot mean probability for each cluster (line) + x = np.arange(n_clusters) + ax2.plot(x, cluster_means, 'r-', linewidth=2, label='Mean Probability') + ax2.set_ylabel('Mean Probability', color='r') + ax2.tick_params(axis='y', labelcolor='r') + ax2.set_ylim(0, max(cluster_means) * 1.2) + + # Plot histogram of cluster assignments (bars) + ax2_twin.bar(x, cluster_max_counts, alpha=0.3, label='Assignment Count') + ax2_twin.set_ylabel('Number of Samples\nwith Highest Probability', color='b') + ax2_twin.tick_params(axis='y', labelcolor='b') + + # Add labels and grid + ax2.set_xlabel('Cluster Index') + ax2.set_title('Cluster Usage Statistics Across All Samples') + ax2.set_xticks(np.arange(0, n_clusters, max(1, n_clusters // 20))) + ax2.grid(True, linestyle='--', alpha=0.5, axis='y') + + # Create custom legend + lines, labels = ax2.get_legend_handles_labels() + lines2, labels2 = ax2_twin.get_legend_handles_labels() + ax2.legend(lines + lines2, labels + labels2, loc='upper right') + + # Add overall statistics as text + active_clusters = np.sum(np.max(soft_cluster_probs, axis=0) > 0.01) + most_used_cluster = np.argmax(cluster_max_counts) + ax2.text(0.02, 0.95, + f"Active clusters: {active_clusters}/{n_clusters} ({active_clusters / n_clusters:.1%})\n" + f"Most used cluster: {most_used_cluster} ({cluster_max_counts[most_used_cluster]} samples)", + transform=ax2.transAxes, verticalalignment='top', + bbox=dict(boxstyle='round', facecolor='white', alpha=0.8)) + + plt.tight_layout() + + # Save if path is provided + if save_path: + plt.savefig(save_path, dpi=150, bbox_inches='tight') + + # Show or close based on global visualize flag + if visualize: + plt.show() + else: + plt.close() + + +def plot_cluster_distribution(soft_cluster_probs, save_path=None, visualize=True): + """ + Plot distribution of samples across clusters based on one-hot encodings. + + Args: + soft_cluster_probs: Soft cluster probabilities + save_path: Path to save the plot + + Returns: + used_clusters: Number of clusters used + usage_percentage: Percentage of clusters used + """ + # Convert soft cluster probabilities to one-hot encodings + one_hot_encodings = tf.one_hot(tf.argmax(soft_cluster_probs, axis=-1), depth=soft_cluster_probs.shape[-1]) + one_hot_encodings = tf.cast(one_hot_encodings, tf.float32) + + # print(f"one_hot_encodings shape: {one_hot_encodings.shape}") + # print first 5 values + # print(f"one_hot_encodings values: {one_hot_encodings[:5]}") + + # Convert one-hot to cluster indices if needed + if isinstance(one_hot_encodings, tf.Tensor): + one_hot_encodings = one_hot_encodings.numpy() + + # Handle different shapes of one_hot_encodings + if len(one_hot_encodings.shape) == 3: # (batch, seq_len, num_embeddings) + cluster_assignments = np.argmax(one_hot_encodings, axis=-1).flatten() + else: # (batch, num_embeddings) + cluster_assignments = np.argmax(one_hot_encodings, axis=-1).flatten() + + # Count occurrences of each cluster + unique_clusters, counts = np.unique(cluster_assignments, return_counts=True) + + # Create a full distribution including zeros for unused clusters + num_clusters = one_hot_encodings.shape[-1] + full_distribution = np.zeros(num_clusters) + for cluster, count in zip(unique_clusters, counts): + full_distribution[cluster] = count + + # Calculate usage statistics + used_clusters = np.sum(full_distribution > 0) + usage_percentage = (used_clusters / num_clusters) * 100 + + # Create the plot + plt.figure(figsize=(12, 6)) + bars = plt.bar(np.arange(num_clusters), full_distribution) + + # Color bars by frequency + max_count = np.max(full_distribution) + if max_count > 0: + for i, bar in enumerate(bars): + intensity = full_distribution[i] / max_count + bar.set_color(plt.cm.plasma(intensity)) + + plt.xlabel('Cluster Index') + plt.ylabel('Number of Samples') + plt.title( + f'Sample Distribution Across Clusters\n{used_clusters}/{num_clusters} clusters used ({usage_percentage:.1f}%)') + plt.grid(axis='y', linestyle='--', alpha=0.7) + + # Add a colorbar + sm = plt.cm.ScalarMappable(cmap=plt.cm.plasma, norm=plt.Normalize(0, max_count)) + sm.set_array([]) + cbar = plt.colorbar(sm, ax=plt.gca()) + cbar.set_label('Sample Count') + + plt.tight_layout() + + if save_path: + plt.savefig(save_path) + print(f"Cluster usage: {used_clusters}/{num_clusters} clusters contain samples ({usage_percentage:.1f}%)") + if visualize: + plt.show() + else: + plt.close() + return used_clusters, usage_percentage + +def plot_tsne_umap(cross_latents, mhc_ids, labels, save_path=None): + """Plot t-SNE and UMAP visualizations of the cross-latents.""" + # Standardize the data + scaler = StandardScaler() + cross_latents_scaled = scaler.fit_transform(cross_latents) + + # t-SNE + tsne = TSNE(n_components=2, random_state=random_state) + tsne_results = tsne.fit_transform(cross_latents_scaled) + + # Plotting + import matplotlib.pyplot as plt + + plt.figure(figsize=(12, 6)) + + # t-SNE plot + plt.subplot(1, 2, 1) + plt.scatter(tsne_results[:, 0], tsne_results[:, 1], c=labels, cmap='viridis', s=5) + plt.title('t-SNE Visualization') + plt.colorbar(label='Labels') + + if save_path: + plt.savefig(save_path) + print(f"Plots saved to {save_path}") + + plt.show() + + +def plot_PCA(cross_latents, mhc_ids=None, labels=None, save_path=None): + """Plot PCA visualization of the cross-latents with optional label highlighting.""" + + # reduce dimensions if necessary + if cross_latents.ndim > 2: + # Flatten the cross_latents to ensure they are 2D (N, seq_length * embedding_dim) + cross_latents = cross_latents.reshape(cross_latents.shape[0], -1) + + # Standardize the data + scaler = StandardScaler() + cross_latents_scaled = scaler.fit_transform(cross_latents) + + # PCA + pca = PCA(n_components=2) + pca_results = pca.fit_transform(cross_latents_scaled) + + # Plotting + import matplotlib.pyplot as plt + import numpy as np + + plt.figure(figsize=(8, 6)) + + if mhc_ids is not None: + # Convert string MHC IDs to categorical indices + unique_mhcs = np.unique(mhc_ids) + mhc_to_index = {mhc: i for i, mhc in enumerate(unique_mhcs)} + numeric_mhc_ids = np.array([mhc_to_index[mhc] for mhc in mhc_ids]) + + # Plot using the numeric encoding + sc = plt.scatter(pca_results[:, 0], pca_results[:, 1], c=numeric_mhc_ids, cmap='viridis', s=5) + plt.colorbar(sc, label='MHC IDs') + + # If not too many unique MHCs, add a legend + if len(unique_mhcs) <= 20: + from matplotlib.lines import Line2D + cmap = plt.cm.get_cmap('viridis', len(unique_mhcs)) + legend_elements = [ + Line2D([0], [0], marker='o', color='w', markerfacecolor=cmap(i), + label=str(mhc.decode('utf-8') if isinstance(mhc, bytes) else mhc), markersize=5) + for i, mhc in enumerate(unique_mhcs) + ] + plt.legend(handles=legend_elements, bbox_to_anchor=(1.05, 1), loc='upper left') + else: + # Default plotting without colors + plt.scatter(pca_results[:, 0], pca_results[:, 1], s=5) + + # Highlight positive labels (value 1) + if labels is not None: + # Flatten and convert labels if needed + if isinstance(labels, (list, np.ndarray)) and len(labels) > 0: + flat_labels = np.asarray(labels).flatten() + # Find indices of points with positive labels (value 1 or close to 1) + positive_indices = np.where(np.isclose(flat_labels, 1.0, atol=0.01))[0] + + if len(positive_indices) > 0: + # Plot circles around positive points + plt.scatter(pca_results[positive_indices, 0], pca_results[positive_indices, 1], + s=30, facecolors='none', edgecolors='orange', linewidths=0.07, + label='Positive Labels') + + # Add a legend entry for positive labels + plt.legend(loc='upper right') + plt.title('PCA Visualization (Red circles: Positive Labels)') + else: + plt.title('PCA Visualization (No positive labels found)') + else: + plt.title('PCA Visualization') + else: + plt.title('PCA Visualization') + + if save_path: + plt.savefig(save_path, bbox_inches='tight') + print(f"PCA plot saved to {save_path}") + + plt.show() + + +def process_and_save(dataset: tf.data.Dataset, + split_name: str, + model: tf.keras.Model, + output_dir: str, + num_embeddings: int, + mhc_ids: np.ndarray = None, + labels: np.ndarray = None): + """ + Quantize `dataset` through `model`, assemble into a DataFrame, + save to parquet, and plot distributions with split-specific filenames. + """ + quantized_latents = [] + cluster_indices_soft = [] + cluster_indices_hard = [] + labels = [] + + # Extract latent codes for every batch + for batch_X, batch_y in dataset: + Zq, out_P_proj, _, _ = model.encode_(batch_X) + quantized_latents.append(Zq.numpy()) + cluster_indices_soft.append(out_P_proj.numpy()) + cluster_indices_hard.append(tf.argmax(out_P_proj, axis=-1).numpy()) + labels.append(batch_y.numpy()) + + # Concatenate across batches + quantized_latent = np.concatenate(quantized_latents, axis=0) + soft_probs = np.concatenate(cluster_indices_soft, axis=0) + hard_assign = np.concatenate(cluster_indices_hard, axis=0) + labels = np.concatenate(labels, axis=0) + + # Build DataFrame + records = [] + for i in range(len(quantized_latent)): + rec = {} + flat_latent = quantized_latent[i].flatten() + for j, v in enumerate(flat_latent): + rec[f'latent_{j}'] = float(v) + + flat_soft = soft_probs[i].flatten() + for j, v in enumerate(flat_soft): + rec[f'soft_cluster_{j}'] = float(v) + + rec['hard_cluster'] = int(hard_assign[i]) + # binding label if available + if i < len(labels): + lbl = labels[i] + # Handle scalar, 0-dim, or 1-dim arrays + if isinstance(lbl, (np.ndarray, list)) and np.asarray(lbl).size > 0: + rec['binding_label'] = float(np.asarray(lbl).flatten()[0]) + else: + rec['binding_label'] = float(lbl) + else: + rec['binding_label'] = np.nan + records.append(rec) + + df = pd.DataFrame(records) + # ensure output directory exists + os.makedirs(output_dir, exist_ok=True) + + # Save parquet + parquet_path = os.path.join(output_dir, f'quantized_outputs_{split_name}.parquet') + df.to_parquet(parquet_path, index=False) + print(f"[{split_name}] saved parquet → {parquet_path}") + + # Plot distributions + plot_cluster_distribution(soft_probs, + save_path=os.path.join(output_dir, f'cluster_distribution_soft_{split_name}.png')) + plot_codebook_usage(hard_assign, num_embeddings, + save_path=os.path.join(output_dir, f'codebook_usage_{split_name}.png')) + plot_soft_cluster_distribution(soft_probs, 20, + save_path=os.path.join(output_dir, + f'soft_cluster_distribution_{split_name}.png')) + + # visualize PCA with label highlights + print(quantized_latent.shape) + # Pass both mhc_ids and labels to plot_PCA + plot_PCA(quantized_latent, + save_path=os.path.join(output_dir, f'quantized_latents_pca_{split_name}.png'), + mhc_ids=mhc_ids, + labels=labels) # Add labels parameter + + + + # visualize by hard cluster assignments + plot_PCA(quantized_latent, + save_path=os.path.join(output_dir, f'quantized_latents_pca_hard_{split_name}.png'), + mhc_ids=hard_assign.flatten(), + labels=labels) # Add labels parameter + + + +def main(): + # --- Configuration --- + num_embeddings = 16 # Number of embeddings in the codebook + embedding_dim = 4 # Dimension of each embedding vector + commitment_beta = 0.25 # Commitment loss weight + batch_size = 32 # Batch size for training + epochs = 3 # Number of training epochs + learning_rate = 1e-3 # Learning rate for the optimizer + + cross_latents_file = 'runs/run_20250626-114618/cross_latent_test1_fold_1.npz' # Path to the cross-attention data file + val_file = 'runs/run_20250626-114618/cross_latent_test2_fold_1.npz' # Path to the validation data file (if needed) + save_dir = 'runs/run_20250626-114618/scq' # Directory to save results and plots + os.makedirs(save_dir, exist_ok=True) + + # --- Load Cross-Attention Data --- + print("Loading cross-attention data...") + cross_latents, mhc_ids, labels = load_cross_latents_data(cross_latents_file) + print("Cross-latents shape:", cross_latents.shape) + # flatten the cross_latents to ensure they are 2D (N, seq_length * embedding_dim) + cross_latents = cross_latents.reshape(cross_latents.shape[0], -1) # Flatten to (N, seq_length * embedding_dim) + seq_length = cross_latents.shape[1] # Length of the sequences + + val_latents, val_mhc_ids, val_labels = load_cross_latents_data(val_file) + if val_latents is not None: + print("Validation cross-latents shape:", val_latents.shape) + val_latents = val_latents.reshape(val_latents.shape[0], -1) + else: + print("No validation data found, proceeding without validation set.") + val_latents, val_mhc_ids, val_labels = None, None, None + + + # --- Create TensorFlow Dataset --- + print("Creating TensorFlow dataset...") + dataset = create_dataset(cross_latents, labels) + dataset = dataset.batch(batch_size).prefetch(tf.data.AUTOTUNE) + # drop labels + dataset_train = create_dataset(cross_latents) + dataset_train = dataset_train.batch(batch_size).prefetch(tf.data.AUTOTUNE) # Batch and prefetch for performance + print("Dataset created with {} batches.".format(len(dataset))) + # --- Print Dataset Information --- + print("Cross-latents shape:", cross_latents.shape) + print("MHC IDs shape:", mhc_ids.shape) + print("Labels shape:", labels.shape) + print("Sequence length:", seq_length) + + # Visualize raw cross-latents data + print("Visualizing raw cross-latents data with PCA...") + plot_PCA(cross_latents, mhc_ids, save_path=os.path.join(save_dir, 'cross_latents_pca.png'), labels=labels) + print("Visualizing cross-latents data with t-SNE and UMAP...") + + # --- Initialize Codebook --- + print("Initializing codebook with k-means...") + codebook_init = initialize_codebook_with_kmeans(cross_latents, num_embeddings, embedding_dim) + print("Codebook initialized with shape:", codebook_init.shape) + + # --- Model Instantiation --- + print("Building the SCQ1DAutoEncoder model...") + input_shape = (seq_length,) + # Print detailed information about input dimensions + print(f"Input shape being passed to model: {input_shape}") + print(f"Expected embedding_dim: {embedding_dim}") + print(f"Actual shape of cross_latents: {cross_latents.shape}") + + # Check if the embedding_dim needs adjustment based on the actual data + if embedding_dim != cross_latents.shape[-1]: + print(f"Warning: Adjusting embedding_dim from {embedding_dim} to match data: {cross_latents.shape[-1]}") + embedding_dim = cross_latents.shape[-1] + + model = SCQ1DAutoEncoder( + input_dim=input_shape, + num_embeddings=num_embeddings, + embedding_dim=embedding_dim, + commitment_beta=commitment_beta, + scq_params={ + 'lambda_reg': 1.0, + 'discrete_loss': False, + 'reset_dead_codes': True, + 'usage_threshold': 1e-4, + 'reset_interval': 5 + }, + cluster_lambda=1 + ) + print("Model built.") + model.compile(optimizer=tf.keras.optimizers.Adam(learning_rate=learning_rate)) + + # --- Training the Model --- + print("Starting training...") + print(f"Training on balanced set for {epochs} epochs...") + start_time = time.time() + history = model.fit( + dataset_train, + validation_data=val_latents, + epochs=epochs, + ) + end_time = time.time() + print(f"Balanced training finished in {end_time - start_time:.2f} seconds.") + + # --- Save the Model --- + model_save_path = os.path.join(save_dir, 'scq_vae_model.h5') + print(f"Saving the model to {model_save_path}...") + model.save(model_save_path) + print("Model saved successfully.") + + # --- Evaluate the Model --- + print("Evaluating the model...") + val_latents = None + val_dataset = None + if val_latents is not None: + val_dataset = create_dataset(val_latents, val_labels).batch(batch_size) + evaluation_results = model.evaluate(val_dataset) + print(f"Validation Loss: {evaluation_results[0]}, Validation Accuracy: {evaluation_results[1]}") + else: + print("No validation data provided, skipping evaluation.") + print("Model evaluation completed.") + + # --- Visualize Results --- + print("Visualizing results...") + process_and_save(dataset, 'train', model, save_dir, num_embeddings, mhc_ids) + if val_dataset is not None: + process_and_save(val_dataset, 'val', model, save_dir, num_embeddings, val_mhc_ids) + + print("Results visualization is not implemented yet.") + print("End-to-end training completed successfully.") + print("You can now proceed with further analysis or visualization of the model outputs.") + # --- End of Main Function --- + +if __name__ == "__main__": + main() \ No newline at end of file From 33cb6be641e0620104fbd09d99d102ed368340e3 Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 26 Jun 2025 15:52:54 +0200 Subject: [PATCH 77/83] refactor: enhance peptide and MHC processing with improved padding and attention visualization --- src/run_model3.py | 193 +++++++++++++++++++++++++++++++++++----------- 1 file changed, 147 insertions(+), 46 deletions(-) diff --git a/src/run_model3.py b/src/run_model3.py index 1f8c899aa..46caa40fc 100644 --- a/src/run_model3.py +++ b/src/run_model3.py @@ -112,14 +112,19 @@ def cleanup_memory(): # ---------------------------------------------------------------------------- AA = "ACDEFGHIKLMNPQRSTVWY" # 20 standard AAs, order fixed AA_TO_IDX = {aa: i for i, aa in enumerate(AA)} -UNK_IDX = 20 # index for unknown / padding +UNK_IDX = 20 # index for unknown +PAD_TOKEN = -2 # set manually to avoid confusion with UNK def peptides_to_onehot(sequence: str, max_seq_len: int) -> np.ndarray: """Convert peptide sequence to one-hot encoding""" - arr = np.zeros((max_seq_len, 21), dtype=np.float32) + arr = np.full((max_seq_len, 21), PAD_TOKEN, dtype=np.float32) # initialize padding with -2 for j, aa in enumerate(sequence.upper()[:max_seq_len]): arr[j, AA_TO_IDX.get(aa, UNK_IDX)] = 1.0 + # print number of UNKs in the sequence + num_unks = np.sum(arr[:, UNK_IDX]) + if num_unks > 0: + print(f"Warning: {num_unks} unknown amino acids in sequence '{sequence}'") return arr @@ -241,6 +246,15 @@ def _row_to_tensor_pack(row_dict: dict, max_pep_seq_len: int, max_mhc_len: int): # --- load MHC embedding -------------------------------------------- mhc = _read_embedding_file(row_dict["mhc_embedding_path"]) + # pad