Skip to content

Latest commit

 

History

History
224 lines (156 loc) · 11.8 KB

File metadata and controls

224 lines (156 loc) · 11.8 KB

nail workspace

About

This is a cargo workspace for nail, which is a profile Hidden Markov Model (pHMM) biological sequence alignment tool. Using the fast MMseqs2 search pipeline to produce candidate alignment seeds, nail computes a fast approximation of the HMMER3 Forward/Backward (F/B) sequence alignment algorithm. Currently, nail only supports amino acid search, with nucleotide search coming in a future update.

The nail preprint paper can be found on bioRxiv (doi: https://doi.org/10.1101/2024.01.27.577580).

What's here

There are two sub-projects in the nail workspace:

  1. nail: this is the command line tool
  2. libnail: this is a Rust library that contains the implementation of nail's sparse alignment algorithms

Example input files

A few example input files may be found under the fixtures/ directory at the root of this repository.

$ ls fixtures/
query.fa  target.fa  query.hmm

Dependencies

The nail search pipeline uses the mmseqs search tool as an alignment prefilter. In the future, we will replace this with our own prefiltering strategies.

nail has been tested with MMseqs2 Release 15-6f452. We have not tested nail against other versions of MMseqs2, but they may work.

To run the nail search pipeline, mmseqs search must be available in your system path.

Installation

You can find precompiled binaries for various platforms on the latest release page.

Building from source

To install nail from source, you'll need the Rust development tooling, which means you'll need to install the Rust compiler and Cargo. The easiest way to do that is to use rustup.

Once you've done that, you can clone this repository and build the project with Cargo:

git clone https://github.com/TravisWheelerLab/nail
cd nail/
cargo build --release

You'll then find the compiled binary at: target/release/nail

For example, try running:

target/release/nail -h

Usage

The nail command line interface uses subcommands.

Currently, there is only one subcommand: search

*Note: that may seem a little strange, but we will be adding subcommands in the near future

nail search

The nail search command runs the entire nail pipeline, including running MMseqs2 to find alignment seeds.

The input to nail search is a query file (p7HMM or FASTA) and a target sequence database file (FASTA).

By default, the search results will be written to ./results.tbl in a tabular format, and alignment output is written to stdout. In addition, a collection of temporary files required to run mmseqs search, will be written to the ./tmp/ directory.

For example, when running nail search, you'll see something like:

$ nail search query.hmm target.fa 
reading query database...   done (0.00s)
indexing target database... done (0.00s)
running mmseqs...           done (0.44s)
running nail pipeline...    done (0.16s)    

Checking the results.tbl will look something like:

$ head -n 15 results.bl
#                                                                         target target query query       comp         cell  
# target                                                  query           start  end    start end   score bias evalue  frac  
# ------------------------------------------------------- --------------- ------ ------ ----- ----- ----- ---- ------- ----- 
F1MV99|reviewed|Somatostatin                              7tm_1-consensus 58     306    1     260   175.8 7.5  1.0e-53 0.066
O08858|reviewed|Somatostatin                              7tm_1-consensus 54     303    1     260   173.0 7.8  7.7e-53 0.069
C3ZQF9|reviewed|QRFP-like                                 7tm_1-consensus 64     326    1     260   149.3 8.6  1.3e-45 0.070
O02813|reviewed|Neuropeptide                              7tm_1-consensus 56     319    1     260   147.9 5.4  3.5e-45 0.070
O08565|reviewed|C-X-C                                     7tm_1-consensus 52     299    1     260   145.8 5.3  1.5e-44 0.076
O02835|reviewed|Neuropeptide                              7tm_1-consensus 57     320    1     260   145.7 6.8  1.6e-44 0.071
A0T2N3|reviewed|Apelin                                    7tm_1-consensus 51     316    1     260   145.0 4.3  2.6e-44 0.077
O08726|reviewed|Galanin                                   7tm_1-consensus 42     292    1     260   144.9 4.2  2.8e-44 0.073
O08556|reviewed|C-C                                       7tm_1-consensus 49     299    1     260   144.3 5.3  4.4e-44 0.073
F1R332|reviewed|Galanin                                   7tm_1-consensus 35     286    1     260   143.3 3.8  8.9e-44 0.077
D4A7K7|reviewed|G-protein                                 7tm_1-consensus 44     304    1     260   142.7 4.3  1.3e-43 0.073
E7F7V7|reviewed|Galanin                                   7tm_1-consensus 43     294    1     260   142.6 1.7  1.4e-43 0.073

nail can also produce alignment output if you supply an --ali-out argument:

$ nail search --ali-out results.ali query.hmm target.fa 

Checking the results.ali will look something like:

$ head -n 70 results.ali
query:        7tm_1
target:       O08892|reviewed|5-hydroxytryptamine
query start:  2
query end:    260
target start: 66
target end:   368
score:        257.7
comp bias:    9.3
E-value:      6.3e-79
cell frac:    0.094

==

                              7tm_1     2 NllVilvilrnkklrtptnifllnLavaDllvlllvlpfslvyallegdwvfgevlCklvtaldvvnltasillltaisi 81   
                                          N +Vi++++r++kl+tp+n+++ +La++Dllv++lv+p+s++y++ +g+w++g++lC+++ + d++++tasi++l++i++
O08892|reviewed|5-hydroxytryptamine    66 NAFVIATVYRTRKLHTPANYLIASLAFTDLLVSILVMPISTMYTV-TGRWTLGQALCDFWLSSDITCCTASIMHLCVIAL 144  
                                          9********************************************06*********************************