MHC to max_mhc_len if needed + if mhc.shape[0] < max_mhc_len: + pad_mhc = np.full((max_mhc_len, mhc.shape[1]), PAD_TOKEN, dtype=np.float32) + pad_mhc[:mhc.shape[0]] = mhc + mhc = pad_mhc + elif mhc.shape[0] > max_mhc_len: + raise ValueError( + f"MHC length {mhc.shape[0]} exceeds max_mhc_len {max_mhc_len} for row: {row_dict}") + if mhc.shape[0] != max_mhc_len: # sanity check raise ValueError(f"MHC length mismatch: {mhc.shape[0]} vs {max_mhc_len}") @@ -280,8 +294,10 @@ def streaming_data_generator( # Parallel map; chunksize tuned for large batches results = pool.map(worker_fn, rows_iter, chunksize=64) - # Stream each converted sample back to the generator consumer - yield from results # <-- keeps memory footprint tiny + # # Stream each converted sample back to the generator consumer + # yield from results # <-- keeps memory footprint tiny + for result, sample_id in zip(results, dict_rows["allele"]): + yield result + (sample_id,) # explicit clean-up del batch_df, dict_rows, rows_iter, results @@ -303,9 +319,11 @@ def create_streaming_dataset(parquet_path: str, tf.TensorSpec(shape=(max_mhc_len, 1152), dtype=tf.float32), ), tf.TensorSpec(shape=(), dtype=tf.float32), + tf.TensorSpec(shape=(), dtype=tf.string), # MHC allele ID ) - ds = tf.data.Dataset.from_generator( + # Create raw dataset with features, label, and IDs + raw_ds = tf.data.Dataset.from_generator( lambda: streaming_data_generator( parquet_path, max_pep_seq_len, @@ -314,18 +332,48 @@ def create_streaming_dataset(parquet_path: str, output_signature=output_signature, ) - # ► Parallel interleave gives another speed-up if the Parquet file has - # many row-groups – adjust cycle_length as needed. - ds = ds.interleave( - lambda x, y: tf.data.Dataset.from_tensors((x, y)), + # Parallel interleave for speed + raw_ds = raw_ds.interleave( + lambda feats, label, mhc_id: tf.data.Dataset.from_tensors((feats, label, mhc_id)), cycle_length=tf.data.AUTOTUNE, num_parallel_calls=tf.data.AUTOTUNE, deterministic=False, ) - return ds + # Separate dataset and IDs + ds = raw_ds.map(lambda feats, label, _: (feats, label), + num_parallel_calls=tf.data.AUTOTUNE) + ids_ds = raw_ds.map(lambda _, __, mhc_id: mhc_id, + num_parallel_calls=tf.data.AUTOTUNE) + labels_only_ds = raw_ds.map(lambda _, label, __: label, + num_parallel_calls=tf.data.AUTOTUNE) + + return ds, ids_ds, labels_only_ds +# ---------------------------------------------------------------------------- +# get cross latent npy +# ---------------------------------------------------------------------------- +def save_cross_latent_npy(cross_latent_model, ds, run_dir: str, name: str = "cross_latents_fold_{fold_id}", mhc_ids: np.ndarray = None, labels_only: np.ndarray = None): + cross_latents = cross_latent_model.predict(ds, verbose=0) + save_path = os.path.join(run_dir, f'{name}.npz') + # Prepare data for saving + if mhc_ids is not None or labels_only is not None: + if isinstance(mhc_ids, tf.data.Dataset): + mhc_ids = np.array(list(mhc_ids.as_numpy_iterator())) + if isinstance(labels_only, tf.data.Dataset): + labels_only = np.array(list(labels_only.as_numpy_iterator())) + if isinstance(cross_latents, tf.Tensor): + cross_latents = cross_latents.numpy() + savez_kwargs = {'cross_latents': cross_latents} + if mhc_ids is not None: + savez_kwargs['mhc_ids'] = mhc_ids + if labels_only is not None: + savez_kwargs['labels'] = labels_only + np.savez(save_path, **savez_kwargs) + else: + np.save(save_path.replace('.npz', '.npy'), cross_latents) + # ---------------------------------------------------------------------------- # Visualization utilities (keeping the same as original) # ---------------------------------------------------------------------------- @@ -377,7 +425,7 @@ def plot_training_curve(history: tf.keras.callbacks.History, run_dir: str, fold_ # Sample a subset for confusion matrix to avoid memory issues sample_dataset = val_dataset.take(100) # Take only 100 batches y_pred_proba = model.predict(sample_dataset, verbose=0) - y_pred = (y_pred_proba > 0.5).astype(int) + y_pred = (y_pred_proba > 0.8).astype(int) y_true = [] for _, labels in sample_dataset: @@ -413,13 +461,15 @@ def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, y_pred_proba_list = [] for batch_x, batch_y in test_dataset: - batch_pred = model.predict(batch_x, verbose=0) - y_true_list.append(batch_y.numpy()) - y_pred_proba_list.append(batch_pred.flatten()) + batch_pred = model.predict(batch_x, verbose=0).flatten() + batch_y_np = batch_y.numpy().flatten() + mask = ~np.isnan(batch_y_np) + y_true_list.append(batch_y_np[mask]) + y_pred_proba_list.append(batch_pred[mask]) y_true = np.concatenate(y_true_list).flatten() y_pred_proba = np.concatenate(y_pred_proba_list) - y_pred = (y_pred_proba > 0.5).astype(int) + y_pred = (y_pred_proba > 0.8).astype(int) # Calculate ROC curve fpr, tpr, _ = roc_curve(y_true, y_pred_proba) @@ -510,13 +560,13 @@ def plot_test_metrics(model, test_dataset, run_dir: str, fold_id: int = None, } def plot_attn(att_model, val_loader, run_dir: str, fold_id: int = None): + """Generate and save attention heatmaps for 5 samples.""" # ------------------------------------------------------------- - # ATTENTION VISUALISATION – take ONE batch from validation + # ATTENTION VISUALISATION – take ONE batch from validation # ------------------------------------------------------------- - (pep_ex, mhc_ex), _ = next(iter(val_loader)) # first batch + (pep_ex, mhc_ex), labels = next(iter(val_loader)) # first batch att_scores = att_model.predict([pep_ex, mhc_ex], verbose=0) print("attn_scores", att_scores.shape) - print("attn_scores first 5 samples:", att_scores[:5]) # save attention scores if fold_id is None: fold_id = 0 @@ -530,20 +580,49 @@ def plot_attn(att_model, val_loader, run_dir: str, fold_id: int = None): # att_scores shape : (B, heads, pep_len, mhc_len) att_mean = att_scores.mean(axis=1) # (B,pep,mhc) print("att_mean shape:", att_mean.shape) - sample_id = 0 - A = att_mean[sample_id] - A = A.transpose() - plt.figure(figsize=(8, 6)) - sns.heatmap(A, - cmap = "viridis", - xticklabels = [f"P{j}" for j in range(A.shape[1])], - yticklabels = [f"M{i}" for i in range(A.shape[0])], - cbar_kws = {"label": "attention"}) - plt.title(f"Fold {fold_id} – attention sample {sample_id}") - out_png = os.path.join(run_dir,f"attention_fold{fold_id}_sample{sample_id}.png") - plt.savefig(out_png, dpi=300, bbox_inches="tight") - plt.close() - print(f"✓ Attention heat-map saved to {out_png}") + # Find positive and negative samples + labels_np = labels.numpy().flatten() + pos_indices = np.where(labels_np == 1)[0] + neg_indices = np.where(labels_np == 0)[0] + # Select up to 5 samples (prioritize positive samples, then use negative if needed) + num_pos = min(5, len(pos_indices)) + num_neg = min(5 - num_pos, len(neg_indices)) if num_pos < 5 else 0 + selected_pos = pos_indices[:num_pos] + selected_neg = neg_indices[:num_neg] if num_neg > 0 else [] + selected_samples = list(selected_pos) + list(selected_neg) + print(f"Plotting attention maps for {len(selected_pos)} positive and {len(selected_neg)} negative samples") + # Generate heatmaps for each selected sample + for i, sample_id in enumerate(selected_samples[:5]): + sample_type = "Positive" if sample_id in pos_indices else "Negative" + A = att_mean[sample_id] + A = A.transpose() + plt.figure(figsize=(8, 6)) + ax = sns.heatmap( + A, + cmap="viridis", + xticklabels=[ + AA[pep_ex[sample_id][j].numpy().argmax()] if float(tf.reduce_sum(pep_ex[sample_id][j])) > 0 else "" + for j in range(A.shape[1]) + ], + yticklabels=[f"M{i}" for i in range(A.shape[0])], + cbar_kws={"label": "attention"}, + linewidths=0.1, # Add lines between cells + linecolor='black', # White lines for better contrast + linestyle=':' # Dashed lines + ) + # Improve labels and title + plt.xlabel("Peptide Position (Amino Acid)") + plt.ylabel("MHC Position") + plt.title(f"Fold {fold_id} - Attention Heatmap\nSample {sample_id} ({sample_type} Example)") + # Add box around the entire heatmap + for _, spine in ax.spines.items(): + spine.set_visible(True) + spine.set_linewidth(2) + out_png = os.path.join(run_dir, f"attention_fold{fold_id}_sample{sample_id}_{sample_type.lower()}.png") + plt.tight_layout() + plt.savefig(out_png, dpi=300, bbox_inches="tight") + plt.close() + print(f"✓ Attention heat-map {i+1}/5 saved to {out_png}") # ---------------------------------------------------------------------------- @@ -586,7 +665,7 @@ def main(argv=None): # Find maximum peptide length across all datasets max_peptide_length = 0 - max_mhc_length = 36 # Fixed for now + max_mhc_length = 50 print("Scanning datasets for maximum peptide length...") all_parquet_files = [ @@ -625,37 +704,55 @@ def main(argv=None): print(f" Class weights: {cw}") # Create streaming datasets - train_ds = (create_streaming_dataset(train_path, max_peptide_length, max_mhc_length, + train_ds, val_ids, train_labels_copy = create_streaming_dataset(train_path, max_peptide_length, max_mhc_length, buffer_size=args.buffer_size) + train_ds = (train_ds .shuffle(buffer_size=args.buffer_size, reshuffle_each_iteration=True) .batch(args.batch) .take(args.test_batches) .prefetch(tf.data.AUTOTUNE)) - val_ds = (create_streaming_dataset(val_path, max_peptide_length, max_mhc_length, + train_ids = np.asarray(val_ids) + train_labels_copy = np.asarray(train_labels_copy) + + + val_ds, val_ids, val_labels_copy = create_streaming_dataset(val_path, max_peptide_length, max_mhc_length, buffer_size=args.buffer_size) - .batch(args.batch) - .take(args.test_batches) - .prefetch(tf.data.AUTOTUNE)) + val_ds = (val_ds + .batch(args.batch) + .take(args.test_batches) + .prefetch(tf.data.AUTOTUNE)) + folds.append((train_ds, val_ds)) class_weights.append(cw) + val_ids = np.asarray(val_ids) + val_labels_copy = np.asarray(val_labels_copy) + # Force cleanup cleanup_memory() # Create test datasets print("Creating test datasets...") - test1_ds = (create_streaming_dataset(os.path.join(args.dataset_path, "test1.parquet"), + test1_ds, test1_ids, test1_labels_copy = create_streaming_dataset(os.path.join(args.dataset_path, "test1.parquet"), max_peptide_length, max_mhc_length, buffer_size=args.buffer_size) + test1_ds = (test1_ds .batch(args.batch) .prefetch(tf.data.AUTOTUNE)) - test2_ds = (create_streaming_dataset(os.path.join(args.dataset_path, "test2.parquet"), + test1_ids = np.array(list(test1_ids.as_numpy_iterator())) + test1_labels_copy = np.array(list(test1_labels_copy.as_numpy_iterator())) + + test2_ds, test2_ids, test2_labels_copy = create_streaming_dataset(os.path.join(args.dataset_path, "test2.parquet"), max_peptide_length, max_mhc_length, buffer_size=args.buffer_size) + test2_ds = (test2_ds .batch(args.batch) .prefetch(tf.data.AUTOTUNE)) + test2_ids = np.array(list(test2_ids.as_numpy_iterator())) + test2_labels_copy = np.array(list(test2_labels_copy.as_numpy_iterator())) + print(f"✓ Created {n_folds} fold datasets and 2 test datasets") print("Memory after dataset creation:") monitor_memory() @@ -673,7 +770,7 @@ def main(argv=None): # Build fresh model for each fold print("Building model...") - model, attn_model = build_classifier(max_peptide_length,max_mhc_length) + model, attn_model, cross_latent_model = build_classifier(max_peptide_length,max_mhc_length) model.summary() # Callbacks @@ -735,6 +832,10 @@ def main(argv=None): print("Evaluating on test2 (rare alleles)...") plot_test_metrics(model, test2_ds, run_dir, fold_id, string="Test2_rare_alleles") + # save cross_latents for test1 and test2 + save_cross_latent_npy(cross_latent_model, test1_ds, run_dir, name=f"cross_latent_test1_fold_{fold_id}", mhc_ids=test1_ids, labels_only=test1_labels_copy) + save_cross_latent_npy(cross_latent_model, test2_ds, run_dir, name=f"cross_latent_test2_fold_{fold_id}", mhc_ids=test2_ids, labels_only=test2_labels_copy) + print(f"✅ Fold {fold_id} completed successfully") # Cleanup @@ -747,12 +848,12 @@ def main(argv=None): if __name__ == "__main__": BUFFER = 8192 # Reduced buffer size for memory efficiency - MHC_CLASS = 2 - dataset_path = f"../data/Custom_dataset/NetMHCpan_dataset/mhc_{MHC_CLASS}" + MHC_CLASS = 1 + dataset_path = f"../data/Custom_dataset/PMGen_sequences/mhc_{MHC_CLASS}" main([ "--dataset_path", dataset_path, - "--epochs", "10", - "--batch", "32", + "--epochs", "3", + "--batch", "128", "--buffer_size", "8192", - "--test_batches", "500", + "--test_batches", "1000", ]) \ No newline at end of file From 96d6dd28977d078208a472abe7850c598dcd41cf Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 26 Jun 2025 15:52:58 +0200 Subject: [PATCH 78/83] refactor: improve attention mechanism with padding handling and mask integration --- src/model3.py | 74 ++++++++++++++++++++++++++++----------------------- 1 file changed, 41 insertions(+), 33 deletions(-) diff --git a/src/model3.py b/src/model3.py index 1f9d5865e..ce290d26e 100644 --- a/src/model3.py +++ b/src/model3.py @@ -22,39 +22,15 @@ AA = "ACDEFGHIKLMNPQRSTVWY" AA_TO_INT = {a:i for i,a in enumerate(AA)} UNK = 20 # index for “unknown” +PAD_TOKEN = -2 # set manually to avoid confusion with UNK def onehot(seq: str, max_len: int) -> np.ndarray: """Return (max_len,21) one-hot matrix.""" - mat = np.zeros((max_len, 21), dtype=np.float32) + mat = np.full((max_len, 21), PAD_TOKEN, dtype=np.float32) # initialize padding with -2 for i, aa in enumerate(seq[:max_len]): mat[i, AA_TO_INT.get(aa, UNK)] = 1.0 return mat -# def toy_batch(batch_size=32, -# pep_max=14, -# mhc_max=36, -# mhc_dim=1152): -# """Synthetic (peptide, mhc, label) batch.""" -# peps, mhcs, labels = [], [], [] -# for _ in range(batch_size): -# # random peptide ----------------------------------------------------- -# Lp = np.random.randint(8, pep_max+1) -# pep = ''.join(np.random.choice(list(AA), Lp)) -# peps.append(onehot(pep, pep_max)) # (pep_max,21) -# -# # random MHC latent -------------------------------------------------- -# Lm = np.random.randint(20, mhc_max+1) -# mhc_lat = np.random.randn(Lm, mhc_dim).astype(np.float32) -# pad_mhc = np.zeros((mhc_max, mhc_dim), dtype=np.float32) -# pad_mhc[:Lm] = mhc_lat -# mhcs.append(pad_mhc) # (mhc_max,1152) -# -# # RANDOM label (replace by real NetMHCpan label in practice) --------- -# labels.append([np.random.randint(0,2)]) -# -# return (np.stack(peps), np.stack(mhcs), np.asarray(labels, np.float32)) - - # -------------------------------------------------------------------------------- # 2. Model building block: cross-attention with score output # -------------------------------------------------------------------------------- @@ -78,6 +54,8 @@ def onehot(seq: str, max_len: int) -> np.ndarray: # --------------------------------------------------------------------- def cross_att_block(query, # (B,pep_len,D) context, # (B,mhc_len,D) + query_mask=None, # (B,pep_len) + context_mask=None, # (B,mhc_len) heads=8, name="xatt"): """ @@ -90,9 +68,16 @@ def cross_att_block(query, # (B,pep_len,D) key_dim=query.shape[-1], name=name) + # Create attention mask if both query_mask and context_mask are provided + if query_mask is not None and context_mask is not None: + attn_mask = query_mask[:, :, None] & context_mask[:, None, :] # (B, pep_len, mhc_len) + else: + attn_mask = None + att_out, att_scores = mha(query=query, value=context, key=context, + attention_mask=attn_mask, return_attention_scores=True) return att_out, att_scores @@ -104,7 +89,6 @@ def build_classifier(max_pep_len : int, max_mhc_len : int, pep_emb_dim : int = 64, mhc_emb_dim : int = 64, - mhc_latent_dim : int = 1152, heads : int = 8): """ Returns @@ -115,6 +99,10 @@ def build_classifier(max_pep_len : int, inp_pep = keras.Input(shape=(max_pep_len, 21), name="pep_onehot") inp_mhc = keras.Input(shape=(max_mhc_len,1152), name="mhc_latent") + # Masks ----------------------------------------------------------- + pep_mask = layers.Lambda(lambda x: tf.reduce_any(x != PAD_TOKEN, axis=-1), name="pep_mask")(inp_pep) + mhc_mask = layers.Lambda(lambda x: tf.reduce_any(x != 0, axis=-1), name="mhc_mask")(inp_mhc) + # Linear projections ---------------------------------------------- pep_emb = layers.Dense(pep_emb_dim, activation=None, name="pep_proj")(inp_pep) # (B,pep_len,D) @@ -136,11 +124,27 @@ def build_classifier(max_pep_len : int, name="mhc_dim_reduction")(mhc_emb) # (B,mhc_len,D) # Cross-attention -------------------------------------------------- - att_pep, att_scores = cross_att_block(pep_emb, mhc_emb, + att_pep, att_scores = cross_att_block(pep_emb, mhc_emb, pep_mask, mhc_mask, heads=heads, name="pep2mhc") # Pool & classifier ----------------------------------------------- - pooled = layers.GlobalAveragePooling1D()(att_pep) + # Mask out padding in peptide for pooling + masked_att_pep = layers.Lambda( + lambda inputs: inputs[0] * tf.expand_dims(tf.cast(inputs[1], tf.float32), axis=-1), + name="mask_pep" + )([att_pep, pep_mask]) + sum_att_pep = layers.Lambda( + lambda x: tf.reduce_sum(x, axis=1), + name="sum_att_pep" + )(masked_att_pep) + num_non_pad = layers.Lambda( + lambda x: tf.reduce_sum(tf.cast(x, tf.float32), axis=1, keepdims=True), + name="num_non_pad" + )(pep_mask) + pooled = layers.Lambda( + lambda inputs: inputs[0] / (inputs[1] + 1e-8), + name="pooled" + )([sum_att_pep, num_non_pad]) x = layers.Dense(32, activation="relu")(pooled) out = layers.Dense(1, activation="sigmoid", name="prob")(x) @@ -153,7 +157,11 @@ def build_classifier(max_pep_len : int, att_model = keras.Model([inp_pep, inp_mhc], att_scores, name="PepMHC_attention") - return clf_model, att_model + # cross latent space projection model ----------------------------- + cross_latent_model = keras.Model([inp_pep, inp_mhc], att_pep, + name="PepMHC_cross_latent") + + return clf_model, att_model, cross_latent_model # -------------------------------------------------------------------------------- @@ -167,17 +175,17 @@ def build_classifier(max_pep_len : int, # BATCH = 64 # STEPS = 4 # keep tiny for a quick sanity run # -# model, att_model = build_classifier(max_pep_len=PEP_MAX, max_mhc_len=MHC_MAX) +# model, att_model, cross_latent_model = build_classifier(max_pep_len=PEP_MAX, max_mhc_len=MHC_MAX) # # print(model.summary(line_length=110)) # # # quick dummy training -------------------------------------------------- # for step in range(STEPS): -# Xp, Xm, y = toy_batch(BATCH, pep_max=PEP_MAX, mhc_max=MHC_MAX) +# Xp, Xm, y = toy_batch_masked(BATCH, pep_max=PEP_MAX, mhc_max=MHC_MAX) # model.train_on_batch([Xp,Xm], y) # # # one inference batch & attention --------------------------------------- -# Xp_test, Xm_test, y_test = toy_batch(8, pep_max=PEP_MAX, mhc_max=MHC_MAX) +# Xp_test, Xm_test, y_test = toy_batch_masked(8, pep_max=PEP_MAX, mhc_max=MHC_MAX) # preds = model.predict([Xp_test, Xm_test]) # att_scores = att_model.predict([Xp_test, Xm_test]) # (B,heads,pep_len,mhc_len) # From 66f7bd9019ec7413ae54e6e749295e955144afa0 Mon Sep 17 00:00:00 2001 From: amirreza Date: Thu, 26 Jun 2025 15:53:05 +0200 Subject: [PATCH 79/83] refactor: update dataset creation for PMGen compatibility and enhance allele normalization --- utils/create_ESM_dataset.py | 321 ++++++++++++++++++++++++++---------- 1 file changed, 233 insertions(+), 88 deletions(-) diff --git a/utils/create_ESM_dataset.py b/utils/create_ESM_dataset.py index 6201ba36a..aacb31bae 100644 --- a/utils/create_ESM_dataset.py +++ b/utils/create_ESM_dataset.py @@ -14,16 +14,16 @@ import pandas as pd from tqdm import tqdm # progress bars from typing import Dict -from processing_functions import create_progressive_k_fold_cross_validation, create_k_fold_leave_one_out_stratified_cv +from processing_functions import create_progressive_k_fold_cross_validation, create_k_fold_leave_one_out_stratified_cv, normalize_netmhcpan_allele_to_pmgen # --------------------------------------------------------------------- # 1. CONFIGURATION – adjust if your paths change # --------------------------------------------------------------------- -dataset_name = "NetMHCpan_dataset" -mhc_class = 1 -CSV_PATH = pathlib.Path(f"../data/{dataset_name}/combined_data_{mhc_class}.csv") +dataset_name = "PMGen_sequences" # "NetMHCpan_dataset" +mhc_class = 2 +CSV_PATH = pathlib.Path(f"../data/NetMHCpan_dataset/combined_data_{mhc_class}.csv") NPZ_PATH = pathlib.Path( - f"../data/ESM/esmc_600m/NetMHCpan pseudoseqs/mhc{mhc_class}_encodings.npz" + f"../data/ESM/esmc_600m/{dataset_name}/mhc{mhc_class}_encodings.npz" ) OUT_PARQUET = pathlib.Path( f"../data/Custom_dataset/{dataset_name}/mhc_{mhc_class}/mhc{mhc_class}_with_esm_embeddings.parquet" @@ -40,7 +40,7 @@ # --------------------------------------------------------------------- -def load_mhc1_embeddings(npz_path: pathlib.Path) -> Dict[str, np.ndarray]: +def load_mhc_embeddings(npz_path: pathlib.Path) -> Dict[str, np.ndarray]: """ Returns {allele_name: 187×1152 tensor}. """ @@ -56,7 +56,7 @@ def load_mhc1_embeddings(npz_path: pathlib.Path) -> Dict[str, np.ndarray]: return emb_dict -def normalise_allele(a: str) -> str: +def normalise_netmhcpan_allele(a: str) -> str: """ Make the allele string format identical to the keys inside the NPZ. Tweak this if your formats differ! @@ -86,6 +86,76 @@ def normalise_allele(a: str) -> str: return a +# def normalise_allele2(a: str) -> tuple[str, str]: +# """ +# Make the allele string format identical to the keys inside the NPZ. +# Tweak this if your formats differ! +# """ +# # remove * and : from the allele name +# # and convert to upper case +# # e.g. "HLA-A*01:01" -> "HLA-A0101" +# # e.g. "HLA-A*01:01:01" -> "HLA-A010101" +# # remove spaces +# # e.g. "HLA-A 01:01" -> "HLA-A0101" +# a = a.strip() +# if "HLA-DRA/" in a: +# # eg. "HLA-DRA/HLA-DRB1_0401" -> a: "HLA-DRA1_0401" b: "HLA-DRB1_0401" +# # For heterodimers, take the second chain and format as e.g. DRB10101 +# _, second = a.split("/", 1) +# b = second.replace("HLA-", "") +# a = b.replace("HLA-DRB1_", "HLA-DRA1_") +# return a, b +# +# # TODO fix later +# # elif "mice-" in a: +# # _, second = a.split("/", 1) +# # a = second.replace("mice-", "") +# # return a, a +# +# else: +# a = a.replace("/HLA", "") +# # remove "*" and spaces +# a = a.replace("*", "").replace(" ", "") +# return a, None + + +def normalise_allele_NetMHCPan_toPMGen(a: str) -> tuple[str, str]: + a = a.strip() + # remove : * _ from the allele name + # e.g. "HLA-A*01:01" -> "HLA-A0101" + + # + if ":" in a: + # remove ":" from the allele name + # e.g. "HLA-A*01:01" -> "HLA-A0101" + a = a.replace(":", "") + if "HLA-DRA/" in a: + _, second = a.split("/", 1) + b = second.replace("HLA-", "").replace("*", "").replace(" ", "") + a1 = b.replace("HLA-DRB1_", "HLA-DRA1_") + return a1, b + if "_" in a: + name, digits = a.split("_", 1) + name = name.upper() + if not name.startswith("HLA-"): + name = f"HLA-{name}" + return f"{name}{digits}", None + if "BoLa-" in a: + # eg. "BoLa-1*04:01" -> "BOLA-10401" + prefix, rest = a.split("-", 1) + prefix = prefix.replace("BoLa", "BOLA").upper() + digits = rest.replace("*", "").replace(":", "") + return f"{prefix}{digits}", None + if "*" in a: + prefix, rest = a.split("*", 1) + prefix = prefix.upper() + digits = rest.replace(":", "") + return f"{prefix}{digits}", None + + return a, None + + + def attach_embeddings( df: pd.DataFrame, emb_dict: Dict[str, np.ndarray], @@ -103,9 +173,72 @@ def attach_embeddings( out_dir.mkdir(parents=True, exist_ok=True) paths, embeds = [], [] - for allele in tqdm(df["allele"], desc="Attaching embeddings"): - key = normalise_allele(allele) + # Extract unique alleles + unique_alleles = df["allele"].unique() + print(f"Processing {len(unique_alleles)} unique alleles...") + allele_to_key_map = {} + allele_to_emb_map = {} + + # Process each unique allele once + for allele in tqdm(unique_alleles, desc="Creating allele mapping"): + key = normalise_netmhcpan_allele(allele) emb = emb_dict.get(key) + + if emb is None: + if mhc_class == 2: + key1, key2 = normalize_netmhcpan_allele_to_pmgen(allele) + print(key1, key2) + emb1 = emb_dict.get(key1) + emb2 = emb_dict.get(key2) + if emb1 is not None and emb2 is not None: + try: + emb = np.concatenate([emb1, emb2], axis=0) + except ValueError as e: + print(f"Error concatenating embeddings for {allele}: {e}") + emb = None + elif emb1 is not None: + emb = emb1 + elif emb2 is not None: + emb = emb2 + else: + print(f"No embedding found for {allele} (keys tried: {key1}, {key2})") + emb = None + # # Try to find the first chain + # prefix_matches1 = [k for k in emb_dict if k.startswith(key1)] if key1 else [] + # if key2 is not None: + # # Try to find the second chain + # prefix_matches2 = [k for k in emb_dict if k.startswith(key2)] + # if prefix_matches1 and prefix_matches2: + # key = max(prefix_matches1, key=len) + # print(f"{allele} -> {key}") + # emb = emb_dict.get(key) + # if emb is None: + # key = max(prefix_matches2, key=len) + # print(f"{allele} -> {key}") + # emb = emb_dict.get(key) + # else: + # key = max(prefix_matches1, key=len) if prefix_matches1 else None + # print(f"{allele} -> {key}") + # emb = emb_dict.get(key) + else: + key1, _ = normalize_netmhcpan_allele_to_pmgen(allele) + print(key1) + # # find exact prefix matches for longer names + # prefix_matches = [k for k in emb_dict if k.startswith(key1)] + # if prefix_matches: + # key = max(prefix_matches, key=len) + print(f"{allele} -> {key1}") + emb = emb_dict.get(key1) + + allele_to_key_map[allele] = key + allele_to_emb_map[allele] = emb + + # Now use the maps for all rows + paths, embeds = [], [] + for allele in tqdm(df["allele"], desc="Attaching embeddings"): + key = allele_to_key_map.get(allele) + emb = allele_to_emb_map.get(allele) + if emb is None: paths.append(None) embeds.append(None) @@ -211,87 +344,93 @@ def create_test_set(df: pd.DataFrame, bench_df= pd.DataFrame, samples_per_label: def main() -> None: - # print("→ Loading cleaned NetMHCpan CSV") - # df = pd.read_csv( - # CSV_PATH, - # usecols=["long_mer", "assigned_label", "allele", "mhc_class"], - # ) - # - # # filter out - # df = df[df["mhc_class"] == mhc_class] - # - # print(len(df), "rows in the dataset after filtering for MHC class", mhc_class) - # - # # drop mhc_class column - # df = df.drop(columns=["mhc_class"]) - # - # print(f"→ Loading MHC class {mhc_class} embeddings") - # emb_dict = load_mhc1_embeddings(NPZ_PATH) - # - # print("→ Merging") - # df = attach_embeddings(df, emb_dict, EMB_OUT_DIR) - # - # print(len(df), "rows in the dataset after filtering for Mer") - # - # # print("→ Dropping duplicates and nones") - # df = df.drop_duplicates(subset=["long_mer", "allele"]) - # df = df.dropna(subset=["long_mer"]) - # - # print(len(df), "rows in the dataset after dropping duplicates and Nones") - # - # # move the label column to the end - # label_col = "assigned_label" - # cols = [col for col in df.columns if col != label_col] + [label_col] - # df = df[cols] - # - # print(len(df), "rows in the dataset after dropping duplicates and