                              7tm_1    82 DRYlaIvkplkykrirtkrralvlilvvWvlalllslppllfsgtktesaekeetvClidfpeeestwevsytlllsvlg 161  
                                          DRY+aI+ ++ y+++rt+rra+ +i++vWv+++++slpp+++++ k e   +e+  Cl+++++      v yt++++ ++
O08892|reviewed|5-hydroxytryptamine   145 DRYWAITDAVGYSAKRTPRRAAGMIALVWVFSICISLPPFFWRQAKAE---EEVLDCLVNTDH------VLYTVYSTGGA 215  
                                          *****************************************777666500099******99990000009**********

                              7tm_1   162 fllpllvilvcyvrilrtlrksakkeks.................................................... 189  
                                          f+lp+l+++ +y ri+ ++r++  k++                                                     
O08892|reviewed|5-hydroxytryptamine   216 FYLPTLLLIALYGRIYVEARSRILKQTPNKTGKRLTRAQLITDSPGSTSSVTSINSRAPEVPCDSGSPVYVNQVKVRVSD 295  
                                          ***********************9999899999999999999999999********************************

                              7tm_1   190 ....rkkksarkerkalktllvvvvvfvlcwlPyfilllldsllkeceseklve.tallitlllayvnsclNPiiY 260  
                                              +kk +a++erka+ktl+v++++f++cwlP+fi++l++ +   c++ +  + ++++++++l+y+ns++NPiiY
O08892|reviewed|5-hydroxytryptamine   296 ALLEKKKLMAARERKATKTLGVILGAFIVCWLPFFIISLVMPI---CKDACWFHMAIFDFFTWLGYLNSLINPIIY 368  
                                          ***9999************************************000777666551666******************

//

query:        7tm_1
target:       O02666|reviewed|Alpha-1D
query start:  1
query end:    260
target start: 118
target end:   407
score:        255.6
comp bias:    5.5
E-value:      2.8e-78
cell frac:    0.061

==

                   7tm_1     1 gNllVilvilrnkklrtptnifllnLavaDllvlllvlpfslvyallegdwvfgevlCklvtaldvvnltasillltais 80   
                               gNllVil +++n++l+t+tn+f++nLavaDll++++vlpfs++ ++l g w fg+++C+++ a+dv+++tasil+l+ is
O02666|reviewed|Alpha-1D   118 GNLLVILSVACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVL-GFWAFGRAFCDVWAAVDVLCCTASILSLCTIS 196  
                               8*********************************************70********************************

                   7tm_1    81 iDRYlaIvkplkykrirtkrralvlilvvWvlalllslppllfsgtktesaekeetvClidfpeeestwevsytlllsvl 160  
                               +DRY+ + + lky++i+t r+a++++++ W++al++s+ pll  g+k+  +  +e++C i+ +         y++++s++
O02666|reviewed|Alpha-1D   197 VDRYVGVRHSLKYPAIMTERKAAAILALLWAVALVVSMGPLL--GWKEPVP-PDERFCGITEEV-------GYAVFSSLC 266  
                               ******************************************00677776609*******87650000000*********

                   7tm_1   161 gfllpllvilvcyvrilrtlrksakkeks............................................rkkksar 196  
                               +f+lp+ vi+v+y+r++  +r++ ++ +                                              +  +++
O02666|reviewed|Alpha-1D   267 SFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKASEVVLRIHCRGAASGADGAPGTRGAKGHTFRSSLSVRLLKFS 346  
                               ***************************99999999999999999999999999999999999999999999986677778

                   7tm_1   197 kerkalktllvvvvvfvlcwlPyfilllldsllkeceseklvetallitlllayvnsclNPiiY 260  
                               +e+ka+ktl++vv+vfvlcw+P+f++l l sl    ++ k +e +++++ +l+y+nsc+NP+iY
O02666|reviewed|Alpha-1D   347 REKKAAKTLAIVVGVFVLCWFPFFFVLPLGSL---FPQLKPSEGVFKVIFWLGYFNSCVNPLIY 407  
                               899*****************************0009****************************

//

...
...
...

nail seeds

If you run nail search --only-seed command, nail will run MMseqs2, produce a seeds.tsv file, and terminate. This may be useful if you would like to experiment with different nail settings using the same seeds.

For example:

$ nail search --only-seed query.hmm target.fa

You can also save the seeds from a full run of the nail search pipeline by supplying a --seeds-out argument:

$ nail search --seeds-out seeds.tsv query.hmm target.fa

Seeds can be provided to nail search using the --seeds <seeds.tsv> flag, which will skip the seed step in the search pipeline.

$ nail search --seeds seeds.tsv query.hmm target.fa

In practice, these seeds may be produced from any source; the input file just needs to be a tsv of the following shape:

query target query start query end target start target end score E-value
query1 target1 5 247 54 302 189 3.660E-55
query1 target2 12 255 58 305 187 1.281E-54
query1 target3 3 263 51 315 182 7.499E-53
query1 target4 18 240 43 325 176 8.188E-51
query2 target5 7 238 579 838 183 2.854E-53
query2 target6 2 262 570 829 181 9.992E-53
query2 target7 15 244 573 832 181 9.992E-53
query2 target8 9 233 581 840 181 9.992E-53
query3 target9 4 118 192 324 125 1.899E-35
query3 target10 10 141 204 336 124 3.571E-35
query3 target11 6 122 190 322 123 1.732E-34

We plan to make the use of custom seeds more robust in the future.

License

nail is licensed under the BSD-3-Clause license.

See LICENSE for details.

Authors

Jack Roddy - jroddy@arizona.edu