Nones") - # - # print(f"→ Writing parquet to {OUT_PARQUET}") - # df.to_parquet(OUT_PARQUET, engine="pyarrow", index=False, compression="zstd") - # - # print(f"→ Dataset shape: {df.shape}") - # - # - # # load benchmark datasets - # # bench_df1 = pd.read_csv( - # # "../data/Custom_dataset/benchmark_Conbot.csv", - # # usecols=["long_mer", "binding_label", "allele", "mhc_class"], - # # # rename columns to match the main dataset - # # dtype={"binding_label": "int8", "allele": "string", "mhc_class": "int8"}, - # # names=["long_mer", "assigned_label", "allele", "mhc_class"], - # # # convert binding_label to assigned_label - # # converters={"assigned_label": lambda x: 1 if x == "1" else 0}, - # # ) + print("→ Loading cleaned NetMHCpan CSV") + df = pd.read_csv( + CSV_PATH, + usecols=["long_mer", "assigned_label", "allele", "mhc_class"], + ) + + # filter out + df = df[df["mhc_class"] == mhc_class] + + print(len(df), "rows in the dataset after filtering for MHC class", mhc_class) + + # drop mhc_class column + df = df.drop(columns=["mhc_class"]) + + print(f"→ Loading MHC class {mhc_class} embeddings") + emb_dict = load_mhc_embeddings(NPZ_PATH) + + # save keys to a text file + emb_keys_path = NPZ_PATH.parent / f"mhc{mhc_class}_emb_keys.txt" + with open(emb_keys_path, "w") as f: + for key in emb_dict.keys(): + f.write(f"{key}\n") + + print("→ Merging") + df = attach_embeddings(df, emb_dict, EMB_OUT_DIR) + + print(len(df), "rows in the dataset after filtering for Mer") + + # print("→ Dropping duplicates and nones") + df = df.drop_duplicates(subset=["long_mer", "allele"]) + df = df.dropna(subset=["long_mer"]) + + print(len(df), "rows in the dataset after dropping duplicates and Nones") + + # move the label column to the end + label_col = "assigned_label" + cols = [col for col in df.columns if col != label_col] + [label_col] + df = df[cols] + + print(len(df), "rows in the dataset after dropping duplicates and Nones") + + print(f"→ Writing parquet to {OUT_PARQUET}") + df.to_parquet(OUT_PARQUET, engine="pyarrow", index=False, compression="zstd") + + print(f"→ Dataset shape: {df.shape}") + + + # load benchmark datasets # bench_df1 = pd.read_csv( - # "../data/Custom_dataset/benchmark_Conbot.csv") - # # rename columns to match the main dataset - # bench_df1 = bench_df1.rename(columns={ - # "binding_label": "assigned_label", - # }) - # # ensure the assigned_label is of type int - # bench_df1['assigned_label'] = bench_df1['assigned_label'].astype(int) - # # ensure the allele is of type string - # bench_df1['allele'] = bench_df1['allele'].astype(str) - # # convert II to 2 # and I to 1 - # bench_df1['mhc_class'] = bench_df1['mhc_class'].replace({"II": 2, "I": 1}) - # - # print(bench_df1.columns) - # # TODO process later - # bench_df2 = pd.read_csv( - # "../data/Custom_dataset/benchmark_ConvNeXT.csv", - # usecols=["allele"], - # + # "../data/Custom_dataset/benchmark_Conbot.csv", + # usecols=["long_mer", "binding_label", "allele", "mhc_class"], + # # rename columns to match the main dataset + # dtype={"binding_label": "int8", "allele": "string", "mhc_class": "int8"}, + # names=["long_mer", "assigned_label", "allele", "mhc_class"], + # # convert binding_label to assigned_label + # converters={"assigned_label": lambda x: 1 if x == "1" else 0}, # ) - # - # # combine benchmark datasets - # bench_df = pd.concat([bench_df1, bench_df2], ignore_index=True) - # - # print("→ Create and save test sets") - # datasets = create_test_set(df, bench_df) - # for name, subset in datasets.items(): - # print(f"{name.capitalize()} set shape: {subset.shape}") - # if name != "train": - # subset.to_parquet(OUT_PARQUET.parent / f"{name}.parquet", index=False, engine="pyarrow", compression="zstd") + bench_df1 = pd.read_csv( + "../data/Custom_dataset/benchmark_Conbot.csv") + # rename columns to match the main dataset + bench_df1 = bench_df1.rename(columns={ + "binding_label": "assigned_label", + }) + # ensure the assigned_label is of type int + bench_df1['assigned_label'] = bench_df1['assigned_label'].astype(int) + # ensure the allele is of type string + bench_df1['allele'] = bench_df1['allele'].astype(str) + # convert II to 2 # and I to 1 + bench_df1['mhc_class'] = bench_df1['mhc_class'].replace({"II": 2, "I": 1}) + + print(bench_df1.columns) + # TODO process later + bench_df2 = pd.read_csv( + "../data/Custom_dataset/benchmark_ConvNeXT.csv", + usecols=["allele"], + + ) + + # combine benchmark datasets + bench_df = pd.concat([bench_df1, bench_df2], ignore_index=True) + + print("→ Create and save test sets") + datasets = create_test_set(df, bench_df) + for name, subset in datasets.items(): + print(f"{name.capitalize()} set shape: {subset.shape}") + if name != "train": + subset.to_parquet(OUT_PARQUET.parent / f"{name}.parquet", index=False, engine="pyarrow", compression="zstd") ### # TODO remove later @@ -300,6 +439,12 @@ def main() -> None: datasets['train'] = pd.read_parquet(OUT_PARQUET, engine="pyarrow") ### + # Drop NaNs before converting to int + print("→ number of rows in train set before normalization:", len(datasets['train'])) + datasets['train'] = datasets['train'].dropna(subset=['assigned_label', 'allele']) + print("→ number of rows in train set after normalization:", len(datasets['train'])) + datasets['train']['assigned_label'] = datasets['train']['assigned_label'].astype(int) + print("→ Creating cross-validation folds") folds = create_k_fold_leave_one_out_stratified_cv( datasets['train'], From b5fde3995369a0c8a9427b7035616ff534980208 Mon Sep 17 00:00:00 2001 From: amirreza Date: Fri, 27 Jun 2025 16:49:32 +0200 Subject: [PATCH 80/83] refactor: enhance t-SNE and UMAP visualizations with improved color mapping and optional display --- src/run_SCQ_VAE.py | 125 +++++++++++++++++++++++++++++++++------------ 1 file changed, 93 insertions(+), 32 deletions(-) diff --git a/src/run_SCQ_VAE.py b/src/run_SCQ_VAE.py index 850a6c733..6c0ae8a65 100644 --- a/src/run_SCQ_VAE.py +++ b/src/run_SCQ_VAE.py @@ -359,8 +359,12 @@ def plot_cluster_distribution(soft_cluster_probs, save_path=None, visualize=True plt.close() return used_clusters, usage_percentage -def plot_tsne_umap(cross_latents, mhc_ids, labels, save_path=None): +def plot_tsne_umap(cross_latents, mhc_ids, labels, save_path=None, visualize=True): """Plot t-SNE and UMAP visualizations of the cross-latents.""" + # Handle dimensions if cross_latents is 3D (reshape to 2D) + if cross_latents.ndim > 2: + cross_latents = cross_latents.reshape(cross_latents.shape[0], -1) + # Standardize the data scaler = StandardScaler() cross_latents_scaled = scaler.fit_transform(cross_latents) @@ -369,25 +373,70 @@ def plot_tsne_umap(cross_latents, mhc_ids, labels, save_path=None): tsne = TSNE(n_components=2, random_state=random_state) tsne_results = tsne.fit_transform(cross_latents_scaled) - # Plotting - import matplotlib.pyplot as plt + # UMAP + reducer = umap.UMAP(random_state=random_state) + umap_results = reducer.fit_transform(cross_latents_scaled) - plt.figure(figsize=(12, 6)) + # Plotting + plt.figure(figsize=(18, 9)) + + # Determine color source + color_source = labels + color_label = 'Labels' + + if labels is None or (isinstance(labels, np.ndarray) and len(labels) == 0): + if mhc_ids is not None and len(mhc_ids) > 0: + # Convert string MHC IDs to categorical indices if needed + if isinstance(mhc_ids[0], (str, bytes)): + unique_mhcs = np.unique(mhc_ids) + mhc_to_index = {mhc: i for i, mhc in enumerate(unique_mhcs)} + color_source = np.array([mhc_to_index[mhc] for mhc in mhc_ids]) + else: + color_source = mhc_ids + color_label = 'MHC IDs' + else: + # No coloring available + color_source = None # t-SNE plot plt.subplot(1, 2, 1) - plt.scatter(tsne_results[:, 0], tsne_results[:, 1], c=labels, cmap='viridis', s=5) + if color_source is not None: + sc = plt.scatter(tsne_results[:, 0], tsne_results[:, 1], c=color_source, cmap='viridis', s=5, alpha=0.7) + plt.colorbar(sc, label=color_label) + else: + plt.scatter(tsne_results[:, 0], tsne_results[:, 1], s=5, alpha=0.7) + plt.title('t-SNE Visualization') - plt.colorbar(label='Labels') + plt.xlabel('t-SNE Component 1') + plt.ylabel('t-SNE Component 2') + plt.grid(True, linestyle='--', alpha=0.7) + + # UMAP plot + plt.subplot(1, 2, 2) + if color_source is not None: + sc = plt.scatter(umap_results[:, 0], umap_results[:, 1], c=color_source, cmap='viridis', s=5, alpha=0.7) + plt.colorbar(sc, label=color_label) + else: + plt.scatter(umap_results[:, 0], umap_results[:, 1], s=5, alpha=0.7) + + plt.title('UMAP Visualization') + plt.xlabel('UMAP Component 1') + plt.ylabel('UMAP Component 2') + plt.grid(True, linestyle='--', alpha=0.7) + + plt.tight_layout() if save_path: - plt.savefig(save_path) + plt.savefig(save_path, dpi=150, bbox_inches='tight') print(f"Plots saved to {save_path}") - plt.show() + if visualize: + plt.show() + else: + plt.close() -def plot_PCA(cross_latents, mhc_ids=None, labels=None, save_path=None): +def plot_PCA(cross_latents, mhc_ids=None, labels=None, save_path=None, color_map_name="MHC IDs"): """Plot PCA visualization of the cross-latents with optional label highlighting.""" # reduce dimensions if necessary @@ -417,7 +466,7 @@ def plot_PCA(cross_latents, mhc_ids=None, labels=None, save_path=None): # Plot using the numeric encoding sc = plt.scatter(pca_results[:, 0], pca_results[:, 1], c=numeric_mhc_ids, cmap='viridis', s=5) - plt.colorbar(sc, label='MHC IDs') + plt.colorbar(sc, label=color_map_name) # If not too many unique MHCs, add a legend if len(unique_mhcs) <= 20: @@ -449,7 +498,7 @@ def plot_PCA(cross_latents, mhc_ids=None, labels=None, save_path=None): # Add a legend entry for positive labels plt.legend(loc='upper right') - plt.title('PCA Visualization (Red circles: Positive Labels)') + plt.title('PCA Visualization (orange circles: Positive Labels)') else: plt.title('PCA Visualization (No positive labels found)') else: @@ -475,6 +524,7 @@ def process_and_save(dataset: tf.data.Dataset, Quantize `dataset` through `model`, assemble into a DataFrame, save to parquet, and plot distributions with split-specific filenames. """ + original = [] quantized_latents = [] cluster_indices_soft = [] cluster_indices_hard = [] @@ -487,6 +537,8 @@ def process_and_save(dataset: tf.data.Dataset, cluster_indices_soft.append(out_P_proj.numpy()) cluster_indices_hard.append(tf.argmax(out_P_proj, axis=-1).numpy()) labels.append(batch_y.numpy()) + # Store original sequences if available + original.append(batch_X.numpy()) # Concatenate across batches quantized_latent = np.concatenate(quantized_latents, axis=0) @@ -529,8 +581,8 @@ def process_and_save(dataset: tf.data.Dataset, print(f"[{split_name}] saved parquet → {parquet_path}") # Plot distributions - plot_cluster_distribution(soft_probs, - save_path=os.path.join(output_dir, f'cluster_distribution_soft_{split_name}.png')) + # plot_cluster_distribution(soft_probs, + # save_path=os.path.join(output_dir, f'cluster_distribution_soft_{split_name}.png')) plot_codebook_usage(hard_assign, num_embeddings, save_path=os.path.join(output_dir, f'codebook_usage_{split_name}.png')) plot_soft_cluster_distribution(soft_probs, 20, @@ -543,7 +595,7 @@ def process_and_save(dataset: tf.data.Dataset, plot_PCA(quantized_latent, save_path=os.path.join(output_dir, f'quantized_latents_pca_{split_name}.png'), mhc_ids=mhc_ids, - labels=labels) # Add labels parameter + labels=labels,) # Add labels parameter @@ -551,8 +603,20 @@ def process_and_save(dataset: tf.data.Dataset, plot_PCA(quantized_latent, save_path=os.path.join(output_dir, f'quantized_latents_pca_hard_{split_name}.png'), mhc_ids=hard_assign.flatten(), - labels=labels) # Add labels parameter + labels=labels, + color_map_name="Cluster IDs") # Add labels parameter + # visualize t-SNE and UMAP + plot_tsne_umap(quantized_latent, mhc_ids=hard_assign.flatten(), labels=labels, + save_path=os.path.join(output_dir, f'quantized_latents_tsne_umap_{split_name}.png')) + print(f"[{split_name}] processed and saved quantized outputs with {len(df)} records.") + + # visualize reconstructions + plot_reconstructions(quantized_latents[0][:5], # First 5 samples) + original[0][:5], # First 5 samples + n_samples=5, + save_path=os.path.join(output_dir, f'reconstructions_{split_name}.png'), + visualize=False) # Set visualize to False to save without showing def main(): @@ -575,15 +639,17 @@ def main(): print("Cross-latents shape:", cross_latents.shape) # flatten the cross_latents to ensure they are 2D (N, seq_length * embedding_dim) cross_latents = cross_latents.reshape(cross_latents.shape[0], -1) # Flatten to (N, seq_length * embedding_dim) + # cross_latents = cross_latents.mean(axis=1) # Average across the sequence length dimension seq_length = cross_latents.shape[1] # Length of the sequences val_latents, val_mhc_ids, val_labels = load_cross_latents_data(val_file) if val_latents is not None: print("Validation cross-latents shape:", val_latents.shape) - val_latents = val_latents.reshape(val_latents.shape[0], -1) + val_data = val_latents.reshape(val_latents.shape[0], -1) + # val_data = val_latents.mean(axis=1) else: print("No validation data found, proceeding without validation set.") - val_latents, val_mhc_ids, val_labels = None, None, None + val_data, val_mhc_ids, val_labels = None, None, None # --- Create TensorFlow Dataset --- @@ -604,6 +670,8 @@ def main(): print("Visualizing raw cross-latents data with PCA...") plot_PCA(cross_latents, mhc_ids, save_path=os.path.join(save_dir, 'cross_latents_pca.png'), labels=labels) print("Visualizing cross-latents data with t-SNE and UMAP...") + plot_tsne_umap(cross_latents, mhc_ids, labels, save_path=os.path.join(save_dir, 'cross_latents_tsne_umap.png')) + print("Cross-latents data visualization completed.") # --- Initialize Codebook --- print("Initializing codebook with k-means...") @@ -628,6 +696,7 @@ def main(): num_embeddings=num_embeddings, embedding_dim=embedding_dim, commitment_beta=commitment_beta, + initial_codebook=codebook_init, scq_params={ 'lambda_reg': 1.0, 'discrete_loss': False, @@ -646,7 +715,7 @@ def main(): start_time = time.time() history = model.fit( dataset_train, - validation_data=val_latents, + validation_data=val_data, epochs=epochs, ) end_time = time.time() @@ -658,27 +727,19 @@ def main(): model.save(model_save_path) print("Model saved successfully.") - # --- Evaluate the Model --- + # --- Visualize Results --- print("Evaluating the model...") - val_latents = None - val_dataset = None - if val_latents is not None: - val_dataset = create_dataset(val_latents, val_labels).batch(batch_size) + process_and_save(dataset, 'train', model, save_dir, num_embeddings, mhc_ids) + if val_data is not None: + val_dataset = create_dataset(val_data, val_labels).batch(batch_size) evaluation_results = model.evaluate(val_dataset) print(f"Validation Loss: {evaluation_results[0]}, Validation Accuracy: {evaluation_results[1]}") + print("Visualizing results...") + process_and_save(val_dataset, 'val', model, save_dir, num_embeddings, val_mhc_ids) else: print("No validation data provided, skipping evaluation.") print("Model evaluation completed.") - # --- Visualize Results --- - print("Visualizing results...") - process_and_save(dataset, 'train', model, save_dir, num_embeddings, mhc_ids) - if val_dataset is not None: - process_and_save(val_dataset, 'val', model, save_dir, num_embeddings, val_mhc_ids) - - print("Results visualization is not implemented yet.") - print("End-to-end training completed successfully.") - print("You can now proceed with further analysis or visualization of the model outputs.") # --- End of Main Function --- if __name__ == "__main__": From 071ac86ff11cb49af9b2ce9c1ff48d01ae378b41 Mon Sep 17 00:00:00 2001 From: amirreza Date: Fri, 27 Jun 2025 16:49:38 +0200 Subject: [PATCH 81/83] refactor: update MHC class and adjust training parameters for improved performance --- src/run_model3.py | 6 +++--- 1 file changed, 3 insertions(+), 3 deletions(-) diff --git a/src/run_model3.py b/src/run_model3.py index 46caa40fc..35a2fcfad 100644 --- a/src/run_model3.py +++ b/src/run_model3.py @@ -848,12 +848,12 @@ def main(argv=None): if __name__ == "__main__": BUFFER = 8192 # Reduced buffer size for memory efficiency - MHC_CLASS = 1 + MHC_CLASS = 2 dataset_path = f"../data/Custom_dataset/PMGen_sequences/mhc_{MHC_CLASS}" main([ "--dataset_path", dataset_path, - "--epochs", "3", + "--epochs", "5", "--batch", "128", "--buffer_size", "8192", - "--test_batches", "1000", + "--test_batches", "2000", ]) \ No newline at end of file From 31b532ed5f03f203cd348da18db46c2c2116cb98 Mon Sep 17 00:00:00 2001 From: amirreza Date: Mon, 30 Jun 2025 14:07:55 +0200 Subject: [PATCH 82/83] refactor: enhance CSV reading and embedding process with MHC class filtering and noise augmentation --- run_ESM.py | 69 ++++++++++++++++++++++++++++++++++++++++++------------ 1 file changed, 54 insertions(+), 15 deletions(-) diff --git a/run_ESM.py b/run_ESM.py index a2832c43e..e5534c655 100644 --- a/run_ESM.py +++ b/run_ESM.py @@ -28,7 +28,6 @@ import pandas as pd import tqdm import csv - ############################################################################### # --------------------------- I/O utilities --------------------------------- ############################################################################### @@ -54,19 +53,21 @@ def read_dat(path: str) -> List[Tuple[str, str]]: return seqs -def read_csv(path: str = [0, 1]) -> List[Tuple[str, ...]]: +def read_csv(path: str, mhc_class: int): seqs: List[Tuple[str, ...]] = [] - selected_cols = ["simple_allele", "sequence", "mhc_types"] + selected_cols = ["simple_allele", "sequence", "mhc_types", "repres_pseudo_positions"] file = pd.read_csv(path, sep=",", usecols=selected_cols) - file = file[file["mhc_types"] == 1] + file = file[file["mhc_types"] == mhc_class] print(file.columns) # convert simple allele, remove * and : to mtach with netmhcpan file[selected_cols[0]] = file[selected_cols[0]].str.replace("*", "") file[selected_cols[0]] = file[selected_cols[0]].str.replace(":", "") + # convert pseudosequence positions to list of integers (convert string to list split by ;) + pseudoseq_indices = file[selected_cols[3]].apply(lambda x: [int(i) for i in x.split(";") if i.isdigit()]) # return as list of tuples for index, row in file.iterrows(): seqs.append((row[selected_cols[0]], row[selected_cols[1]])) - return seqs + return seqs, pseudoseq_indices.tolist() ############################################################################### # ------------- Local model loader (ESM-C, ESM-2, ESM3-open) ---------------- @@ -210,21 +211,32 @@ def main(**local_args): parser.add_argument("--pooling", choices=["mean", "cls"], default="mean") parser.add_argument("--remote", action="store_true", help="Use cloud API") parser.add_argument("--api_token", default=os.getenv("ESM_API_TOKEN"), help="Forge/NIM token") + parser.add_argument("--mhc_class", type=int, default=1, help="MHC class (1 or 2) for CSV input") + parser.add_argument("--filter_ps", action="store_true", help="Filter out pseudosequence positions") + parser.add_argument("--noise_augmentation", choices=["Gaussian", None], default=None, + help="Add Gaussian noise to embeddings (10% of std_dev)") args = parser.parse_args() seqs = None + pseudoseq_indices = None if args.input.endswith(".csv"): - seqs = read_csv(args.input) + seqs, pseudoseq_indices = read_csv(args.input, mhc_class=args.mhc_class) elif args.input.endswith(".dat"): seqs = read_dat(args.input) if not seqs: sys.exit("No sequences found!") + # Generate embeddings and filter out pseudosequence positions if needed if args.remote: if args.api_token is None: sys.exit("Provide --api_token or set ESM_API_TOKEN") client = load_remote_client(args.model, args.api_token) embeddings = embed_remote(client, seqs, args.batch_size, args.pooling) + if args.filter_ps: + print("Filtering out pseudosequence positions...") + # select embedding indexes equal to the values in the pseudosequence positions + #TODO + print("embeddings with", args.model) sequences = {seq_id: seq for seq_id, seq in seqs} else: @@ -235,13 +247,35 @@ def main(**local_args): # print first 5 sequences print("First 5 sequences:", seqs[:5]) embeddings = {} - for seq_id, seq in tqdm.tqdm(seqs, desc="Embedding sequences"): - embeddings[seq_id] = embed_one(seq) + for idx, (seq_id, seq) in enumerate(tqdm.tqdm(seqs, desc="Embedding sequences")): + emb = embed_one(seq) + if noise_augmentation is not None: + if noise_augmentation == "Gaussian": + # determine the noise based on the embeddings value range + # calculate the standard deviation of the embedding + std_dev = np.std(emb) + noise = np.random.normal(0, std_dev * 0.1, emb.shape) # 10% of std_dev + emb += noise + else: + raise ValueError(f"Unknown noise augmentation: {noise_augmentation}") + embeddings[seq_id] = emb + # print shape of the embedding + # print(f"Embedding shape for {seq_id}: {embeddings[seq_id].shape}") # (sequence_length, embedding_dim) + if args.filter_ps: + print("Filtering out pseudosequence positions...") + # select embedding indexes equal to the values in the pseudosequence positions + if pseudoseq_indices: + # filter out positions in the sequence that are in the pseudosequence positions + embeddings[seq_id] = embeddings[seq_id][pseudoseq_indices[idx]] + print("Filtered embedding shape for", seq_id, ":", embeddings[seq_id].shape) + sequences = {seq_id: seq for seq_id, seq in seqs} # ------------------ save ------------------ out_path = pathlib.Path(args.outfile) + # make directory if it does not exist + out_path.parent.mkdir(parents=True, exist_ok=True) if out_path.suffix == ".npz": np.savez_compressed(out_path, **embeddings) # create a .csv file and save the sequences @@ -263,16 +297,21 @@ def main(**local_args): if __name__ == "__main__": - # example run - model = "esmc_600m" # "esm3-98b-2024-08" "esm3_sm_open_v1", "esm3-open" - # dat_path = "data/NetMHCpan_dataset/NetMHCpan_train/MHC_pseudo.dat" - dat_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/pseudosequence.2016.all.X.dat" - # dat_path = "data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv" - out_path = "data/ESM/mhc2_encodings.npz" + # Config: + mhc_class = 1 # 1 for MHC-I, 2 for MHC-II + model = "esmc_600m" # "esm3-98b-2024-08" "esm3_sm_open_v1", "esm3-open", "esmc_300m", "esmc_600m" + filter_out_pseudoseq_positions = False # filter out positions with pseudosequence in MHC-I and MHC-II + noise_augmentation = "Gaussian" # None + # Input: + dat_path = "data/NetMHCpan_dataset/NetMHCpan_train/MHC_pseudo.dat" # for MHC-I + # dat_path = "data/NetMHCpan_dataset/NetMHCIIpan_train/pseudosequence.2016.all.X.dat" # for MHC-II + # dat_path = "data/HLA_alleles/pseudoseqs/PMGen_pseudoseq.csv" # for both MHC-I and MHC-II + out_path = "data/ESM/NetMHCpan_dataset/esmc_600m/mhc1_encodings.npz" remote = False device = "cuda:0" if torch.cuda.is_available() else "cpu" batch_size = 1 pooling = "mean" # run the script main(input=dat_path, model=model, outfile=out_path, remote=remote, - device=device, batch_size=batch_size, pooling=pooling) + device=device, batch_size=batch_size, pooling=pooling, mhc_class=mhc_class, filter_ps=filter_out_pseudoseq_positions, + noise_augmentation=noise_augmentation) From 331c9688e9b5ccd2f17e698bc292a6791b2d8f27 Mon Sep 17 00:00:00 2001 From: amirreza Date: Mon, 30 Jun 2025 14:08:06 +0200 Subject: [PATCH 83/83] refactor: update dataset creation to load and save benchmark datasets with ESM embeddings --- utils/create_ESM_dataset.py | 47 +++++++++++++++++++++++++++---------- 1 file changed, 35 insertions(+), 12 deletions(-) diff --git a/utils/create_ESM_dataset.py b/utils/create_ESM_dataset.py index aacb31bae..28b358987 100644 --- a/utils/create_ESM_dataset.py +++ b/utils/create_ESM_dataset.py @@ -19,14 +19,18 @@ # --------------------------------------------------------------------- # 1. CONFIGURATION – adjust if your paths change # --------------------------------------------------------------------- -dataset_name = "PMGen_sequences" # "NetMHCpan_dataset" -mhc_class = 2 -CSV_PATH = pathlib.Path(f"../data/NetMHCpan_dataset/combined_data_{mhc_class}.csv") +dataset_name = "NetMHCpan_dataset" # "PMGen_sequences" # "NetMHCpan_dataset" +mhc_class = 1 +CSV_PATH = pathlib.Path(f"../data/NetMHCpan_dataset/combined_data_{mhc_class}.csv") # Training dataset NPZ_PATH = pathlib.Path( f"../data/ESM/esmc_600m/{dataset_name}/mhc{mhc_class}_encodings.npz" ) OUT_PARQUET = pathlib.Path( f"../data/Custom_dataset/{dataset_name}/mhc_{mhc_class}/mhc{mhc_class}_with_esm_embeddings.parquet" +) # Training dataset with ESM embeddings + +BENCHMARKS_PATH = pathlib.Path( + f"../data/Custom_dataset/benchmarks/mhc_{mhc_class}" ) # If you want to *save* each array as its own .npy rather than store the @@ -392,15 +396,27 @@ def main() -> None: # load benchmark datasets - # bench_df1 = pd.read_csv( - # "../data/Custom_dataset/benchmark_Conbot.csv", - # usecols=["long_mer", "binding_label", "allele", "mhc_class"], - # # rename columns to match the main dataset - # dtype={"binding_label": "int8", "allele": "string", "mhc_class": "int8"}, - # names=["long_mer", "assigned_label", "allele", "mhc_class"], - # # convert binding_label to assigned_label - # converters={"assigned_label": lambda x: 1 if x == "1" else 0}, - # ) + # for folder in path and for file in folder read them, then save them in (OUT_PARQUET.parent / "benchmarks").mkdir(parents=True, exist_ok=True) + # with benchmark_{file_name}.parquet + + # load and save benchmark datasets + benchmarks_dir = OUT_PARQUET.parent / "benchmarks" + benchmarks_dir.mkdir(parents=True, exist_ok=True) + + for folder in BENCHMARKS_PATH.iterdir(): + if not folder.is_dir(): + continue + for csv_file in folder.glob("*.csv"): + print(f"Loading benchmark dataset {csv_file.name}") + tmp = pd.read_csv(csv_file, usecols=["long_mer", "assigned_label", "allele", "mhc_class"]) + tmp["assigned_label"] = tmp["assigned_label"].astype(int) + tmp["allele"] = tmp["allele"].astype(str) + tmp["long_mer"] = tmp["long_mer"].astype(str) + tmp = attach_embeddings(tmp, emb_dict, EMB_OUT_DIR) + out_path = benchmarks_dir / f"benchmark_{csv_file.stem}.parquet" + tmp.to_parquet(out_path, index=False, engine="pyarrow", compression="zstd") + print(f"Saved benchmark to {out_path}") + bench_df1 = pd.read_csv( "../data/Custom_dataset/benchmark_Conbot.csv") # rename columns to match the main dataset @@ -475,6 +491,13 @@ def main() -> None: with open(held_out_ids_path, "a") as f: f.write(f"Fold {fold_id}: {ids_str}\n") + + # save only positive labels to a separate file + pos_labels = datasets['train'][datasets['train']['assigned_label'] == 1] + pos_labels_path = OUT_PARQUET.parent / "folds" / "positive_labels.parquet" + pos_labels.to_parquet(pos_labels_path, index=False, engine="pyarrow", compression="zstd") + print(f"Saved positive labels to {pos_labels_path}") + print("✓ Done")